Provided herein are methods for the treatment of avoiding loss of taste response while treating a chronic cough patient with a selective P2X3 modulator.

A stable liquid composition contained in a bottle wherein the composition comprises from about 0.001% to about 0.5% of phenylephrine hydrochloride, by weight of the stable liquid composition. The composition comprises less than about 0.1% of total aldehydes, by weight of the stable liquid composition, and has a pH from about 2 to about 6.5. The bottle comprises a material selected from polyethylene terephthalate (PET), glycol-modified polyethylene terephthalate (PETG), oriented polypropylene (OPP), polyvinylchloride (PVC), polyvinylidene chloride (PVDC), nylon, polyethylene terephthalate polyester (PETP), or combinations thereof.

Methods for treating cough, chronic cough and urges to cough associated with respiratory diseases with a P2X3 and/or a P2X2/3 receptor antagonist, the methods comprising administering to a subject in need thereof an effective amount of a compound of Formula (I):

##STR00001##

or a pharmaceutically acceptable salt thereof, wherein R.sup.1 and R.sup.2 are as defined herein.

Methods for treating cough, chronic cough and urges to cough associated with respiratory diseases with a P2X3 and/or a P2X2/3 receptor antagonist, the methods comprising administering to a subject in need thereof an effective amount of a compound of Formula (I):

##STR00001##

or a pharmaceutically acceptable salt thereof, wherein R.sup.1 and R.sup.2 are as defined herein.

The present invention provides probiotic compositions suitable for reducing the incidence and duration of human illness. In particular, the present invention provides methods and compositions suitable for preventing disease in young children. In some particularly preferred embodiments, the present invention finds use in the prevention respiratory disease in children.

The disclosed subject matter provides certain polymorphic forms of Compound (I) as well as pharmaceutical compositions comprising Compound (I) or such polymorphic forms, and methods of using or making such compounds and pharmaceutical compositions. It has now been discovered that Compound (I) can exist in multiple crystalline forms (polymorphs). One particular crystalline form, Form II, has been found to be more thermodynamically stable and, thus, likely more suitable for bulk preparation and handling than other polymorphic forms. Efficient and economic methods have been developed to prepare Compound (I) and Form II in high purity on a large scale. In animal studies, Form II has demonstrated safety and efficacy in treating depressive disorders and, when micronized, improved absorption compared to non-micronized Form II.

##STR00001##

The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders.

The present disclosure relates to certain (2S)—N-[(1S)-1-cyano-2-phenylethyl]-1,4-oxazepane-2-carboxamide compounds (including pharmaceutically acceptable salts thereof),

##STR00001##

that inhibit dipeptidyl peptidase 1 (DPP1) activity, to their utility in treating and/or preventing clinical conditions including respiratory diseases, such as asthma and chronic obstructive pulmonary disease (COPD), to their use in therapy, to pharmaceutical compositions containing them and to processes for preparing such compounds.

Provided herein are methods for the treatment of avoiding loss of taste response while treating a chronic cough patient with a selective P2X3 modulator.

Provided herein are methods for the treatment of avoiding loss of taste response while treating a chronic cough patient with a selective P2X3 modulator.