The present invention is directed to a method of inactivating virus that is present during production of a polypeptide of interest. In particular, the present invention is directed to a method of on-column virus inactivation using a low pH and high salt wash solution that effectively inactivates viruses with minimum recovery loss of the polypeptide.

The present invention relates to a wound healing PVA sponge dressing using negative capillary pressure of the dressing material together with auxiliary negative pressure for wound treatment. The PVA sponge dressing is pretreated with gram positive and gram negative biocidal 5 dyes for insertion into or over a wound. A negative pressure pump is mounted to the PVA sponge dressing to produce additional capillary pressure for withdrawing fluid or water vapor from the sponge dressing and a cover is mounted over the sponge material and negative pressure pump forming a unitary sealed package for placement over a wound.

Stable formulations for a dimeric naphthalimide coating and preparation methods for forming said coating, dimeric naphthalimide coated articles, as well as sterilization and storage-stable packaging thereof.

A medical packaging device, packaging system, method for producing a packaging device, and method for sterile packaging of a sieve basket with a packaging device. The packaging device defines a receiving space for accommodating a sieve basket in a packaging position, and an insertion opening for inserting a sieve basket into the receiving space. The insertion opening is open in an insertion position. The packaging device is made from a flat material sheet that is folded multiple times. The receiving space has two abutting receiving space flat material sheet surface regions. The regions are delimited by at least three fold lines of the flat material sheet such that the receiving space is closed on all sides except for the insertion opening. The packaging device includes an unfolding securing device for securing the packaging device in the insertion position against being completely unfolded back into the starting position.

The present disclosure in one aspect provides a sterile packaging container comprising a container body with a cross-sectional shape that is constant along the majority of the longitudinal axis, a cover and a closure assembly that inhibits the passage of microbial contaminants. The container is configured such that the interior of the container can be sterilized. The sterile packaging container described herein allows one to manufacture a sterile packaging tube exercising the smallest possible volume.

The present invention relates to a sponge dressing for treating wounds comprised of a polymer sponge containing a plurality of antimicrobial dyes with at least one dye being gram positive and at least one other dye being gram negative and a silicon adhesive secured to a sponge surface. The sponge dressing can be exposed initially to gamma radiation and later sterilized by ethylene oxide or alternatively it can be sterilized by ethylene oxide and later irradiated by gamma radiation. The sponge dressing has a morphology characterized by an average pore throat diameter of 0.5-500 μm and a porosity ranging from about 60% to about 99.5%. The sponge dressing can also contain at least one biofilm reducing agent, at least one chelating agent and an ionic and non-ionic surfactant.

Products, compositions, systems, and methods for modifying a target structure which mediates or is associated with a biological activity, including treatment of conditions, disorders, or diseases mediated by or associated with a target structure, such as a virus, cell, subcellular structure or extracellular structure. The methods may be performed in situ in a non-invasive manner by placing a nanoparticle having a metallic shell on at least a fraction of a surface in a vicinity of a target structure in a subject and applying an initiation energy to a subject thus producing an effect on or change to the target structure directly or via a modulation agent. The nanoparticle is configured, upon exposure to a first wavelength λ.sub.1, to generate a second wavelength λ.sub.2 of radiation having a higher energy than the first wavelength λ.sub.1. The methods may further be performed by application of an initiation energy to a subject in situ to activate a pharmaceutical agent directly or via an energy modulation agent, optionally in the presence of one or more plasmonics active agents, thus producing an effect on or change to the target structure. Kits containing products or compositions formulated or configured and systems for use in practicing these methods.

The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.

Storage stable aqueous ready-to-administer formulations comprising isoproterenol are presented with desirable stability characteristics. In preferred aspects, formulations are terminally sterilized and packaged in a suitable format, such as a polymeric bag with metalized overwrap and include a non-contact oxygen scavenger.

Compositions and methods are provided for treating an article that is susceptible to contamination by an antimicrobial-resistant microorganism, wherein the susceptible article is exposed to an optimized electric current or field. Methods to treat an individual in need of therapy are also provided, including for example, individuals having a bacterial, viral, fungal, or parasitic infection, or individuals having an antimicrobial-resistant microbial infection, e.g., in a wound, by applying a predetermined electric current to the individual. The methods disclosed herein can be used in conjunction with a therapeutic pharmaceutical composition comprising an antimicrobial agent such as an antifungal or antibiotic pharmaceutical.