A61L2/16

Method and system for treating a surface
11161139 · 2021-11-02 · ·

A method of applying a treatment to a surface of an open body having a volume within an interior of the open body comprises; providing an inner structure (110) shaped to complement the shape of the interior of the open body and to fill a major portion of the volume or a major portion of a width of the interior of the open body; positioning the inner structure (110) within the open body in order to form a treatment fluid inner volume comprising an inner space (150) confronting an inner surface within the interior of the open body; and introducing a treatment fluid into the treatment fluid inner volume to thereby modify the inner surface of the open body by applying the treatment using the treatment fluid. Optionally, the method includes providing a tank (120) shaped to complement and contain the open body; positioning the open body within the tank (120) in order to form a treatment fluid outer volume comprising an outer space confronting the outer surface of the open body; and introducing the treatment fluid into the treatment fluid outer volume to thereby modify the outer surface of the open body by applying the treatment using the treatment fluid.

FOOD BIOPRESERVATIVE COMPOSITION AND USES THEREOF
20230329287 · 2023-10-19 ·

The invention relates to a food biopreservative composition comprising a consortium of lactic acid bacteria comprising at least one homofermentative lactic acid bacteria; at least one heterofermentative lactic acid bacteria and an activating agent. The biopreservative composition inhibits the growth of pathogens such as Salmonella, E. coli, Staphylococcus aureus, Listeria monocytogenes, Aspergillus niger and Aspergillus flavus and can prolong the shelf-life of processed and unprocessed food.

FOOD BIOPRESERVATIVE COMPOSITION AND USES THEREOF
20230329287 · 2023-10-19 ·

The invention relates to a food biopreservative composition comprising a consortium of lactic acid bacteria comprising at least one homofermentative lactic acid bacteria; at least one heterofermentative lactic acid bacteria and an activating agent. The biopreservative composition inhibits the growth of pathogens such as Salmonella, E. coli, Staphylococcus aureus, Listeria monocytogenes, Aspergillus niger and Aspergillus flavus and can prolong the shelf-life of processed and unprocessed food.

GENERATION OF PEROXYFORMIC ACID THROUGH POLYHYDRIC ALCOHOL FORMATE

The present invention relates generally to peroxyformic acid forming compositions, methods for forming peroxyformic acid, preferably in situ, using the peroxyformic acid forming compositions. The present invention also relates to the peroxyformic acid formed by the above compositions and methods. The present invention further relates to the uses of the peroxyformic acid, preferably in situ, for treating a surface or a target. The present invention further relates to methods for treating a biofilm using peroxyformic acid, including peroxyformic acid generated in situ.

GENERATION OF PEROXYFORMIC ACID THROUGH POLYHYDRIC ALCOHOL FORMATE

The present invention relates generally to peroxyformic acid forming compositions, methods for forming peroxyformic acid, preferably in situ, using the peroxyformic acid forming compositions. The present invention also relates to the peroxyformic acid formed by the above compositions and methods. The present invention further relates to the uses of the peroxyformic acid, preferably in situ, for treating a surface or a target. The present invention further relates to methods for treating a biofilm using peroxyformic acid, including peroxyformic acid generated in situ.

PHARMACEUTICAL COMPOSITION FOR PREVENTING OR TREATING COVID-19 COMPRISING NANO-SIZED GRAPHENE OXIDE COMPOSITE AND METHOD USING SAME

Provided are a pharmaceutical composition for preventing or treating a coronavirus infection or infectious disease, a composition for disinfection, and a health functional food or feed composition, all including nano-sized graphene oxide, and a method of using the same. Since the nano-sized graphene oxide or a complex thereof has anti-coronavirus activity, the graphene oxide may be used for prevention or treatment of a coronavirus infection, or disinfection of coronaviruses.

Health and safety compliance system, methods, and products

A health and safety compliance system includes processor(s), where the processor(s) are communicatively coupled to a user interface. The user interface includes a display screen, where the display screen is capable of displaying electronic image(s) and is communicatively coupled to the processor(s). The system also includes (i) a sensor unit that is communicatively coupled to the processor(s) and is capable of detecting motion of a user, (ii) a liquid dispensing unit that is communicatively coupled to the processor(s), and (iii) a temperature detection unit that is communicatively coupled to the processor(s).

Health and safety compliance system, methods, and products

A health and safety compliance system includes processor(s), where the processor(s) are communicatively coupled to a user interface. The user interface includes a display screen, where the display screen is capable of displaying electronic image(s) and is communicatively coupled to the processor(s). The system also includes (i) a sensor unit that is communicatively coupled to the processor(s) and is capable of detecting motion of a user, (ii) a liquid dispensing unit that is communicatively coupled to the processor(s), and (iii) a temperature detection unit that is communicatively coupled to the processor(s).

Antibacterial method

The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.

Antibacterial method

The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.