The invention provides a substantially antigen-free composition for induction of innate immune response in a bird or a mammal, the composition comprising a saponin, a sterol, a quaternary amine, and a polyacrylic polymer to the mammal or bird. Methods of using the composition are also provided.

The present invention relates to compounds of formula (I), or the tautomers or pharmacologically acceptable acid addition salts thereof, wherein R.sup.1, R.sup.2, R.sup.3, R.sup.4, X, and Z have one of the meanings as defined in the specification, to the use of compounds of formula (I) as a medicament, to pharmaceutical composition comprising at least one compound of formula (I), as well as to medicament combinations containing one or more compounds of formula (I).

##STR00001##

The present invention is in the field of monoclonal antibodies suitable for passive immunotherapy of Herpes Simplex Virus infections and relates to human monoclonal antibodies or fragments of said antibodies, which bind and neutralize HSV-1 and HSV-2, and their use in the prophylaxis or treatment of HSV-1 or HSV-2-associated diseases.

Disclosed are an antiviral compound and a use thereof in the preparation of a medicament for the treatment of virus infections. Specifically, the present invention relates an imidazole derivative for treating respiratory syncytial virus infection.

The present invention provides nucleic acids, vectors, host cells, methods and compositions to confer and/or augment immune responses mediated by cellular immunotherapy, such as by adoptively transferring CD8+ central memory T cells or combinations of central memory T cells with CD4+ T cells that are genetically modified to express a chimeric receptor. In some alternatives the genetically modified host cell comprises a nucleic acid comprising a polynucleotide coding for a ligand binding domain, a poly nucleotide comprising a customized spacer region, a polynucleotide comprising a transmembrane domain, and a polynucleotide comprising an intracellular signaling domain. In some alternatives, the ligand binding domains binds to CD171.

Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #1 (SEQ ID NO: 1: SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL), peptide #4 (SEQ ID NO: 2: SLTQINWTLLDLTYEMESLQQVVKALNESYIDLKEL), and peptide #11 (SEQ ID NO: 11: SLTQINTTLLDLEYEMRSLEEVVKKLNESYIDLKEL. The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.

Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #1 (SEQ ID NO: 1: SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL), peptide #4 (SEQ ID NO: 2: SLTQINWTLLDLTYEMESLQQVVKALNESYIDLKEL), and peptide #11 (SEQ ID NO: 11: SLTQINTTLLDLEYEMRSLEEVVKKLNESYIDLKEL. The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.

Disclosed are a pharmaceutical composition, cosmetic product, and food or drink product each comprising a porous ceramic obtained by combustion synthesis of a starting material comprising (1) titanium and (2) at least one member selected from the group consisting of carbon, boron, nitrogen, and silicon; a pharmaceutical composition and cosmetic product each comprising a radical- and nanobubble-containing liquid; and a blood treatment device comprising a blood flow channel for extracorporeal circulation of a patient's blood, the blood flow channel being provided with the porous ceramic above, and the porous ceramic and the blood are brought into contact with each other.

The present invention provides a pharmaceutical composition for prevention and/or treatment of diseases induced by viruses of genus coronavirus and/or genus rotavirus. The pharmaceutical composition includes the following components by weight percent: 0.5-100% of taurine, 0-85% of a vitamin complex, and 0-15% of a flavoring agent.

Described are stable topical formulations useful in the treatment of viral wart infection, demodex infection and bacterial infection of the skin, and genitalia and the method of treating viral wart infection, demodex infection and bacterial infection of the skin, and genitalia with said compositions.