Patent classifications
A23B4/00
Antibacterial method
The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.
METHOD FOR CREATING SMOKED FOODS AND BEVERAGES
The present invention is a method and system for making smoke beverages and foods using multiple condensation stages.
METHOD FOR CREATING SMOKED FOODS AND BEVERAGES
The present invention is a method and system for making smoke beverages and foods using multiple condensation stages.
TEXTURE MODIFIED FOOD PRODUCT
The invention is directed broadly to a method of preparing a texture modified food product for consumption by a dysphagic consumer, comprising the steps: (a) providing a cooked fish or meat; (b) comminuting the cooked fish or meat to form a paste; and (c) forming the paste into the texture modified food product shaped and textured to a generic serve of the fish or meat selected to form the paste.
Method for creating smoked foods and beverages
The present invention is a method and system for making smoke beverages and foods using multiple condensation stages.
Food discoloration inhibitor
A food discoloration inhibitor contains, as an effective ingredient, a low molecular weight lignin having a molecular weight peak in a molecular weight range of 4,000 to 9,500 and/or a high molecular weight lignin having a molecular weight peak in a molecular weight range of 10,000 to 40,000, wherein the molecular weight peak is measured at a wavelength of 254 nm by GPC molecular weight analysis using an UV detector.
Food discoloration inhibitor
A food discoloration inhibitor contains, as an effective ingredient, a low molecular weight lignin having a molecular weight peak in a molecular weight range of 4,000 to 9,500 and/or a high molecular weight lignin having a molecular weight peak in a molecular weight range of 10,000 to 40,000, wherein the molecular weight peak is measured at a wavelength of 254 nm by GPC molecular weight analysis using an UV detector.
Food preservation method, food film, food container, and food handling method
A food preserving method is a method for preserving food using a food film (34A), (34B). The food film (34A), (34B) has a surface which has a plurality of raised portions (34Ap), (34Bp). The two-dimensional size of the plurality of raised portions (34Ap), (34Bp) is in a range of more than 20 nm and less than 500 nm when viewed in a direction normal to the food film (34A), (34B). The method includes bringing the food into direct contact with the surface.
Food preservation method, food film, food container, and food handling method
A food preserving method is a method for preserving food using a food film (34A), (34B). The food film (34A), (34B) has a surface which has a plurality of raised portions (34Ap), (34Bp). The two-dimensional size of the plurality of raised portions (34Ap), (34Bp) is in a range of more than 20 nm and less than 500 nm when viewed in a direction normal to the food film (34A), (34B). The method includes bringing the food into direct contact with the surface.
Auger Dip Apparatus for Applying Antimicrobial Solution
Embodiments of the present disclosure provide an auger dip apparatus for the application of antimicrobial solution to raw food. Embodiments of the present disclosure may use an auger as a single moving part to move the food work pieces through the application area for antimicrobial solution. Embodiments of the present disclosure are simple with only one moving auger part to move the food pieces, and the bearing for the moving part, supporting the shaft of the auger, may be configured to be outside of the cabinet with the reservoir of the antimicrobial solution, so that the bearing is not in contact with the antimicrobial solution. This provides for less maintenance and downtime, particularly unscheduled downtime, than a system using more complicated exposed parts. The present disclosure also permits a more compact and lighter configuration for an assembled application unit.