Provided is a kit comprising a first pharmaceutical composition comprising a first cannabinoid and optionally a first terpene and/or a first additive; and a second pharmaceutical composition comprising at least one selected from the group consisting of a second cannabinoid, a second terpene, a second additive and combinations thereof, and uses thereof in the treatment of pelvic pain arising from the female reproductive system. Further provided are methods of treatment of pelvic pain arising from a female reproductive system during a menstrual cycle, the method comprising administering during a first fraction of said menstrual cycle a first pharmaceutical composition comprising a first cannabinoid and optionally a first terpene and/or a first additive, and administering during a second fraction of said menstrual cycle a second pharmaceutical composition comprising at least one selected from the group consisting of a second cannabinoid, a second terpene, a second additive and combinations thereof.

Provided is a kit comprising a first pharmaceutical composition comprising a first cannabinoid and optionally a first terpene and/or a first additive; and a second pharmaceutical composition comprising at least one selected from the group consisting of a second cannabinoid, a second terpene, a second additive and combinations thereof, and uses thereof in the treatment of pelvic pain arising from the female reproductive system. Further provided are methods of treatment of pelvic pain arising from a female reproductive system during a menstrual cycle, the method comprising administering during a first fraction of said menstrual cycle a first pharmaceutical composition comprising a first cannabinoid and optionally a first terpene and/or a first additive, and administering during a second fraction of said menstrual cycle a second pharmaceutical composition comprising at least one selected from the group consisting of a second cannabinoid, a second terpene, a second additive and combinations thereof.

Oral compositions generally, but not exclusively, used for post dental implants that provide low abrasiveness and improved sanitization and protection of dental implants as well as facilitation of tissue regeneration with better active stability and compatibility as well as synergistic effects are described. The oral compositions include one or more mucus regenerators, one or more antiseptic agents, and one or more orally acceptable carrier actives selected from a group of one or more thickeners, one or more humectants, one or more sweeteners, a preservative, one or more surfactants, a film forming agent, a thixotropic agent, a solubilizing agent, a chelating agent, a coloring agent, an anti-tartar agent, an abrasive, an antioxidant agent, a flavoring agent, and a water vehicle, or mixtures thereof.

The disclosed subject matter provides certain polymorphic forms of Compound (I) as well as pharmaceutical compositions comprising Compound (I) or such polymorphic forms, and methods of using or making such compounds and pharmaceutical compositions. It has now been discovered that Compound (I) can exist in multiple crystalline forms (polymorphs). One particular crystalline form, Form II, has been found to be more thermodynamically stable and, thus, likely more suitable for bulk preparation and handling than other polymorphic forms. Efficient and economic methods have been developed to prepare Compound (I) and Form II in high purity on a large scale. In animal studies, Form II has demonstrated safety and efficacy in treating depressive disorders and, when micronized, improved absorption compared to non-micronized Form II.

##STR00001##

Products, compositions, systems, and methods for modifying a target structure which mediates or is associated with a biological activity, including treatment of conditions, disorders, or diseases mediated by or associated with a target structure, such as a virus, cell, subcellular structure or extracellular structure. The methods may be performed in situ in a non-invasive manner by placing a nanoparticle having a metallic shell on at least a fraction of a surface in a vicinity of a target structure in a subject and applying an initiation energy to a subject thus producing an effect on or change to the target structure directly or via a modulation agent. The nanoparticle is configured, upon exposure to a first wavelength λ.sub.1, to generate a second wavelength λ.sub.2 of radiation having a higher energy than the first wavelength λ.sub.1. The methods may further be performed by application of an initiation energy to a subject in situ to activate a pharmaceutical agent directly or via an energy modulation agent, optionally in the presence of one or more plasmonics active agents, thus producing an effect on or change to the target structure. Kits containing products or compositions formulated or configured and systems for use in practicing these methods.

Plant-based medicinal compounds or nutritional supplements in various carrier combinations are described. The carriers can include N-acylated fatty amino acids, penetration enhancers, and/or various other beneficial carriers. The plant-based composition/carrier combinations can create administration benefits.

The present invention provides a strain of Bacteroides thetaiotaomicron and derivatives thereof, and the use of said strain or derivatives in treating inflammatory, autoimmune and allergic disorders. The invention also provides pharmaceutical compositions, nutritional supplements, feedstuffs, food products, dietary supplements, and food additives comprising said strain or derivatives.

The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders.

The present disclosure relates to sustained release drug delivery systems. In some cases, a composition comprises an active pharmaceutical agent; at least one of sucrose acetate isobutyrate and a polyorthoester; an organic solvent; and 2,6-dimethylaniline, wherein the 2,6-dimethylaniline is present at a level less than 500 ppm. In some cases, a composition comprises N-oxide of active pharmaceutical agent at a level less than 1 wt %, based on weight of the composition. In some case, a composition comprises metal present at a level less than 5 ppm. Dosage forms and methods are also provided.

Pharmaceutical compositions of the invention comprise functionalized lactone derivatives having a disease-modifying action in the treatment of diseases associated with dysregulation of 5-hydroxytryptamine receptor 7 activity.