The present application relates to compositions comprising vitamins and/or minerals and a polyphenolic matrix having increased stability and bioavailability. The polyphenolic matrix may comprise a polyphenolic extract, an emulsifier and a binder. The polyphenolic extract may be a fruit peel extract. The present application further relates to uses and methods using the compositions of the application.

The present invention provides, among other things, compositions and methods for CNS delivery of lysosomal enzymes for effective treatment of lysosomal storage diseases. In some embodiments, the present invention includes a stable formulation for direct CNS intrathecal administration comprising a heparan N-sulfatase (HNS) protein, salt, and a polysorbate surfactant for the treatment of Sanfilippo Syndrome Type A.

The present invention relates generally to medicine. More specifically the invention relates to the use of synergistic probiotic bacteria as intervention for health.

In particular, the present invention provides a strain of Faecalibacterium prausnitzii and a bacterial strain which has one or more of the characteristics of: (i) being acetate producing, (ii) being lactate consuming and (iii) having the ability to be an electron acceptor, for use in the treatment or prevention of a disease associated with reduced butyrate levels or a disease associated with reduced or low numbers of Faecalibacterium prausnitzii bacteria.

The invention relates to compounds of formula I: ##STR00001##
where a, R.sup.1, and R.sup.3-6 are as defined in the specification, or a pharmaceutically acceptable salt thereof. The compounds of formula I are serotonin and norepinephrine reuptake inhibitors. The invention also relates to pharmaceutical compositions comprising such compounds; methods of using such compounds; and process and intermediates for preparing such compounds.

Monoclonal antibodies that bind and inhibit the activity of human GDF15 are disclosed. The antibodies can be used to treat body weight loss, including cachexia, associated with the over-expression of human GDF15.

Monoclonal antibodies that bind and inhibit the activity of human GDF15 are disclosed. The antibodies can be used to treat body weight loss, including cachexia, associated with the over-expression of human GDF15.

Methods of treating cancer related conditions using anamorelin are described.

The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders.

Disclosed are powder solid compositions including a hydroalcoholic extract of Bergamot fruit (Citrus aurantium var. bergamia) and at least one phospholipid. Also disclosed is a process for the preparation of the compositions. The compositions are useful for the prevention and/or treatment of dysmetabolic syndromes, dyslipidemias and type 2 diabetes.

The present invention provides a means for suppressing formation and/or proliferation of undesired cells derived from stem cells in a cell population containing cells differentiated from stem cells. The nutrition composition according to the present invention is a nutrition composition for suppressing formation and/or proliferation of undesired cells derived from stem cells in a cell population containing cells differentiated from stem cells, the nutrition composition containing at least one essential amino acid selected from the group consisting of isoleucine, leucine, methionine, lysine, phenylalanine, tryptophan, threonine and histidine except valine, and optionally containing a non-essential amino acid(s).