Charged peptide appendage to facilitate oriented protein covalent immobilization
09778265 · 2017-10-03
Assignee
Inventors
- George P. Anderson (Bowie, MD, US)
- Jinny Lin Liu (Ellicott City, MD, US)
- Marc P. Raphael (Springfield, VA, US)
- Ellen R. Goldman (Germantown, MD)
Cpc classification
C07K2319/73
CHEMISTRY; METALLURGY
G01N33/54393
PHYSICS
C07K19/00
CHEMISTRY; METALLURGY
C07K2317/569
CHEMISTRY; METALLURGY
International classification
G01N33/543
PHYSICS
C07K14/00
CHEMISTRY; METALLURGY
Abstract
Genetic fusions of proteins, for example single-domain antibodies (sdAbs), with a positively-charged domain enhanced immobilization of active protein in a desired orientation.
Claims
1. A fusion protein consisting of: a single-domain antibody; and a positively-charged domain with 100% sequence identity to SEQ ID No: 2 fused to a C-terminus of the single-domain antibody.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
DETAILED DESCRIPTION
Definitions
(7) Before describing the present invention in detail, it is to be understood that the terminology used in the specification is for the purpose of describing particular embodiments, and is not necessarily intended to be limiting. Although many methods, structures and materials similar, modified, or equivalent to those described herein can be used in the practice of the present invention without undue experimentation, the preferred methods, structures and materials are described herein. In describing and claiming the present invention, the following terminology will be used in accordance with the definitions set out below.
(8) The reactions and purification techniques involved in performing this invention are conducted according to manufacturer's specifications or as commonly accomplished in the art or as described herein. The foregoing techniques and procedures are generally performed according to conventional methods well known in the art and as described in various references that are cited and discussed throughout the present specification. See e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual (3rd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2001)), which is incorporated herein by reference.
(9) As used in this specification and the appended claims, the singular forms “a”, “an,” and “the” do not preclude plural referents, unless the content clearly dictates otherwise.
(10) As used herein, the term “and/or” includes any and all combinations of one or more of the associated listed items.
(11) As used herein, the term “about” when used in conjunction with a stated numerical value or range denotes somewhat more or somewhat less than the stated value or range, to within a range of ±10% of that stated.
(12) Overview
(13) Described herein is a technique whereby one can orient a recombinant protein (polypeptide) on a surface for subsequent use or to provide a favored site for the chemical addition of fluorescent, biotin, or similar molecules. To achieve this goal, a charged peptide is genetically appended to either the amino or carboxyl terminus of the polypeptide. Charged residues in the charged peptide will be both electrostatically attracted to an oppositely charged surface and provide the groups involved in the covalent attachment of the protein to the surface, and thereby orient the protein on the surface. These charged residues within the fusion protein would also be highly accessible and reactive for addition of a dye or biotin molecule, thereby avoiding interfering with the active site on the protein when chemically labeling the recombinant protein. As described below, this technique was particularly effective with single-domain antibodies.
(14) Single-domain antibodies (sdAbs) are recombinant derivatives of heavy-chain-only antibodies found in camelids and sharks. Heavy-chain-only antibodies are distinct from conventional antibodies in that they lack the typical heavy-chain/light-chain structure. The binding element for conventional antibodies is composed of both a heavy-chain variable domain and light-chain variable domain so that the functional component of the antibody is divided between two distinct proteins. By contrast, the binding element of a heavy-chain-only antibody is composed of a single domain. This confers two features that have been exploited. First, this binding domain can be isolated from the heavy-chain and used as a very small (˜15 kDa) functional protein by itself. Secondly, as compared to a conventional antibody, the lack of posttranslational modifications in sdAbs allows for their production in bacterial expression systems rather than more complex and costly eukaryotic systems. The basic structure, composition, preparation, and uses of relevant antibodies are described in, for example, U.S. Pat. Nos. 5,800,988; 5,840,526; 5,874,541; 6,005,079; 6,015,695; and 6,765,087. Use of the term “antibody,” “sbAb,” or the like herein includes reference to fusion proteins thereof.
(15) Genetic fusions of single domain antibodies (sdAb) with biotin binding proteins facilitated their oriented attachment to biotin surfaces, and provided a more active capture surface for immunoassay applications than sdAb that were covalently attached in a relatively random orientation. While the use of biotin binding protein fusion molecules were effective, the present inventors were interested in finding a method to achieve the same result without the need to attach a large protein to the sdAb. Thus, the utility of a positively charged, lysine-containing peptide appended to the carboxyl terminus of the sdAb was evaluated.
(16) Exemplary Configurations
(17) It was contemplated that the lysines on the C-terminus of the sdAb would enable directional immobilization using standard EDC/NHS chemistry that is a commonly utilized linking chemistry for proteins to surfaces. Structurally, the binding loops of sdAb are located on the opposite side from their C-terminus, resulting in an orientation with the positive, lysine-containing tail coupled to the surface and the binding region oriented for optimal antigen capture. This has potential to dramatically enhance the percentage of active protein immobilized. For the initial attempt to test this hypothesis, a genetic construct termed sdAb clone C8 (which binds ricin) was genetically linked to a positively charged leucine zipper (termed +Zip) having the amino acid sequence AAAGGGGSGGGGSGGGGSAQLKKKLQALKKKNAQLKWKLQALKKKL AQGGD (SEQ ID No: 1). The utility of this tail to provide oriented immobilization of an anti-ricin sdAb and the subsequent improvement in the ability of the sensor to detect ricin was demonstrated.
(18) To demonstrate the range of this concept, a smaller positively charged peptide (termed GS-3K), and having the amino acid sequence AAAGGGGSGGGGSKKK (SEQ ID No: 2) was tested and found to not hinder the recombinant production of the sdAb to the same degree as positively charged leucine zipper did. This sdAb-GS-3K construct would also provide an oriented capture surface that was significantly more active than when the sdAb was randomly attached. The sdAb-GS-3K was demonstrated for oriented attachment to MagPlex microspheres first. The concept was repeated using two different sdAb and their corresponding sdAb-GS-3K constructs that were prepared. Tests found the oriented immobilized sdAb-GS-3K to provide enhanced detection of ricin relative to the randomly attached sdAb. These results were later confirmed by SPR measuring the improvement in ricin capture by the oriented sdAb-GS-3K relative to random sdAb using SPR GLC sensor chips, designed by Bio-Rad for general amine coupling via a compact polymer layer.
(19) To optimize activity of an immobilized recombinant protein, it is preferred that the binding site remains unobstructed and that the molecule retains substantial freedom of movement. Likewise, when one prepares a chemical conjugate of a protein it is ideal to place the added molecule sufficiently far from the protein active/binding site that no impairment in activity occurs. To achieve these results, additional amino acids which included a number of positively charged residues (lysine) were genetically added to the C-terminal end of a ricin binding single domain antibody (sdAb). When this sdAb with the positive tail, which was termed C8-positive-leucine-zipper-his and had the amino acid sequence EVQLQASGGGLVQGGDSLRLSCAASGRTLGDYGVAWFRQAPGKERE FVSVISRSTIITDYANSVKGRFTISRDNAKNAVYLQMNSLKPEDTAVYYC AVIANPVYATSRNSDDYGHWGQGTQVTVSSAAAGGGGSGGGGSGGGG SAQLKKKLQALKKKNAQLKWKLQALKKKLAQGGDALEHHHHHH (SEQ ID No: 3), was utilized in place of the same sdAb that lacked the positive tail, which was termed c8-GS-3k and had the amino acid sequence EVQLQASGGGLVQGGDSLRLSCAASGRTLGDYGVAWFRQAPGKEREFVS VISRSTIITDYANSVKGRFTISRDNAKNAVYLQMNSLKPEDTAVYYCAVIA NPVYATSRNSDDYGHWGQGTQVTVSSEPKTPKPQPAASGAEFAAAGGG GSGGGGSKKKALEHHHHHH (SEQ ID No: 4), the percentage of protein that immobilized in an active orientation onto a negatively charged SPR surface, used as supplied, dramatically increased by >4 fold, as seen in
(20) Another example demonstrated an improvement in ricin detection using an oriented sdAb versus random, in this case showing a signal increase of 1.7 fold for the +Zip linker and 1.4 fold for the GS-3K linker. This illustrates that both linkers consistently resulted in improvement over the standard recombinant protein (
(21) Another example, illustrated in
(22) Following initial binding, covalent attachment can be made using 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC) crosslinking chemistry. Other forms of covalent attachment can be made as known in the art.
(23) One key advantage of this methodology is that it makes use of the surface chemistry already being widely utilized, thus it is relatively transparent to the user. Many detection/measurement systems make use of carboxyl modified surfaces for the attachment of biomolecules, the technique described here make use of these same surfaces but achieves on average a much more active and oriented molecule on that surface. This method is highly flexible, in that while it was demonstrated with sdAb, it is expected to operate on nearly any recombinant protein such as single chain antibodies, enzymes, etc. In addition, the utility is not simply for the immobilization to surfaces, but the same tail can be utilized for the addition of molecules such as biotin, fluorophores, dyes, or other molecules of interest. It is further contemplated that the addition of negatively charged leader sequences or tails should could useful for attachment to positively charged (lysine) surfaces.
CONCLUDING REMARKS
(24) All documents mentioned herein are hereby incorporated by reference for the purpose of disclosing and describing the particular materials and methodologies for which the document was cited.
(25) Although the present invention has been described in connection with preferred embodiments thereof, it will be appreciated by those skilled in the art that additions, deletions, modifications, and substitutions not specifically described may be made without departing from the spirit and scope of the invention. Terminology used herein should not be construed as being “means-plus-function” language unless the term “means” is expressly used in association therewith.