Repebody against immunoglobulin G and uses thereof
09777046 · 2017-10-03
Assignee
Inventors
- Hak-Sung KIM (Daejeon, KR)
- Woosung Heu (Daejeon, KR)
- Joong-Jae Lee (Daejeon, KR)
- Seong-Min Jo (Daejeon, KR)
Cpc classification
C07K14/705
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to a polypeptide (repebody) selectively bound to an immunoglobulin G, a polynucleotide which encodes the repebody, a vector containing the polynucleotide, a recombinant microorganism in which the polynucleotide is introduced, a method for producing the repebody using the recombinant microorganism, and a method for immobilizing or purifying an immunoglobulin G using the repebody. The repebody according to the present invention is useful as utilized for immobilization of an immunoglobulin G, purification of an immunoglobulin G, and production of an immunosensor, since the repebody selectively bound to an immunoglobulin G.
Claims
1. A repebody consisting of the amino acid sequence of SEQ ID NO: 3, wherein the repebody is capable of selectively binding to immunoglobulin G.
2. A repebody consisting of the amino acid sequence of SEQ ID NOs: 4 or 5, wherein the repebody is capable of selectively binding to immunoglobulin G.
3. A polynucleotide which encodes the repebody of claim 1.
4. A vector which contains the polynucleotide of claim 3.
5. A recombinant microorganism, in which the polynucleotide of claim 3, or a vector containing said polynucleotide, is introduced.
6. A method for producing the repebody of claim 1, wherein the method comprises: (i) expressing the repebody by culturing the recombinant microorganism of claim 5; and (ii) recovering the expressed repebody.
Description
DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
BEST MODE FOR CARRYING OUT THE INVENTION
(10) Unless defined otherwise, all the technical and scientific terms used herein have the same meanings as those generally understood by persons skilled in the art to which the present invention pertains. Generally, the nomenclature used herein are well known and commonly employed in the art.
(11) The present inventors constructed a library randomly including a repeat module of a polypeptide in which an N-terminal of Leucine rich repeat (LRR) family protein having an alpha-helix capping motif, a modified repeat module of variable lymphocyte receptor (VLR) protein, and a C-terminal of the VLR protein are fused, in order to develop a novel polypeptide (repebody) capable of being selectively bound to immunoglobulin G (IgG), and effectively immobilizing or purifying IgG. The polypeptide included in the library may be encoded by a polynucleotide sequence of SEQ ID NO: 1 or a polynucleotide sequence having homology of 75%, preferably 85%, more preferably 90%, further preferably 95% or more, with the polynucleotide sequence of SEQ ID NO: 1. In addition, the library may be formed of phagemid including the polynucleotide. In the present invention, the term “phagemid” means a circular polynucleotide molecule derived from a phage which is a virus having E. coli as a host and includes sequences of proteins and surface-proteins required for propagation and proliferation. A recombinant phagemid may be produced using gene recombinant technology well known in the art, and site-specific DNA cleavage and connection may be performed by an enzyme, generally known in the art, and the like. The phagemid may include a signal sequence or leader sequence for secretion in addition to expression regulating factors such as a promoter, an operator, an initiation codon, a termination codon, an enhancer and may be mainly used in a method for labeling the protein on a surface of the phage by fusing a desired protein with a surface protein of the phage. The promoter of the phagemid is mostly inducible and may include a selective marker for selecting a host cell. For an object of the present invention, the phagemid may be a polynucleotide of SEQ ID NO: 2, including MalEss, DsbAss or PelBss which is a signal sequence or a leader sequence for expressing and secreting the polynucleotide which encodes the polypeptide constructing the library, and including a histidine-tag for confirming expression of a recombinant protein on a surface of the phage, and a polynucleotide which encodes gp3 domain which is a kind of a surface protein of M13 phage for expression on the surface of the phage, but the present invention is not particularly limited thereto.
(12) The present inventors firstly selected a novel polypeptide (SEQ ID NO: 3, Repebody-E10) which is a repebody having excellent binding capacity to IgG, using a phage display method using the library including the phagemid.
(13) Therefore, in one aspect, the present invention is directed to a repebody selectively bound to an immunoglobulin G in which an N-terminal of Leucine rich repeat (LRR) family protein having an alpha-helix capping motif; a modified repeat module of variable lymphocyte receptor (VLR) protein and a C-terminal of the VLR protein are fused, wherein said modified repeat module of the VLR protein, and said C-terminal of the VLR protein are represented by the amino acid sequence of SEQ ID NO: 6. Here, SEQ ID NO: 6 corresponds to the part of position Nos: 84 to 266 of the amino acid of SEQ ID NO: 3.
(14) The present inventors mutated the selected polypeptide in order to obtain a polypeptide having more improved binding capacity to IgG than that of the firstly selected polypeptide. To this end, a repebody having excellent binding capacity was secured by rational design scheme based on a complex structure of the selected polypeptide of SEQ ID NO: 3 and IgG. In detail, among the selected polypeptide amino acid sequence of SEQ ID NO: 3, an amino acid at a position which is expected to improve the binding capacity to IgG was mutated to obtain a novel polypeptide specifically bound to IgG (SEQ ID NO: 4 Repebody D10 and SEQ ID NO: 5 Repebody F4). That is, a complex of the polypeptide of SEQ ID NO: 3 and IgG was expressed in E. coli and the amino acid of the repebody adjacent to IgG was partially mutated, thereby selecting a polypeptide having an increased to IgG. In an exemplary embodiment of the present invention, polypeptides of which (an) amino acid(s) at one or two or more position(s) selected from a group consisting of Nos: 161, 163, 165 and 166 in polypeptide amino acid sequence represented by Repebody-E10 (SEQ ID NO: 3) (which is the same as Nos: 78, 80, 82, and 83 in polypeptide amino acid sequence represented by SEQ ID NO: 6) is mutated were produced and among them, polypeptides of SEQ ID NOs: 4 and 5 having excellent biding capacity to IgG were selected. The novel polypeptide (SEQ ID NOs: 4 and 5) produced by mutation of the amino acid of SEQ ID NO: 3 at a specific position is selectively bound to IgG is useful for immobilization, purification, and the like, of IgG.
(15) Therefore, in another aspect, the present invention is directed to a repebody selectively bound to an immunoglobulin G in which an N-terminal of Leucine rich repeat (LRR) family protein having an alpha-helix capping motif; a modified repeat module of variable lymphocyte receptor (VLR) protein and a C-terminal of the VLR protein are fused, wherein amino acid(s) at one or two or more position(s) selected from a group consisting of Nos: 78, 80, 82, and 83 in the amino acid sequence of SEQ ID NO: 6 is mutated.
(16) Here, in the present invention, the N-terminal of Leucine rich repeat (LRR) family protein having an alpha-helix capping motif is preferably an N-terminal of an internalin protein. In the present invention, the term “internalin protein” is a kind of the LRR family protein expressed in a Listeria strain, and it is known that the internalin protein has an N-terminal structure different from that of the LRR family proteins in which a hydrophobic core are uniformly distributed through the entire molecule to thereby be stably expressed in microorganisms. It is considered that since the N-terminal of the internalin protein which is the most important in folding a repeat module is derived from a microorganism and has a stable shape including an alpha-helix, such that the internalin protein is stably expressed in microorganisms. The internalin protein used in fusion of the present invention may limitlessly include any internalin protein which is expected to have an N-terminal structure similar thereto and play an important role in protein folding, and as an example thereof, internalin protein A, B, C, H, J, or the like, preferably, internalin protein B, may be used. However, since the internalin proteins A to J are significantly similar to the internalin protein B in view of a structure, and the root mean square deviation (RMSD) values thereof with the N-terminal (36 to 11) of the internalin protein B through a structure alignment are 0.6 [internalin protein A (36 to 115)], 0.793 [internalin protein C (36 to 115)], 0.619 [internalin protein H (36 to 115)], and 0.862 [(internalin protein J (57 to 131)), respectively, which are significantly similar to that of internalin protein B, the internalin proteins A to J may be used instead of the internalin protein B.
(17) In the present invention, the term “N-terminal of an (or the) internalin protein” of the present invention means an N-terminal of the internalin protein required for soluble expression and folding of the protein, and means a repeat module of the alpha-helix capping motif and the internalin protein. The N-terminal of the internalin protein may limitlessly include any N-terminal of the internalin protein required for soluble expression and folding of the protein, and as an example thereof, an alpha-helix capping motif “ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE (SEQ ID NO: 9)” and the repeat module may be included. The repeat module pattern may be “LxxLxxLxLxxN”. In the repeat module, L means alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine, or tryptophan; N means asparagine, glutamine, serine, cysteine or threonine and x means any amino acid. In addition, the N-terminal of the internalin protein of the present invention may be the N-terminal of the internalin B protein which is SEQ ID NO: 10; however, may be limitlessly used as long as the N-terminal has high structural similarity depending on a kind of the LRR family protein, and the most stable amino acid may be selected by calculation of a binding energy, and the like, and the amino acid of the module corresponding thereto may be mutated. The N-terminal of the internalin protein selected by the method according to the present invention may consist of any one amino acid sequence selected from SEQ ID NOs: 11 to 13. SEQ ID NOs: 11 to 13 correspond to position Nos: 1 to 83 of the amino acid of SEQ ID NOs: 3 to 5.
(18) In the present invention, the term “immunoglobulin G (IgG)” is one kind of globulin protein having an antibody activity contained in body fluids such as blood serum, and the like, and is occupied by about 70% of the immunoglobulin. IgG is a glycoprotein where a molecular weight thereof is about 160,000, a molecular model is Y type, two upper ends are bound to an antigen, and a lower end (Fc part) is allowed to bind the antibody which binds to the antigen to a cell or a complement thereby having a biological activity. IgG participates in overall immune reaction to generate neutralization of toxins or viruses, sedimentation and flocculation reaction.
(19) In the present invention, the term “repebody” is a polypeptide optimized by consensus design through fusion of the N-terminal of the internalin B having the LRR protein structure and the VLR based on the structural similarity. The repebody protein may be structurally divided into a concave region and a convex region (
(20) In the present invention, the term “variable lymphocyte receptor (VLR)” is a kind of the LRR family protein expressed in a hagfish and a lamprey, performing an immune function, and has been in the spotlight as a frame capable of binding to various antigen materials. Since the polypeptide in which the N-terminal of the internalin B protein and the VLR protein are fused has an increased solubility and an increased expression amount as compared to the VLR protein in which the internalin B protein is not fused, the polypeptide may be useful for production a novel protein therapeutic agent based on the polypeptide. The improvement of the expression amount as described above suggests that the polypeptide of the present invention has largely improved economic feasibility, and the increase in the expression amount of the fused polypeptide in which the internalin B protein and the VLR protein are fused was firstly developed by the present inventors (Korean Patent Application No. 10-2012-0019927).
(21) In the present invention, the term “Leucine rich repeat (LRR) family protein” means a protein formed by combination of modules in which leucine is repeated at a certain position, (i) it has one or more LRR repeat modules, (ii) the LRR repeat module consists of 20 to 30 amino acids, (iii) the LRR repeat module has “LxxLxxLxLxxN” as a conservation pattern, wherein L means hydrophobic aminoacids such as alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine, and tryptophan; N means asparagine, glutamine, serine, cysteine or threonine and x means any amino acid, and (iv) the LRR family protein means a protein having a three dimensional structure like horseshoe. The LRR family protein of the present invention may include all mutants having the sequence which is already known or found by newly induced mRNA or cDNA, as well as the sequence which is not known in the natural world through consensus design, and the like, and having a frame of the repeat module, and as a non-limited example thereof, a variable lymphocyte receptor (VLR), a toll-like receptor (TLR), a TV3 protein, an U2A or ribonuclease inhibitor (RI) may be included. In a preferred exemplary embodiment of the present invention, the LRR family protein may include a number of repeat modules as long as fused water soluble polypeptide is capable of being stably expressed, but the number thereof is not limited thereto, wherein the number thereof is preferably 1 to 9. In addition, the number of the LRR repeat modules may be all numbers including the number known in the natural world as well as the numbers in which the frame of the fused polypeptide is capable of being maintained while artificially adding or removing the module.
(22) In the present invention, the modified repeat module of the VLR protein may include the following repeat module pattern:
(23) LxxLxxLxLxxN.
(24) In the pattern above, L is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine, or tryptophan; N is asparagine, glutamine, serine, cysteine or threonine and x is any amino acid.
(25) In the present invention, the term “mutation” or “modification” may include all substitution, deletion, or insertion of amino acid residues; preferably, substitution of the existing amino acid residue with the other amino acid residue.
(26) In an exemplary embodiment of the present invention, the polypeptide in which the modified repeat module of the VLR protein and the C-terminal of the VLR protein are fused is characterized by consisting of polypeptide amino acid sequences represented by SEQ ID NOs: 6 to 8. SEQ ID NOs: 6 to 8 correspond to position NOs: 84 to 266 of the amino acid of SEQ ID NOs: 3 to 5.
(27) In still another aspect, the present invention is directed to a polynucleotide which encodes the repebody according to the present invention.
(28) The polynucleotide may be a polynucleotide having homology of 75%, preferably 85%, more preferably 90%, further preferably 95% or more, and having a polypeptide activity specifically bound to IgG, but the present invention is not limited thereto. In view of an object of the present invention, it is obvious that the polypeptide (repebody) specifically bound to IgG may include polypeptide wherein one or more amino acid residues in the repebody represented by SEQ ID NOs: 3 to 5 is substituted, deleted, or added, as the scope of the present invention.
(29) In still another aspect, the present invention is directed to a vector which contains the polynucleotide (repebody).
(30) In the present invention, the term “vector” may be a DNA product containing base sequence of polynucleotide encoding a target protein operably connected to an appropriate regulation sequence so as to express the target protein in a suitable host cell. The regulation sequence may include a promoter capable of initiating transcription, an any operator sequence for regulating transcription, a sequence encoding an appropriate mRNA ribosome binding site, and a sequence regulating termination of transcription and decoding and may be variously produced depending on a purpose. The promoter of the vector may be constitutive or inducible. The vector may be transfected into a suitable host and then may be replicated or may perform functions regardless of the host genome, and may be integrated into a genome itself.
(31) The vector used in the present invention is not particularly limited as long as it is replicated in host cells, and may be any vector known in the art. Examples of the generally used vector may include plasmid, phagemid, cosmid, virus, and bacteriophage in a natural state or a recombinant state. For example, as the phage vector or the cosmid vector, pWE15, M13, λMBL3, λMBL4, λIXII, λASHII, λt10, λt11, Charon4A, and Charon21A may be used, and as the plastmid vector, pBR-based, pUC-based, pBluescriptII-based, pGEM-based, pTZ-based, pCL-based and pET-based, may be used. The vector usable in the present invention is not particularly limited but may be any known expression vector. Preferably, pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC vectors, and the like, may be used. Most preferably, pACYC177, pCL and pCC1BAC vectors may be used.
(32) In still another aspect, the present invention is directed to a recombinant microorganism in which the polynucleotide (repebody) or the vector which contains the polynucleotide (repebody) is introduced.
(33) In the present invention, the term “recombinant microorganism” means a transfected cell in which a vector having polynucleotide encoding one or more target proteins is introduced into a host cell, or polynucleotide encoding one or more target proteins is introduced into a microorganism, such that the polynucleotide is integrated into the chromosome to express the target protein, and may include all cells of eukaryotic cells, prokaryotic cells, and the like. Examples thereof may include bacteria cells such as E. coli, streptomyces, salmonella typhimurium, and the like; yeast cells; fungus cells such as pichiapastoris, and the like; insect cells such as drosophila, spodoptera Sf9 cell, and the like; animal cells such as CHO, COS, NSO, 293, bow melanoma cell, and the like, but the present invention is not particularly limited thereto.
(34) In the present invention, the term “transfection” means that a vector containing polynucleotide encoding a target protein is introduced into a host cell or a polynucleotide encoding a target protein is integratedly completed into chromosome of the host cell, such that protein encoded by the polynucleotide is capable of being expressed in the host cell. The polynucleotide may be any one regardless of the position as long as the polynucleotide is capable of being expressed in the host cell, regardless of the matter that the polynucleotide is inserted and positioned into chromosome of the host cell or positioned on an outer portion of the chromosome. In addition, the polynucleotide includes DNA and RNA encoding the target protein. The polynucleotide may be inserted with any type as long as the polynucleotide is capable of being introduced into the host cell to be expressed. For example, the polynucleotide may be introduced into the host cell as an expression cassette which is a gene structure, including all factors required for self expression. The expression cassette may include a promoter, transcription termination signal, ribosome binding site and translation termination signal which may be operably connected to the polynucleotide. The expression cassette may be an expression vector performing self-replication. In addition, the polynucleotide may be introduced into the host cell as itself to be operably connected to the sequence required for expression in the host cell.
(35) In still another aspect, the present invention is directed to a method for producing a repebody against IgG, wherein the method comprises: (i) expressing the repebody by culturing a recombinant microorganism; and (ii) recovering the expressed repebody.
(36) In the method, the culturing of the recombinant microorganism may be preferably performed by a batch culture method, a continuous culture method, a fed-batch culture, and the like, known in the art, but the present invention not particularly limited thereto, wherein under the culture condition, pH may be appropriately adjusted (pH 5 to 9, preferably pH 6 to 8, most preferably pH 6.8) by using a basic compound (for example: sodium hydroxide, potassium hydroxide or ammonia) or an acidic compound (for example, phosphoric acid or sulfuric acid), and an aerobic condition may be maintained by introducing oxygen, or an oxygen-containing gas mixture into the culture, and the culture may be performed at 20 to 45° C., preferably, 25 to 40° C. for about 10 to 160 hours. The repebody produced by the culture may be secreted in the medium or remained in the cell.
(37) In addition, in the culture medium used, as carbon source, sugar and carbohydrate (for example, glucose, sucrose, lactose, fructose, maltose, molasse, starch and cellulose), oil and fat (for example, soybean oil, sunflower seed oil, peanut oil and coconut oil), fatty acid (for example, palmitic acid, stearic acid and linoleic acid), alcohol (for example, glycerol and ethanol) and organic acid (for example, acetic acid), and the like, may be used individually or by mixing; as nitrogen source, nitrogen-containing organic compound (for example, peptone, yeast extract, gravy, malt extract, corn steep liquor, soybean meal powder and urea), or inorganic compound (for example, ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and ammonium nitrate) and the like, may be used individually or by mixing; as phosphate source, potassium dihydrogen phosphate, dipotassium hydrogen phosphate, sodium-containing salt corresponding thereof, and the like, may be used individually or by mixing; or essential growth-promoting materials such as other metal salts (for example, magnesium sulfate or iron sulfate), amino acids and vitamins may be included.
(38) In the recovering of the repebody produced in the culturing of the present invention, the desired repebody may be recovered from a culture fluid by appropriate culture methods such as a batch culture method, a continuous culture method, a fed-batch culture, and the like, known in the art.
(39) In still another aspect, the present invention is directed to a method for purifying an immunoglobulin G antibody, wherein the method comprises: (i) treating a column onto which the repebody according to the present invention is adsorbed with a composition comprising an antibody; and (ii) eluting the antibody attached to the column of the step (i) above.
(40) Here, a bead onto which the repebody is attached may be packed into a column instead of directly adsorbing the repebody onto the column in the step (i) above. The repebody according to the present invention is preferably a repebody consisting of any one amino acid sequence of SEQ ID NOs: 3 to 5.
(41) In still another aspect, the present invention is directed to a method for immobilizing an immunoglobulin G, wherein the method comprises: (i) surface-treating a solid substrate by attaching the repebody according to the present invention onto the solid substrate; and (ii) binding an immunoglobulin G to the surface-treated solid substrate.
(42) The repebody according to the present invention is preferably a repebody consisting of any one amino acid sequence of SEQ ID NOs: 3 to 5.
(43) In the method, the solid substrate may be selected from a group consisting of a CM-5 Au sensor chip, a magnetic micro bead, a glass plate, a gold nanoparticle, a biodegradable organic polymer nanoparticle such as PLGA, and various kinds of micro well plates. IgG used in the present invention is preferably human IgG, but is not limited thereto. By the surface-treating of the step (i) above, the solid substrate may be bound to protein so that orientation is controlled and may have an increased uniformity on a surface thereof. The method of immobilizing IgG using the repebody of the present invention may be physically and chemically stable and may have a significantly wide use thereof as compared to the existing method of using antibody-binding protein (protein A, G, A/G or L) and may be economical as compared to the existing method of using a low molecular compound or protein A.
(44) In still another aspect, the present invention is directed to an immunosensor in which an immunoglobulin G is immobilized onto a solid substrate surface-treated with the repebody according to the present invention, using the repebody as a mediator.
(45) The immunosensor may be obtained by surface-treating the solid substrate with the repebody according to the present specifically bound to Fc site of IgG and immobilizing IgG to be detected. The detection by an antigen-antibody reaction using the immunosensor may vary depending on the kind of the solid substrate. For example, in a case where the solid substrate is a magnetic micro beads, the magnetic micro beads itself may be boiled in buffer and then measured by a PAGE method. In addition, in a case where the solid substrate is a glass plate, the repebody may be treated with fluorescent-labeled IgG to measure fluorescence.
(46) Hereinafter, the present invention will be described in more detail with reference to the following Examples. However, the following Examples are provided by way of example so as to easily explain description and scope of the technical spirit of the present invention. Accordingly, the scope of the present invention is not restricted thereby or changed therefrom. In addition, various modifications and changes may be made by those skilled in the art to which the present invention pertains from this description.
EXAMPLES
Example 1
Design of Phagemid for Selection of Random Repebody Library
(47) A protein frame named repebody was used as a component of the present invention. The frame is a water soluble polypeptide in which an LRR portion containing an N-terminal of an internalin B protein and a C-terminal of VLR protein is fused, and has an amino acid sequence the same as SEQ ID NO: 14.
Example 1-1
Expression of Repebody Using Signal Sequence in Periplasm
(48) In order to confirm whether or not the repebody is applicable to a phage display, it is required to confirm periplasmic expression of E. coli to be used as a host, and whether or not protein is well expressed onto a surface particle of a phage. To this end, two recombinant vectors were produced by inserting MalE and DsbA signal sequences which are signal polypeptides differentiated from each other right into the back side of an initiation codon, using pMAL-c2x (NEB, USA) vector. Then, DNA in which the repebody and a histidine-tag are fused was inserted between the signal sequence and termination codon to complete a final vector. Two completed vector was introduced into E. coli XL1-blue strain to produce a transformant, the transformant was cultured until absorbance (OD.sub.600) reached 0.5 and then 0.1 mM IPTG (Isopropyl β-D-1-thiogalactopyranoside) was treated to induce expression of the protein, followed by culturing at 30° C. for 16 hours again. After the culturing was completed, the strain was obtained by centrifugation and treated by ultrasonic wave to obtain a water soluble protein fraction.
(49) The obtained water soluble protein fraction was applied to a Ni-NTA (Nickel-nitrilotriacetic acid) resin to be purified, and an expression amount of the produced repebody in periplasm was confirmed by SDS-PAGE analysis (
Example 1-2
Construct of Phagemid for Repebody Expression on Surface of Phage
(50) A phagemid was designed based on the MalE signal sequence finally determined in Example 1-1 above. With pTV118N (Takara, Japan) as a basic frame, the MalE signal sequence was inserted right into the back side of the initiation codon and DNA in which the repebody and a histidine-tag are fused was added to thereby construct a phagemid. In addition, gp3 which is capable of labeling a relatively large protein among several phage surface proteins was used, C-terminal was positioned at the back of an amber codon, and two continuous terminal codons were finally inserted thereto, thereby completing the phagemid named pBEL118M. The phagemid was introduced into XL1-Blue to produce a transformant, and the produced transformant was cultured by the same method as Example 1-1 above except for treatment with 0.5 mM IPTG, followed by centrifugation to obtain a culture fluid. The culture fluid was applied to Polyethylene glycol precipitation method to purify the phage. The phage was analyzed by Western Blot, and as a result thereof, it was confirmed that the repebody was expressed on a surface of the phage (
Example 2
Construct of Repebody Library Based on Protein Structure
(51) The repebody consists of continuously connected repeat units having conserved leucine sequence, similar to LRR proteins present in the natural world and has a modularity maintaining the entire protein structure and structural characteristic of a concave region and a convex region differentiated by curvature of the entire structure (
(52) In detail, six amino acid residues Nos. 91, 93, 94, 115, 117 and 118 positioned at the concave region of two continuous mutation modules (LRRV module 1 and 2) positioned at an amine group terminus were selected in order to deviate from steric hinderance by C-term loop of a non-designed carboxylic acid terminus (
(53) Then, the selected amino acid was substituted with NNK degenerate codon and configured so that base sequences of the other convex region include silent mutation, thereby synthesizing a mutagenic primer for constructing a library.
(54) Next, overlap PCR was performed on two modules using the primers to obtain a library DNA (
(55) The secured library was introduced into E. coli XL1-Blue by electroporation to obtain a transformant, such that a library having a synthetic diversity with a level of 1.8×10.sup.8 was constructed.
Example 3
Selection of Protein Specifically Bound to IgG Using Phage Display
Example 3-1
Selection of Polypeptide Bound to IgG Through Purification and Panning of Repebody Library Phage
(56) The library constructed in Example 2 was cultured by the method of Example 1-1 above and the phage in which the repebody was expressed on a surface thereof was selected by the method of Example 1-2 and purified. In order to select a candidate capable of binding IgG, 10 ug/ml of Fc fragment of IgG was coated on immuno tube at 4° C. for 12 hours or more. The tube was washed with PBS (Phosphate buffered saline), followed by blocking with a PBS solution (TPBS) containing 1% bovine serum albumin (BSA) and 0.05% Tween 20 at 4° C. for 2 hours. After the blocking, 10.sup.12 cfu (Colony forming unit)/ml of the library phage was reacted at room temperature for 2 hours. Then, the reactant was washed with a PBS solution (TPBS) containing 0.05% Tween 20 total five times for 2 minutes and then washed again with PBC twice. Finally, the reactant was treated with 1 ml 0.2M Gly-HCl (pH2.2) at room temperature for 12 minutes to elute the phage in the tube. The reactant after the elution was neutralized with 60 ul of 1.0M Tris-HCl (pH8.8) and 10 ml XL1-Blue (OD.sub.600=0.5) which is a host E. coli was inserted thereinto, followed by plating on a 2xYT plate. A bio-panning process through a series of process as described above was performed total of three times and the Fc fragment coated on the immuno tube was decreased to be 5 ug/ml, followed by bio-panning twice again. A phenomenon that the phage having a specific binding through each panning process is enriched was observed. The result means that the library phage bound to the Fc fragment of IgG is specifically increased.
Example 3-2
Confirmation of Specific Binding of Selected Repebody to IgG and Sequence Analysis
(57) Enzyme-linked immunosorbent assay (ELISA) was performed on the phage selected by the method of Example 3-1 above, using a 96-well plate coated with IgG and BSA. As a result, one specific binding candidate showing absorbance (OD.sub.450) of IgG five times-higher than that of BSA was selected and the sequence thereof was confirmed.
Example 3-3
Analysis of Property of Specific Binding of Selected Repebody to IgG
(58) Based on ELISA result obtained by Example 3-2 above and with the previously obtained Repebody E10 as a target, ELISA was additionally performed using a plate coated with various kinds of IgG and BSA, such that it could be appreciated that the Repebody E10 had a target specificity only on human IgG (
(59) Meanwhile, a dissociation constant of the Repebody E10 to IgG was measured. With 0.2 mM (6 mg/ml) of the repebody dissolved into PBS and 0.02 mM (3 mg/ml) of IgG dissolved into PBS, a dissociation constant of the Repebody E10 to IgG was measured at room temperature by Isothermal titration calorimetry (ITC) (
Example 4-1
Method for Increasing Module-Based Affinity for Increase in Binding Capacity of Repebody
(60) It was confirmed from the result of Example 3-3 above that the Repebody E10 is capable of being selectively bound to IgG; however, in order to be used for purification of IgG, and the like, since more various binding capacities need to be secured, mutants having improved binding capacity to IgG was tried to be developed using the modularity of the repebody.
(61) In detail, the module LRRV module 4 adjacent to the library region constructed by Example 2 above was selected and four residues of the concave region was mutated by the same scheme as Example 2 above (
Example 4-2
Analysis of Possibility of Replacing Protein a with Selected Repebody
(62) In order to analyze possibility of replacing protein A with selected repebodies secured in Examples 3-3 and 4-1, repebody F4 was attached onto a bead surface-treated with N-hydroxysuccinimide (NHS). In order to confirm that the polypeptide attached onto the bead appropriately maintains an activity, the bead onto which the repebody is attached was packed into a column and IgG flowed to the column. Then, the column was washed with a PBS solution and IgG was eluted with pH4 solution and confirmed by SDS PAGE (
(63) The repebody according to the present invention may have excellent binding capacity to IgG, thereby being effectively utilized for purification or immobilization of IgG.
(64) Although specific embodiments of the present invention are described in detail, it will be apparent to those skilled in the art that the specific description is merely desirable exemplary embodiment and should not be construed as limiting the scope of the present invention. Therefore, the substantial scope of the present invention is defined by the accompanying claims and equivalent thereof.