The present invention provides valuable peptidomimetics for therapeutic and diagnostic purposes as well as compositions, methods, uses and kits based on these peptidomimetics. In particular, the peptidomimetics of the present invention are incorporated by CCK2R expressing cells, for instance, cancer cells. This allows, for instance, to selectively destroy cancer cells or to selectively image cancer cells that express CCK2R.

A method for synthesis and purification of radiolabeled macroaggregated human serum albumin (MAA) to form a bulk solution injectable to a patient includes: providing a radiometal in a generator, the radiometal being a generator eluate; synthesizing the radiolabeled MAA in a reactor with MAA particles from a commercially available labeling kit for 99mTc and the generator eluate so as to provide synthesized radiolabeled MAA particles; passing the synthesized radiolabeled MAA particles on a syringe filter membrane having a membrane composition, diameter, and pore size for trapping the radiolabeled MAA particles as trapped radiolabeled MAA particles and not retaining impurities from a bulk solution, the impurities including free radioactive metal isotopes, parent radioactive metal breakthrough, and stannous chloride present in the MAA labeling kit for 99mTc; and untrapping the trapped radiolabeled MAA particles from the syringe filter using a saline or buffered solution passing through the syringe filter.

The present invention discloses complex for PET imaging in patients with Cushing's syndrome dependent on secretion of a hormone called ACTH from pituitary. This will help to distinguish Cushing's disease due to pituitary tumor (adenoma) or due to tumor of origin other than pituitary (ectopic Cushing's syndrome). It will also be helpful to delineate ACTH producing pituitary adenoma (corticotropinoma). More particularly the work disclosed an imaging complex comprising radiolabelled analogue of desmopressin for PET imaging to localize pituitary adenoma.

A smartphone wallet sleeve combo with both a clip and a pop-up stand. The clip is attached at the bottom of the wallet sleeve so that when attached to clothing the opening of the wallet sleeve is oriented upward to keep cards from falling out of the wallet sleeve. The pop-up stand includes an attachment magnet. The invention also includes a magnetic key fob that includes a key ring and a disk end with attachment disks on both sides. The invention also includes an attachment disk with an adhesive side to attach to a flat surface and a magnetic side to attach to either the key fob or the wallet sleeve, or both.

Chromatography columns for the purification of eluates from .sup.68Ge/.sup.68Ga generators comprising silica as stationary phase and purification processes that use said columns are described.

Various methods and compositions of treating 4-hydroxyphenylpyruvate dioxygenase-like (HPDL)-related diseases or disorders are presented herein. Also presented herein are methods of increasing CoQ10 biosynthesis, and methods of determining whether a subject will benefit from a CoQ10 or CoQ10 alternative treatment. Also presented herein are pharmaceutical compositions and dosage forms comprising 4-hydroxymandelic acid (4-HMA), and/or its metabolites. Further presented herein are compounds that inhibit 4-hydroxyphenylpyruvate dioxygenase-like (HPDL). Further presented herein are methods of identifying and/or assessing modulators of HPDL. Yet further presented herein are example methods and systems for isotopic labelling in cells by metabolizing cells in the presence of gaseous isotopic tracer.

A nuclide-labeled inhibitory peptide, and a preparation method therefor and use thereof are provided. The nuclide-labeled inhibitory peptide is prepared by labeling ASF1a peptide with .sup.68Ga/.sup.177Lu by DOTA, and an amino acid sequence of the ASF1a peptide is YGRKKRRQRRRCASTEEKWARLARRIAGAGGVTLDGFGGCA (as shown in SEQ ID NO: 1). The .sup.68Ga labeled ASF1a inhibitory peptide of the present invention displays the expression level of ASF1a of a tumor through PET/CT imaging, has good imaging sensitivity, can specifically screen high-expression and low-expression individuals, and achieves noninvasive prediction of the efficacy of tumor immunotherapy. The .sup.177Lu-labeled ASF1a inhibitory peptide provides a novel and effective therapeutic strategy for a tumor that highly expresses ASF1a and is not effective for immunotherapy.

Provided herein are antibodies and methods of using the antibodies to treat and diagnose neurite degenerative diseases and disorders.

The present invention relates to the field of radiopharmaceuticals for in vivo imaging, in particular to radiotracer compositions which comprises .sup.18F-labelled c-Met binding peptides. The invention provides said compositions, as well as associated automated methods of preparation and cassettes.

Provided herein are methods for iodinating biomolecules, including proteins and peptides. The methods can be used to successfully and efficiently iodinate biomolecules under relatively mild reaction conditions. As a consequence, the methods described herein can be used to iodinate biomolecules that include, for example, an oxidatively unstable moiety (e.g., an optical dye) without adversely impacting the oxidatively unstable moiety.