A23L3/16

COMPOSITION FOR DEGRADATION OF MYCOTOXIN COMPRISING ASPERGILLUS CULTURE FILTRATE CONTAINING IRON COMPOUND OR YEAST EXTRACT AS EFFECTIVE COMPONENT AND USES THEREOF
20220127562 · 2022-04-28 ·

A composition for degradation of mycotoxin including, as an effective component, Aspergillus culture filtrate which contains an iron compound or yeast extract, and uses thereof, are proposed. As aflatoxin can be degraded with high efficiency and simple composition by the composition of the present invention and the activity of degrading mycotoxin is maintained in very stable state in a broad temperature range of from room temperature to heating at 121° C. for sterilization, it is expected that the composition can be advantageously used for processing like heating at high temperatures.

Methods for making mixed allergen compositions

Methods of making mixed allergen products are provided, wherein the mixed allergen products are substantially free of replication viable organisms.

ISOTONIC HIGH-ENERGY SPORTS GELS

The invention relates to a isotonic nutritional composition in gel form comprising at least 40 wt % of one or more partially hydrolyzed starch having a dextrose equivalent (DE) of from 0.5 to 4 and an amylose content below 5 wt % of the partially hydrolyzed starch. The partially hydrolyzed starch is preferably derived from a waxy starch, more preferably from a waxy corn starch, a waxy wheat starch, a waxy potato starch or the like.

ISOTONIC HIGH-ENERGY SPORTS GELS

The invention relates to a isotonic nutritional composition in gel form comprising at least 40 wt % of one or more partially hydrolyzed starch having a dextrose equivalent (DE) of from 0.5 to 4 and an amylose content below 5 wt % of the partially hydrolyzed starch. The partially hydrolyzed starch is preferably derived from a waxy starch, more preferably from a waxy corn starch, a waxy wheat starch, a waxy potato starch or the like.

Connecting kit and product feed unit comprising the kit

A kit for connecting to a processing container a device for feeding a liquid or semi-liquid food product, including at least: an internally hollow pipe having a first end and a second end, wherein at least one between the first and the second end includes an enlarged, external terminal portion; a receiving element provided with a hole for receiving at least the enlarged, external terminal portion at one end of the pipe and with an abutment for stopping the end of the pipe inside the hole; a pushing portion for pushing and locking the enlarged, external terminal portion at the end inside the receiving hole in order to allow locking the enlarged, external terminal portion against the abutment.

Advanced oxidative process for microbial reduction
11178890 · 2021-11-23 · ·

Disclosed is system for inactivating bacteria and/or reducing microbial count on product, in particular a food product, susceptible to microbial presence, said system comprising a processing chamber which is operably connected to i) a means for generating UV-C light, ii) a means for generating hydrogen peroxide vapor and/or means for generating ozone, and iii) a heat source. Also disclosed is a method for inactivating bacteria and/or reducing microbial count on a product, in particular food product, which is susceptible to microbial presence, said method comprising subjecting said product in a processing chamber to exposure with ultraviolet C (UV-C) light and hydrogen peroxide vapor and/or ozone, and heat, for a processing time of between 5-120 seconds, wherein the hydrogen peroxide vapor is present at up to 12% v/v solution, and the temperature inside the processing chamber is maintained between about 22° C. and 60° C.

Advanced oxidative process for microbial reduction
11178890 · 2021-11-23 · ·

Disclosed is system for inactivating bacteria and/or reducing microbial count on product, in particular a food product, susceptible to microbial presence, said system comprising a processing chamber which is operably connected to i) a means for generating UV-C light, ii) a means for generating hydrogen peroxide vapor and/or means for generating ozone, and iii) a heat source. Also disclosed is a method for inactivating bacteria and/or reducing microbial count on a product, in particular food product, which is susceptible to microbial presence, said method comprising subjecting said product in a processing chamber to exposure with ultraviolet C (UV-C) light and hydrogen peroxide vapor and/or ozone, and heat, for a processing time of between 5-120 seconds, wherein the hydrogen peroxide vapor is present at up to 12% v/v solution, and the temperature inside the processing chamber is maintained between about 22° C. and 60° C.

BEVERAGE COMPOSITION CONTAINING CHLORELLA FREE OF CHLOROPHYLL AND PREPARATION METHOD THEREFOR
20230309582 · 2023-10-05 · ·

Provided are a beverage composition comprising: chlorophyll-deficient Chlorella; a specific gum as a stabilizer; and an aqueous liquid medium and a process for preparing the same, wherein the beverage composition exhibits excellent dispersion stability without precipitation, and prevent the browning phenomenon occurring in a sterilization process.

Antibacterial method

The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.

Pasteurisation of microbial biomass suitable for food applications

The invention relates to a method for pasteurising a biomass, for example a fungal biomass, wherein the biomass is pasteurised using specific time and temperature parameters to obtain pasteurised biomass. The pasteurised biomass is suitable for use as a source of single-cell proteins in food products. The invention also relates to the pasteurised product, and to food products comprising it.