Vaccine composition comprising an immunogenic protein and combination adjuvants for use in eliciting antigen-specific T-cell responses
09775898 · 2017-10-03
Assignee
Inventors
- Chia-Mao Wu (Hsinchu County, TW)
- Jiun-Ming Wu (Hsinchu County, TW)
- Yi-Tsui Chiu (Hsinchu County, TW)
- Yin-Ching Lin (Hsinchu County, TW)
- Hsien-Kai Chuang (Hsinchu County, TW)
- Fu-Tan Hsieh (Hsinchu County, TW)
- Kuan-Ming Chen (Hsinchu County, TW)
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
A61K39/39
HUMAN NECESSITIES
C12N2710/20033
CHEMISTRY; METALLURGY
A61K38/1774
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61K2039/55561
HUMAN NECESSITIES
A61P43/00
HUMAN NECESSITIES
C12N2710/20034
CHEMISTRY; METALLURGY
A61K2039/6037
HUMAN NECESSITIES
A61K2039/55572
HUMAN NECESSITIES
A61K2039/545
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
A61K39/39
HUMAN NECESSITIES
C12N7/00
CHEMISTRY; METALLURGY
Abstract
Vaccine compositions for use in inducing enhanced antigen-specific T cell-mediated immune responses in a subject in need thereof are disclosed. The composition comprises (a) a therapeutically effective amount of an immunogenic protein comprising at least an antigen of a pathogen; (b) a saponin-base adjuvant selected from the group consisting of GPI-0100, Quil A, QS-21; and (c) a Toll-like receptor (TLR) agonist adjuvant selected from the group consisting of monophosphoryl lipid A (MPL), and CpG1826.
Claims
1. A composition consisting of: (a) a therapeutically effective amount of an immunogenic protein; (b) the saponin-based adjuvant QS21; (c) a Toll-like receptor (TLR) agonist adjuvant selected from the group consisting of monophosphoryl lipid A (MPL), and CpG oligonucleotide; and (d) optionally at least one additive selected from the group consisting of mannitol, sucrose, trehalose, histindine, glycine, arginine, sorbitol, Polysorbate 80, glucose, lactose, maltose, maltodextrins, citrate, Tris and sodium phosphate; wherein the immunogenic protein is a fusion protein comprising: (a′) an antigen-presenting cell (APC)-binding domain or a CD91 receptor-binding domain, located at the N-terminus of the fusion protein; (b′) a protein transduction domain, located at the C-terminus of the APC-binding domain or the CD91 receptor-binding domain, the protein transduction domain being selected from the group consisting of: (i) a fusion polypeptide comprising: (1) a T cell sensitizing signal-transducing peptide consisting of 28-53 amino acid residues in length, comprising the amino acid sequence of SEQ ID NO: 31, in which Xaa.sup.8 is I or L; Xaa.sup.10 is V, F or A, Xaa.sup.11 is M or L, Xaa.sup.17 is L or I, being located at the N-terminus of the fusion polypeptide; (2) a translocation peptide consisting of 34-112 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 4, 20, or 41; and (3) a linker, comprising SEQ ID NO: 15 linking the T cell sensitizing signal-transducing peptide and the translocation peptide; (ii) a T cell-sensitizing signal-transducing peptide consisting of 28-53 amino acid residues in length, comprising the amino acid sequence of SEQ ID NO: 31, in which Xaa.sup.8 is I or L; Xaa.sup.10 is V, F or A, Xaa.sup.11 is M or L, Xaa.sup.17 is L or I; and (iii) a translocation peptide of 34-112 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 4, 20 or 41; and (c′) an antigen of a pathogen, located at the C-terminus of the protein transduction domain.
2. A composition comprising: (A) a therapeutically effective amount of an immunogenic protein comprising at least an antigen of a pathogen: (B) the saponin-base adjuvant GPI-0100; and (C) a Toll-like receptor (TLR) agonist adjuvant selected from the group consisting of monophosphoryl lipid A (MPL), and CpG oligonucleotide, wherein the immunogenic protein is a fusion protein comprising: (a) an antigen-presenting cell (APC)-binding domain or a CD91 receptor-binding domain, located at the N-terminus of the fusion protein; (b) a protein transduction domain, located at the C-terminus of the APC-binding domain or the CD91 receptor-binding domain, the protein transduction domain being selected from the group consisting of: (i) a fusion polypeptide comprising: (1) a T cell sensitizing signal-transducing peptide consisting of 28-53 amino acid residues in length, comprising the amino acid sequence of SEQ ID NO: 31, in which Xaa.sup.8 is I or L; Xaa.sup.10 is V, F or A, Xaa.sup.11 is M or L, Xaa.sup.17 is L or I, being located at the N-terminus of the fusion polypeptide; (2) a translocation peptide consisting of 34-112 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 4, 20 or 41; and (3) a linker, comprising SEQ ID NO: 15 linking the T cell sensitizing signal-transducing peptide and the translocation peptide; (ii) a T cell-sensitizing signal-transducing peptide consisting of 28-53 amino acid residues in length, comprising the amino acid sequence of SEQ ID NO: 31, in which Xaa.sup.8 is I or L; Xaa.sup.10 is V, F or A, Xaa.sup.11 is M or L, Xaa.sup.17 is L or I; and (iii) a translocation peptide of 34-112 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 4, 20, or 41; and (c) an antigen of a pathogen, located at the C-terminus of the protein transduction domain.
3. The composition of claim 2, wherein the protein transduction domain comprises the sequence of SEQ ID NO: 30.
4. The composition of claim 2, wherein the APC-binding domain or the CD91 receptor-binding domain is a polypeptide comprising an amino acid sequence that is at least 90% identical to the sequence selected from the group consisting of SEQ II) NOs: 5, 9, 6, 7, and 8.
5. The composition of claim 2, wherein the T cell sensitizing signal-transducing peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 and 2.
6. The composition of claim 2, wherein the translocation peptide comprises the amino acid sequence of SEQ ID NO: 3.
7. The composition of claim 2, wherein the pathogen is at least one selected from the group consisting of Human Papillomavirus (HPV), Porcine Reproductive and Respiratory Syndrome Virus (PRRSV), Human Immuno-deficient Virus (HIV-1), flu virus, dengue virus, Hepatitis C virus (HCV), Hepatitis B virus (HBV) and Porcine Circovirus 2 (PCV2).
8. The composition of claim 2, wherein the antigen of a pathogen is selected from the group consisting of Human Papillomavirus (HPV) E7 protein, Hepatitis B virus (HBV) HBx protein, Hepatitis C virus (HCV) core antigen, Flu virus M2 antigen, and a tumor associated antigen.
9. The composition of claim 8, wherein the tumor associated antigen is selected from the group consisting of SSX2, MAGE-A3, NY-ESO-1, iLRP, WT12-281, RNF43 (2-116+696-783), and CEA-NE3.
10. The composition of claim 2, wherein the fusion protein further comprises an endoplasmic reticulum retention sequence located at the C-terminus of the fusion protein.
11. The composition of claim 2, wherein the protein translocation domain is the translocation peptide of 34-112 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 4, 20, or 41, located at the C-terminus of the APC-binding domain or the CD91 receptor-binding domain; and the fusion protein further comprises a nuclear export signal, comprising the amino acid sequence of SEQ ID NO: 44; and an endoplasmic reticulum retention sequence, located at the C-terminus of the fusion protein; wherein the nuclear export signal is located between the antigen and the endoplasmic reticulum retention sequence, or between the translocation peptide and the antigen.
12. The composition of claim 11, wherein the translocation peptide is of 34-61 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 20, or 41.
13. The composition of claim 2, wherein: (a) the APC-binding domain or the CD91 receptor-binding domain is a polypeptide comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 9: (b) the protein transduction domain is the translocation peptide consisting of 34-112 amino acid residues in length, comprising an amino acid sequence that is at least 900/identical to SEQ ID NO: 3, 4, 20 or 41; and (c) the antigen of a pathogen comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 21.
14. The composition of claim 13, wherein the fusion protein comprises the amino acid sequence of SEQ ID NO: 54.
15. The composition of claim 2, wherein: (a) the APC-binding domain or the CD91 receptor-binding domain is a polypeptide comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 5; (b) the protein transduction domain comprises the sequence of SEQ ID NO: 30; and (c) the antigen of a pathogen comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 21.
16. The composition of claim 15, wherein the fusion protein comprises the amino acid sequence of SEQ ID NO: 55.
17. A method for inducing an enhanced pathogen antigen-specific T cell response, comprising: administering the composition of claim 2 to a subject in need thereof, and thereby inducing the enhanced pathogen antigen-specific T cell response.
18. A composition consisting of: (a) a therapeutically effective amount of an immunogenic protein; (b) the saponin-based adjuvant QS21; (c) a Toll-like receptor (TLR) agonist adjuvant selected from the group consisting of monophosphoryl lipid A (MPL), and CpG oligonucleotide; and (d) optionally at least one additive selected from the group consisting of mannitol, sucrose, trehalose, histindine, glycine, arginine, sorbitol, Polysorbate 80, glucose, lactose, maltose, maltodextrins, citrate, Tris and sodium phosphate; wherein the immunogenic protein is a fusion protein comprising: (a′) an antigen-presenting cell (APC)-binding domain or a CD91 receptor-binding domain, located at the N-terminus of the fusion protein; (b′) a translocation peptide of 34-112 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 4, 20, or 41, located at the C-terminus of the APC-binding domain or the CD91 receptor-binding domain; (c′) an antigen of a pathogen; (d′) a nuclear export signal, comprising the amino acid sequence of SEQ ID NO: 44; and (e′) an endoplasmic reticulum retention sequence, located at the C-terminus of the fusion protein; wherein the nuclear export signal is located between the antigen and the endoplasmic reticulum retention sequence, or between the translocation peptide and the antigen.
19. The composition of claim 18: wherein the translocation peptide is of 34-61 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 20, or 41.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
DETAILED DESCRIPTION OF THE INVENTION
(16) The present invention is more particularly described in the following examples that are intended as illustrative only since numerous modifications and variations therein will be apparent to those skilled in the art. Various embodiments of the invention are now described in detail. Referring to the drawings, like numbers indicate like components throughout the views. As used in the description herein and throughout the claims that follow, the meaning of “a”, “an”, and “the” includes plural reference unless the context clearly dictates otherwise. Also, as used in the description herein and throughout the claims that follow, the meaning of “in” includes “in” and “on” unless the context clearly dictates otherwise. Moreover, titles or subtitles may be used in the specification for the convenience of a reader, which shall have no influence on the scope of the present invention. Additionally, some terms used in this specification are more specifically defined below.
DEFINITIONS
(17) The terms used in this specification generally have their ordinary meanings in the art, within the context of the invention, and in the specific context where each term is used. Certain terms that are used to describe the invention are discussed below, or elsewhere in the specification, to provide additional guidance to the practitioner regarding the description of the invention. For convenience, certain terms may be highlighted, for example using italics and/or quotation marks. The use of highlighting has no influence on the scope and meaning of a term; the scope and meaning of a term is the same, in the same context, whether or not it is highlighted. It will be appreciated that same thing can be said in more than one way. Consequently, alternative language and synonyms may be used for any one or more of the terms discussed herein, nor is any special significance to be placed upon whether or not a term is elaborated or discussed herein. Synonyms for certain terms are provided. A recital of one or more synonyms does not exclude the use of other synonyms. The use of examples anywhere in this specification including examples of any terms discussed herein is illustrative only, and in no way limits the scope and meaning of the invention or of any exemplified term. Likewise, the invention is not limited to various embodiments given in this specification.
(18) Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. In the case of conflict, the present document, including definitions will control.
(19) Immunogenic proteins such as fusion proteins for use as immunogenic enhancers for inducing antigen-specific T cell responses are disclosed in the U.S. Patent No. 20140154285 A1 and 20140154280 A1, each of which is incorporated herein by reference in its entirety.
(20) A Toll like receptor (TLR) 4 ligand, particularly an agonist such as a lipid A derivative particularly monophosphoryl lipid A or more particularly 3 Deacylated monophoshoryl lipid A (3 D-MPL). 3D-MPL is sold under the name MPL by GlaxoSmithKline Biologicals N.A. and is referred throughout the document as MPL or 3D-MPL.
(21) Quil A (derived from the bark of the South American tree Quillaja Saponaria Molina), and fractions thereof are described in U.S. Pat. No. 5,057,540 and “Saponins as vaccine adjuvants”, Kensil, C. R., Crit Rev Ther Drug Carrier Syst, 1996, 12 (1-2):1-55; and EP 0 362 279 B1.
(22) QS-21 is a natural saponin derived from the bark of Quillaja saponaria Molina. QS-21 is a HPLC purified non-toxic fraction of Quil A and it is disclosed in U.S. Pat. No. 5,057,540.
(23) The term “an antigen-presenting cell (APC) or accessory cell” refers to a cell that displays foreign antigens complexed with major histocompatibility complexes (MHC's) on their surfaces. T-cells may recognize these complexes using their T-cell receptors (TCRs). These cells process antigens and present them to T-cells. Main types of professional antigen-presenting cell: dendritic cells (DCs), macrophages, monocytes, and certain B-cells.
(24) The term “an antigen-presenting cell (APC)-binding domain” refers to a domain that can bind to an antigen-presenting cell (APC). The APC-binding domain may be a polypeptide comprising an amino acid sequence that is at least 90% identical to the sequence selected from the group consisting of SEQ ID NOs: 5, 6, 7, 8, and 9. An APC-binding domain is a ligand that recognizes and binds to a receptor on APC.
(25) Cluster of differentiation 91 (CD91) is a protein that forms a receptor in the membrane of cells and is involved in receptor-mediated endocytosis.
(26) The term “a protein transduction domain” refers to a polypeptide or a fusion polypeptide having a function to sensitize T-cells and thus enhance antigen-specific T cell responses, and/or to guide or direct an antigen toward (i.e., to target to) class I major histocompatibility complex (MHC-1) pathway (i.e., a cytotoxic T cell pathway) of antigen presentation.
(27) The term “to sensitize T cells” generally means that CD8+ and CD4+ T cells are sensitized and as a result, CD8+(CTL) and CD4+ T cell responses to an antigen challenge are enhanced. An antigen-specific cell mediated immune response is measured by quantifying the production of antigen-specific induced γ-interferon in response to an antigen. For example, without a sensitization signal (i.e., without the protein transduction domain), an antigen alone may induce weak or no cell mediated immune response at all, i.e., weak or no production of antigen-specific γ-interferon from CD8+ and CD4+ T cells, while in the presence of a sensitization signal (the protein transduction domain), the antigen may induce an enhanced cell mediated immune response. Thus, the function of a sensitization signal (the protein transduction domain) is to sensitize CD4+ and CD8+ T cells in a host so that when the host is later challenged by an antigen, the antigen can induce an enhanced antigen-specific T cell mediated immune response due to prior CD4+ and CD8+ T cell sensitization.
(28) A protein transduction domain may be “a fusion polypeptide”, in which the fusion polypeptide comprises a T cell sensitizing signal-transducing peptide, a linker, and a translocation peptide. For example, the fusion polypeptide may be the polypeptide “CD28convPE.sub.t”.
(29) The term “CD28conv” refers to a CD28 conserved region, which is a “T cell sensitizing signal-transducing peptide”. It's an epitope for inducing CD28 agonist antibody.
(30) The term “PE.sub.t” or “PE.sub.tCore” refers to a PE translocation domain core with 34 amino acid residues in length.
(31) A linker is present between the “CD28conv” and the “PE.sub.t”. The orientation or arrangement of the fusion polypeptide “CD28convPE.sub.t” is important in that “CD28conv” (or the T cell sensitizing signal-transducing peptide) must be at the upstream to the PE.sub.t (or the translocation peptide), i.e., PE.sub.t must be at the C-terminus of the “CD28conv” to obtain enhanced T-cell responses. The “CD28convPE.sub.t” can raise much higher IgG titer (called CD28-specific agonist antibody) specific to CD28conv than the reversed orientation fusion peptide PE.sub.tCD28conv. The CD28-specific agonist antibody can sensitize both CD4+ and CD8+ T cells. The correct orientation fusion polypeptide CD28convPE.sub.t contains a linker (R.sup.1X.sup.2R.sup.3X.sup.4K.sup.5R.sup.6) between CD28conv and PE.sub.t domains. The linker contains an antigen presenting cell (APC)-specific protease (cathepsin L) cutting site Lys-Arg (KR). Therefore, the fusion protein RAP1-CD28convPE.sub.t-Antigen-K3 can be digested into the two fragments: RAP1-CD28conv and PE.sub.t-Antigen-K3. The RAP1-CD28conv fragment can be further digested in the lysosome and the epitope of CD28conv is then presented to the APC cell surface via MHC II pathway, which in turn elicits a humoral immune response producing CD28 agonist antibody. Thus, CD28 agonist antibody is produced by B cells. This CD28 agonist antibody can bind to CD28 on the T cell surface and pre-activate the T cells (CD4+ and CD8+ T cells).
(32) A “T cell-sensitizing signal-transducing peptide” has 28-53 amino acid residues in length and comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 31, in which X.sup.8 is I or L; X.sup.10 is V, F or A. X.sup.11 is M or L, X.sup.17 is L or I.
(33) The T cell-sensitizing signal-transducing peptide comprises the critical region K.sup.1X.sup.2E.sup.3X.sup.4X.sup.5Y.sup.6P.sup.7P.sup.8P.sup.9Y.sup.10 (SEQ ID NO: 32), wherein X.sup.2 is I or L; X.sup.4 is V, F or A, X.sup.5 is M or L.
(34) A T cell sensitizing signal-transducing peptide (TDIYFCKIEFMYPPPYLDNEKSNGTIIH; SEQ ID NO: 31, wherein X.sup.8 is L. X.sup.10 is F, X.sup.11 is M, X.sup.17 is L) specific for mice was illustrated in the U.S. Patent No. 20140154285 A1.
(35) A PE translocation peptide may comprise an amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 4, 20 or 41. For example, the amino acid sequence of a PE translocation peptide may be a.a. 280-a.a. 313 (SEQ ID NO: 3), a.a. 268-a.a. 313 (SEQ ID NO: 20), a.a. 253-a.a. 313 (SEQ ID NO: 41), or a.a. 253-a.a. 364 (SEQ ID NO: 4) of full length PE (SEQ ID NO: 10). That is, the amino acid sequence of a PE translocation peptide may contain any region of the PE domain II (a.a. 253 to a.a. 364; SEQ ID NO: 4) as long as it comprises a.a. 280-a.a. 313 (SEQ ID NO: 3) essential fragment.
(36) An antigen may be a pathogenic protein, polypeptide or peptide that is responsible for a disease caused by the pathogen, or is capable of inducing an immunological response in a host infected by the pathogen, or tumor-associated antigen (TAA) which is a polypeptide specifically expressed in tumor cells. The antigen may be selected from a pathogen or cancer cells including, but not limited to, Human Papillomavirus (HPV), Porcine reproductive and respiratory syndrome virus (PRRSV), Human immunodeficiency virus-1 (HIV-1), flu virus, Dengue virus, Hepatitis C virus (HCV), Hepatitis B virus (HBV), Porcine Circovirus 2 (PCV2), Classical Swine Fever Virus (CSFV), Foot-and-mouth disease virus (FMDV), Newcastle disease virus (NDV), Transmissible gastroenteritis virus (TGEV), Porcine epidemic diarrhea virus (PEDV), Influenza virus, Pseudorabies virus, Parvovirus, Pseudorabies virus, Swine vesicular disease virus (SVDV), Poxvirus, Rotavirus, Mycoplasma pneumonia. Herpes virus, infectious bronchitis, or infectious bursal disease virus, non-small cell lung cancer, breast carcinoma, melanoma, lymphomas, colon carcinoma, hepatocellular carcinoma and any combination thereof. For example, HPV E7 protein (E7), HCV core protein (HCV core), HBV X protein (HBx) were selected as antigens for vaccine development. The antigen may be a fusion antigen from a fusion of two or more antigens selected from one or more pathogenic proteins. For example, a fusion antigen of PRRSV ORF6 and ORF5 fragments, or a fusion of antigenic proteins from PRRSV and PCV2 pathogens.
(37) The function of an endoplasmic reticulum retention sequence is to assist translocation of an antigen from an endocytotic compartment into ER and retains it in the lumen. It comprises the sequence Lys Asp Glu Leu (KDEL) or RDEL. An ER retention sequence may comprise, or consists essentially of, or consist of, the sequence of KKDLRDELKDEL (SEQ ID NO: 16), KKDELRDELKDEL (SEQ ID NO: 17), KKDELRVELKDEL (SEQ ID NO: 18), or KDELKDELKDEL (SEQ ID NO: 19).
(38) Receptor-associated protein (RAP1) with a molecular weight of 39 kDa is an ER resident protein and molecular chaperone for LDL receptor-related protein. It has a high binding affinity to CD91 (Kd˜3 nM) and is composed by three functional-similar domains.
(39) The PE.sub.407, (SEQ ID NO. 40) is described in prior patent (U.S. Pat. No. 7,335,361 B2) as PE(ΔIII).
(40) A nuclear export signal (NES) refers to a short amino acid sequence of 4 hydrophobic residues in a protein that targets it for export from the cell nucleus to the cytoplasm through the nuclear pore complex using nuclear transport. The NES is recognized and bound by exportins. The most common spacing of the hydrophobic residues to be L.sup.1X.sup.2X.sup.3K.sup.4L.sup.5X.sup.6X.sup.7L.sup.8X.sup.9L.sup.10X.sup.11 (SEQ ID NO. 44), where “L” is leucine, “K” is lysine and “X.sup.2,3,6,7,9,11” is any naturally occurring amino acid. For example, an artificial NES may comprise the sequence Leu Gin Lys Lys Leu Glu Glu Leu Glu Leu Ala (LQKKLEELELA: SEQ ID NO: 45).
(41) The term “NESK” refers to a fusion peptide of a NES and an ER retention signal (i.e., a NES fused to an ER retention signal). It is an artificial peptide possessing the function of a nuclear export signal (NES) and an ER retention sequence. Thus, it can export an antigen from the cell nucleus to the cytoplasm through the nuclear pore complex, and assist translocation of an antigen from the cytoplasm to ER and retain the antigen in the lumen of the ER. For example, the amino acid sequence of NESK may be LQKKLEELELAKDEL (SEQ ID NO: 43).
(42) The term “subject” refers to a human or a non-human animal.
(43) The term “treating” or “treatment” refers to administration of an effective amount of the fusion protein to a subject in need thereof, who has cancer or infection, or a symptom or predisposition toward such a disease, with the purpose of cure, alleviate, relieve, remedy, ameliorate, or prevent the disease, the symptoms of it, or the predisposition towards it. Such a subject can be identified by a health care professional based on results from any suitable diagnostic method.
(44) The term “an effective amount” refers to the amount of an active compound that is required to confer a therapeutic effect on the treated subject. Effective doses will vary, as recognized by those skilled in the art, depending on rout of administration, excipient usage, and the possibility of co-usage with other therapeutic treatment.
(45) Abbreviations: CD 28, Cluster of Differentiation 28.
EXAMPLES
(46) Without intent to limit the scope of the invention, exemplary instruments, apparatus, methods and their related results according to the embodiments of the present invention are given below. Note that titles or subtitles may be used in the examples for convenience of a reader, which in no way should limit the scope of the invention. Moreover, certain theories are proposed and disclosed herein; however, in no way they, whether they are right or wrong, should limit the scope of the invention so long as the invention is practiced according to the invention without regard for any particular theory or scheme of action.
(47) Immunogenic Protein Preparation:
(48) The immunogenic proteins were expressed in E. coli expression system. They may be antigen itself only, or antigen and a ER retention signal (K3) fused to the C-terminus of Pseudomonas exotoxin A domains I and II (i.e., PE.sub.407) to generate PE.sub.407-(antigen)-K3 fusion protein or antigen and a ER retention signal fused to the C-terminus of RAP1-CD28convPE.sub.t fusion protein to generate RAP1-CD28convPE.sub.t-(Antigen)-K3 fusion protein (
(49) Immunogenicity Analysis of Different Immunogenic Composition:
(50) The E7 immunogenic proteins. E7 antigen, PE.sub.407-E7-K3 fusion protein, or RAP1-CD28convPE.sub.t-E7-K3 fusion protein were combined with different adjuvant, such as alum, GPI-0100 or QS-21, and their immunogenicity were tested in mice. All immunogenic proteins could elicit medium to strong E7 antigen specific humoral immune response when combined with alum, GPI-0100 or QS-21. For E7 antigen specific cell mediated immune responses, weak to strong responses were elicited when E7 antigen or PE.sub.407-E7-K3 fusion protein were combined with GPI-0100 or QS-21. On the other hand, RAP1-CD28convPE.sub.t-E7-K3 fusion protein could elicit medium to strong cell mediated immune response when combined with alum, GPI-0100 and QS-21. These results revealed that GPI-0100 and QS-21 were better adjuvants to stimulate both humoral and cell mediated immune responses. Furthermore, PE.sub.407-E7-K3 or RAP1-CD28convPE.sub.t-E7-K3 fusion protein could elicit stronger responses than E7 antigen only when combined with saponin based adjuvant, such as GPI-0100 or QS-21.
(51) Animal Study for T Cell-Mediated Immune Response Female mice C57BL/6 at 5 weeks old of age were purchased from BioLASCO Taiwan Co., Ltd. 5 mice/cage with a 12 hour day/12 hour night light cycle. Given free access to food and water, the mice were housed for one week and maintained under standard conditions prior to experimentation. The immunogenic protein used for illustration was lyophilized PE.sub.407-E7-K3 (SEQ ID NO: 54), which was produced by The Vax Genetics Vaccine Co., Ltd., and each vial contained 0.6 mg protein. Adjuvants: GPI-0100 (Hawaii Biotech); MPL (Cat. No. 699800P, Avanti); Poly I:C (Cat. No. tlrl-pic-5, InvivoGen); R837 (Cat. No. tlrl-imqs, InvivoGen); R848 (Cat. No. tlrl-r848, InvivoGen); CpG1826 (Cat. No. tlrl-1826, InvivoGen); and Laboratory grade QS-21 (TheVax).
(52) The immunization schedule is as shown in
(53) Adjuvant Formulations
(54) To investigate the best immune response for immunogenic composition, adjuvant formulations listed in Table 1 were evaluated.
(55) TABLE-US-00001 TABLE 1 Group II (TLR agonist adjuvants) Group I Imidazolquinoline (Saponin-base Poly I:C MPL R837 R848 CpG1826 Formulation adjuvants) (TLR3 (TLR4 (TLR7 (TLR7/8 (TLR9 No. QS-21 GPI-0100 agonist) agonist) agonist) agonist) agonist) A Placebo B 100 μg C 50 μg D 50 μg E 50 μg F 50 μg G 50 μg H 50 μg I 50 μg 50 μg J 50 μg 50 μg K 50 μg 50 μg L 50 μg 50 μg M 50 μg 50 μg N 10 μg O 10 μg P 10 μg Q 10 μg R 10 μg S 10 μg T 10 μg 10 μg U 10 μg 10 μg V 10 μg 10 μg W 10 μg 10 μg X 10 μg 10 μg
Intracellular-Cytokine Staining of CD8.sup.+ Cells.
(56) Splenocytes (2*10.sup.7) were plated in 6-well flat-bottom tissue culture plates and incubated for 2 hours at 37° C., and with and without 1 μg/ml HPV.sub.16-E7 peptide (amino acids 49-57 of full length PE), and Brefeldin A, and Monensin to increased accumulation of cytokines in the cell enhances the detectability of cytokine-producing cells. After incubation, the cells were transferred to test tube at 300×g for 5 min. The supernatants were discarded, the plates were briefly vortexed, and the cells were stained for surface markers at 0.2 mg/sample of fluorescein isothiocyanate-conjugated anti-mouse CD8 (clone 53-6.7, eBioscience), and anti-mouse CD3 (clone 17A2. BioLegend) for 30 min. The cells were washed with 1 ml of fluorescence-activated cell sorter (FACS) buffer (1% FBS in PBS) and IC Fixation solution (eBioscience) by incubation on ice for 30 min in the dark after resuspension in 1 ml of permeabilization wash buffer (BioLegend). The cells were washed twice in Permwash (BD Pharmingen) and then stained for intracellular IFN-γ with allophycocyanin-conjugated anti-mouse IFN-γ (clone XMG1.2, eBioscience), at 0.2 mg/sample diluted in of permeabilization wash buffer for 30 min on ice in the dark. The cells were resuspension in 1 ml FACS buffer and then analyzed on a FACS Calibur flow cytometer.
(57) In the immunogenicity assays, antigen-specific T cell-mediated immune responses induced by various vaccine formulations were evaluated by measuring the numbers of CD3+/CD8+/IFNγ+ T cells in the splenocytes.
(58)
(59) Humoral Immunity Studies
(60) Animals were vaccinated and the serum samples were collected as described above. The serum samples from each animal and at each collection time point were diluted for 10000 times in blocking buffer. The level of HPV16 E7 specific IgG was detected by ELISA method (coating E7 pet32a 1 μg/well).
(61)
(62)
(63) T Cell-Mediated Immunogenic Response Elicited by Fusion Proteins of Different Platforms
(64) We further examines T cell-mediated immunogenic response elicited by different immunogenic proteins PE.sub.407-E7-K3 and RAP1-CD28convPE.sub.t-E7-K3 using the best combination of adjuvants discovered as described above, and performed the same immunogenicity assays as described in
(65)
(66) TABLE-US-00002 TABLE 2 Formula- tion No. Protein QS-21 GPI-0100 MPL CpG1826 A Placebo B PE.sub.407-E7-K3 10 μg 50 μg C 50 μg D 50 μg 50 μg E 50 μg 50 μg F 10 μg G 10 μg 10 μg H 10 μg 10 μg I RAP1- 10 μg 50 μg J CD28convPE.sub.t- 50 μg K E7-K3 50 μg 50 μg L 50 μg 50 μg M 10 μg N 10 μg 10 μg O 10 μg 10 μg
Studies on TC-1 Tumor Animal Model
(67) Vaccine: 100 μg of PE.sub.407-E7-K3 is formulated with different adjuvants or combination thereof. Vaccine formulations were shown in
(68) Table 3 shows SEQ ID NOs. of the components of various fusion proteins.
(69) Table 4 shows the fusion proteins tested for the effects on T cell-mediated immune responses in animals and the sequences of antigens.
(70) TABLE-US-00003 TABLE 3 Length Component SEQ ID NO: (residues) hCD28 Core 1 28 TDIYFCKIEVMYPPPYLDNEKSNGTIIH hCD28 Maximum 2 53 NCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNE KSNGTIIHVKG PE.sub.t Core (PE translocation domain core; a.a. 280- a.a. 313 of PE) 3 34 PE.sub.t Maximum (translocation domain maxi, a.a. 253 - a.a. 364 of PE) 4 112 RAP1 Minimum (domain III of RAP1) 5 104 A2M Minimum 6 153 HIV-Tat Minimum 7 24 HSPs Minimum,. Heat shock 70 kDa protein (HSPs; Homo sapiens) 8 641 Minimum Pseudomonas exotoxin A (PE) binding domain 1a (an 9 252 APC-binding domain, a.a. 1- a.a. 252 of PE) Linker R.sup.1X.sup.2R.sup.3X.sup.4K.sup.5R.sup.6, in which “X.sup.2,4” is any amino acid residue. 15 6 Full length PE (Exotoxin A mature lbrm, Pseudomonas aeruginosa) 10 613 Full length RAP1 (Homo sapiens low density lipoprotein receptor- 11 323 related protein associated protein 1, LRPAP1): Domain 1: a.a. 1-a.a. 112; domain 2: a.a. 113-a.a, 218; domain 3: a.a. 219-aa. 323. Full length A2M (Homo sapiens alpha-2-macroglobulin receptor 12 357 associated protein precursor) HIV-Tat (Human immunodeficiency virus 1) 13 101 KDEL (endoplasmic reticulum retention sequence) 14 4 KKDLRDELKDEL (K3) 16 12 KKDEIRDELKDEL (K3) 17 13 KKDELRVELKDEL (K3) 18 13 KDELKDELKDEL (K3) 19 12 PE.sub.268-313(a.a. 268-a.a. 313 of full length PE) 20 46 PLETFTRHRQPRGWEQLEQCGYPVQRLVALYLAARLSWNQV DQV1R CD28comvPEt 30 68 T.sup.1D.sup.2I.sup.3Y.sup.4F.sup.5C.sup.6K.sup.7X.sup.8E.sup.9X.sup.10X.sup.11Y.sup.12P.sup.13P.sup.14P.sup.15Y.sup.16X.sup.17D.sup.18N.sup.19E.sup.20K.sup.21S.sup.22N.sup.23 G.sup.24T.sup.25I.sup.26I.sup.27H.sup.28R.sup.29X.sup.30R.sup.31X.sup.32K.sup.33R.sup.34G.sup.35W.sup.36E.sup.37Q.sup.38L.sup.39E.sup.40Q.sup.41C.sup.42G.sup.43Y.sup.44 P.sup.45V.sup.46Q.sup.47R.sup.48L.sup.49V.sup.50A.sup.51L.sup.52Y.sup.53L.sup.54A.sup.55A.sup.56R.sup.57L.sup.58S.sup.59W.sup.60N.sup.61Q.sup.62V.sup.63D.sup.64Q.sup.65 V.sup.66I.sup.67R.sup.68, wherein X.sup.8 is I or L; X.sup.10 is V, F or A, X.sup.11 is M or L, X.sup.17 is L or I, X.sup.30,32 is any amino acid residue. CD28 consensus sequence 31 28 T.sup.1D.sup.2I.sup.3Y.sup.4F.sup.5C.sup.6K.sup.7X.sup.8E.sup.9X.sup.10X.sup.11Y.sup.12P.sup.13P.sup.14P.sup.15Y.sup.16X.sup.17 D.sup.18N.sup.18E.sup.20K.sup.21S.sup.22N.sup.23G.sup.24T.sup.25I.sup.26I.sup.27H.sup.28, wherein X.sup.8 is I or L; X.sup.10 is V, F CD28 critical region 32 10 K.sup.1X.sup.2E.sup.3X.sup.4X.sup.5Y.sup.6P.sup.7P.sup.8P.sup.9Y.sup.10, wherein X.sup.2 is I or L; X.sup.4 is V, R or A, X.sup.5 is M or L. SSX2 33 187 MAGE-A3 34 314 NY-ESO-1 35 181 iLRP 36 296 WT12-281 37 279 RNF43(2-116 + 696-783) 38 406 CEA-NE3 39 284 PE.sub.407(a.a. 1-a.a. 407 of full length PE) 40 407 PE.sub.253-313(a.a. 253-a.a. 313 of full length PE) 41 61 PE.sub.313(a,a. 1- a.a. 313 of full length PE) 42 313 NESK is LQKKLEELELAKDEL * 43 15 NES consensus sequence is L.sup.1X.sup.2X.sup.3K.sup.4L.sup.5X.sup.6X.sup.7L.sup.8X.sup.9L.sup.10X.sup.11, wherein 44 11 “L” is leucine, “K” is lysine and “X.sup.2,3,6,7,9,11” is any naturally occurring amino acid, NES is LQKKLEELELA 45 11 PCV2 ORF2 (Porcine Circovirus type 2 Open Reading Frame 2) 46 192 CSFV E2 (Classical Swine Fever Virus Envelope glycoprotein E2) 47 328 FMDV VP1 peptide (viral capsid protein a.a. 127-a.a. 176 of VP1) 48 50 FMDV 3A peptide (a.a. 21-35 of 3A) 49 15 FMDV (Foot-and-Mouth Disease Virus) VP1-3A peptide** 50 65 NDV F peptide (a.a. 65- a.a. 82 of Fusion protein) 51 18 NDV HN peptide (a.a. 101- a.a. 111 of Hemagglutinin- 52 11 Neuraminidase) NDV FHN peptide *** 53 29 PE.sub.407-E7-K3 54 525 RAP1-CD2SconvPE.sub.t-E7-K3 55 290 *: The bold letters represents the amino acid sequence of an artificial nuclear exporting signal; the underlined letters represents the amino acid sequence of an endoplasmic reticulum retention signal. **: The VP1 -3A peptide (SEQ ID NO: 50) is a fusion antigen composed of a.a. 127 - a.a. 176 of VP1 and a.a. 21-a.a. 35 of 3A; i.e., a fusion protein of FMDV VP1 peptide (SEQ ID NO: 48) and FMDV 3A peptide (SEQ ID NO 49). ***: The FHN peptide (SEQ ID NO: 53) is a fusion antigen composed of a.a. 65 - a.a. 82 of fusion protein and (a.a. 101-a.a. 111 at Hemaglutinin-Neuranninidase; i.e., a fusion protein of NDV F peptide (SEQ ID NO: 51) and NDV HN peptide (SEQ ID NO: 52).
(71) TABLE-US-00004 TABLE 4 Antigen SEQ Fusion protein name Antigen Name ID NO: RAP1-CD28convPE.sub.t-E7-K3 HPV16 E7 (full length) 21 PE.sub.407-E7-K3 RAP1-CD28convPE.sub.t-E7.sub.18-K3 HPV18 E7 (full length) 22 RAP1-CD28convPE.sub.t-HCVc-K3 HCV core protein (full length) 23 RAP1-CD28convPE.sub.t-HBx-K3 HBV X protein (full length) 24 RAP1-CD28convPE.sub.t-PCV2-K3 PCV2 ORF2 (a fragment of ORF2) 25 RAP1-CD28convPE.sub.t-DGD-K3 PRRSV nucleocapsid 26 (a fusion antigen: ORF7 a.a. 64-a.a. 123, linker and ORF7 a.a. 64-a.a. 123) RAP1-CD28convPE.sub.t-M12-K3 PRRSV RNA-dependent RNA polymerase 27 (ORF1b a.a. 1046-a.a. 1210) RAP1-CD28convPE.sub.t-PQAB-K3 PRRSV American strain: a fusion antigen of 28 ORF6 (a.a. 2-a.a. 26) and ORF5 (a.a. 31-a.a. 63) RAP1-CD28convPE.sub.t-RSAB-K3 PRRSV European strain: a fusion antigen of 29 ORF6 (a.a. 2-a.a. 28) and ORF5 (a.a. 31-a.a. 64)
(72) The embodiments and examples were chosen and described in order to explain the principles of the invention and their practical application so as to enable others skilled in the art to utilize the invention and various embodiments and with various modifications as are suited to the particular use contemplated. Alternative embodiments will become apparent to those skilled in the art to which the present invention pertains without departing from its spirit and scope. All references cited and discussed in this specification are incorporated herein by reference in their entireties and to the same extent as if each reference was individually incorporated by reference.