COMPOSITIONS AND METHODS FOR DETECTION AND TREATMENT OF CORONAVIRUS INFECTION
20220042992 · 2022-02-10
Assignee
- The Translational Genomics Research Institute (Phoenix, AZ)
- Arizona Board Of Regents On Behalf Of Northern Arizona University (Flagstaff, AZ)
Inventors
Cpc classification
A61K39/215
HUMAN NECESSITIES
C12N7/00
CHEMISTRY; METALLURGY
C12N2770/20034
CHEMISTRY; METALLURGY
C12N2770/20022
CHEMISTRY; METALLURGY
International classification
A61K39/215
HUMAN NECESSITIES
Abstract
The present disclosure includes a multiplexed peptide assay to generate an epitope-resolved view of antibody reactivity across all human coronaviruses (CoVs). PepSeq accurately classifies SARS-CoV-2 exposure status and reveals epitopes across the Spike and Nucleocapsid proteins. Two of these represent recurrent reactivities to conserved, functionally-important sites in the S2 subunit of Spike, regions that we show are also targeted for the endemic CoVs in pre-pandemic controls. At one of these sites, we demonstrate that the SARS-CoV-2 response strongly and recurrently cross-reacts with the endemic virus hCoV-OC43. The disclosed epitope-resolved analysis reveals new CoV targets for the development of diagnostics, vaccines and therapeutics, including a site that may have broad neutralizing potential.
Claims
1. A method of detecting in a sample the presence of an antibody that binds to a spike protein or a nucleocapsid protein of a severe acute respiratory syndrome-associated coronavirus (SARS-CoV), the method comprising: providing a biological sample from a subject suspected to be infected with a SARS-CoV; contacting the biological sample with a peptide comprising an amino acid sequence having at least 85% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-4, 275-412, and 421-423; and detecting antigen-antibody complexes formed.
2. The method of claim 1, wherein the method comprises the step of: detecting in the biological sample from the subject the presence or absence of an antibody to at least one of a first peptide, a second peptide, a third peptide, and a fourth peptide; wherein the first peptide comprises a first amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 1; the second peptide comprises a second amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 2; the third peptide comprises a third amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 3; and the fourth peptide comprises a fourth amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 4.
3. The method of claim 2, wherein the method comprises detecting in the biological sample from the subject the presence or absence of an antibody to the first peptide, second peptide, third peptide, and fourth peptide.
4. The method of claim 1, wherein the method comprises the step of detecting in the biological sample from the subject the presence or absence of: a first antibody to a peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 421; a second antibody to a peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 422; and/or a third antibody to a peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 423.
5. The method of claim 4, wherein the method comprises detecting in the biological sample from the subject the presence or absence of the first antibody, the second antibody, and the third antibody.
6. The method of claim 1, wherein the SARS-CoV is severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).
7. The method of claim 1, wherein the biological sample is whole blood, serum, or plasma.
8. The method of claim 1, wherein the subject is a human.
9. The method of claim 1, wherein the method of detecting antigen-antibody complexes comprises a technique selected from the group consisting of flow cytometry, immunohistochemistry, enzyme-linked immunosorbent assay (ELISA), Western Blot, and immunoaffinity chromatography.
10. An immunogenic composition, comprising: a peptide comprising an amino acid sequence having at least 85% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-4, 275-412, and 421-423; and a pharmaceutically acceptable carrier or adjuvant.
11. The immunogenic composition of claim 10, wherein the composition comprises: a first peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 1; a second peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 2; a third peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 3; and/or a fourth peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 4.
12. The immunogenic composition of claim 10, wherein the composition comprises: a first peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 421; a second peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 422; and/or a third peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 423.
13. A method of eliciting an immune response in a subject, the method comprising administering to the subject the immunogenic composition of claim 10.
14. A method of detecting in a sample the presence of an antibody that binds to a spike protein or a nucleocapsid protein of a severe acute respiratory syndrome-associated coronavirus (SARS-CoV), the method comprising: providing a biological sample from a subject suspected to be infected with a SARS-CoV; contacting the biological sample with a peptide comprising an amino acid sequence having at least 85% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-4, 275-412, and 421-447; and detecting antigen-antibody complexes formed.
15. The method of claim 14, wherein the method comprises the step of detecting in the biological sample from the subject the presence or absence of: a first antibody to a peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 422; a second antibody to a peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 423; a third antibody to a peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 435; a fourth antibody to a peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 441; a fifth antibody to a peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 442; and/or a sixth antibody to a peptide comprising an amino sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 447.
16. The method of claim 15, wherein the method comprises the step of detecting in the biological sample from the subject the presence or absence of the first antibody, second antibody, third antibody, fourth antibody, fifth antibody, and sixth antibody.
17. The method of claim 14, wherein the SARS-CoV is severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).
18. The method of claim 14, wherein the biological sample is whole blood, serum, or plasma.
19. The method of claim 14, wherein the subject is a human.
20. The method of claim 14, wherein the method of detecting antigen-antibody complexes comprises a technique selected from the group consisting of flow cytometry, immunohistochemistry, enzyme-linked immunosorbent assay (ELISA), Western Blot, and immunoaffinity chromatography.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0036] Illustrative and exemplary embodiments of the invention are shown in the drawings in which:
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
DETAILED DESCRIPTION
[0046] It is to be understood that unless specifically stated otherwise, references to “a,” “an,” and/or “the” may include one or more than one and that reference to an item in the singular may also include the item in the plural. Reference to an element by the indefinite article “a,” “an” and/or “the” does not exclude the possibility that more than one of the elements are present, unless the context clearly requires that there is one and only one of the elements. As used herein, the term “comprise,” and conjugations or any other variation thereof, are used in its non-limiting sense to mean that items following the word are included, but items not specifically mentioned are not excluded.
[0047] Generally, some embodiments of the present invention can be used to develop diagnostics, therapies, and vaccines for coronavirus infection based on the peptides and epitopes identified in the present disclosure. Among the various aspects of the present invention is the provision of one or more targets for diagnosing, treating, and preventing coronavirus infection in a subject. The disclosed epitope regions of coronaviruses, including SARS-CoV-2, indicate uses including serological assays, vaccines for eliciting antibodies, and predicting an individual's antibody response to a coronavirus infection.
[0048] The invention may comprise methods for detecting the presence of, exposure to, or infection by a particular virus in a sample. The invention may further comprise methods of population screening, predicting immune response or disease outcome in an individual, serological assays, and neutralization assays. The invention may further comprise a method of eliciting neutralization antibodies to coronavirus.
[0049] The sample in this method is preferably a biological sample from a subject. The term “sample” or “biological sample” is used in its broadest sense. Depending upon the embodiment of the invention, for example, a sample may comprise a bodily fluid including whole blood, serum, plasma, urine, saliva, cerebral spinal fluid, semen, vaginal fluid, pulmonary fluid, tears, perspiration, mucus and the like; an extract from a cell, chromosome, organelle, or membrane isolated from a cell; a cell; genomic DNA, RNA, or cDNA, in solution or bound to a substrate; a tissue; a tissue print, or any other material isolated in whole or in part from a living subject or organism. Biological samples may also include sections of tissues such as biopsy and autopsy samples, and frozen sections taken for histologic purposes such as blood, plasma, serum, sputum, stool, tears, mucus, hair, skin, and the like. Biological samples also include explants and primary and/or transformed cell cultures derived from patient tissues.
[0050] The terms “peptide,” “polypeptide,” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones. These terms also include proteins that are post-translationally modified through reactions that include glycosylation, acetylation and phosphorylation. The term “at least a portion” of a polypeptide means a portion having the minimal size characteristics of such sequences, or any larger fragment of the full length molecule, up to and including the full length molecule. For example, a portion of a polypeptide may be 4 to 15 amino acids, or may be 4 amino acids, 5 amino acids, 6 amino acids, 7 amino acids, and so on, up to a full length polypeptide. A portion of a polypeptide useful as an epitope may be as short as 4 amino acids. A portion of a polypeptide that performs the function of the full-length polypeptide would generally be longer than 4 amino acids.
[0051] The term “amino acid” refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified. Unnatural amino acids are not encoded by the genetic code and can, but do not necessarily have the same basic structure as a naturally occurring amino acid. “Amino acid analogs” refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs may have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. “Amino acid mimetics” refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
[0052] Amino acids may be referred to by either the three letter symbols or by the one-letter symbols recommended by the IUPAC, the IUAPC letter code are as follows: G=Glycine; A=Alanine; L=Leucine; M=Methionine; F=Phenylalanine; W=Tryptophan; K=Lysine; Q=Glutamine; E=Glutamic Acid; S=Serine; P=Proline; V=Valine; I=Isoleucine; C=Cysteine; Y=Tyrosine; H=Histidine; R=Arginine; N=Asparagine; D=Aspartic Acid; T=Threonine.
[0053] The terms “homologous” and “similar” refer to the relationship between proteins that possess a “common evolutionary origin,” including proteins from superfamilies (e.g., the immunoglobulin superfamily) and homologous proteins from different species. Such proteins (and their encoding genes) have sequence homology, as reflected by their sequence similarity, whether in terms of percent similarity or the presence of specific residues or motifs as conserved positions. In a specific embodiment, two peptide sequences are “substantially homologous or similar” when at least about 80%, or at least about 90%, or at least about 95) of the amino acids match over the defined lengths of the amino acid sequences.
[0054] The term “variant” applies to both amino acid and nucleic acid sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Variants may include individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence.
[0055] “Function-conservative variants” are those in which a given amino acid residue in a protein or enzyme has been changed without altering the overall conformation and function of the polypeptide, including, but not limited to, replacement of an amino acid with one having similar properties (such as, for example, polarity, hydrogen bonding potential, acidic, basic, hydrophobic, aromatic, and the like). Amino acids with similar properties are well known in the art. For example, arginine, histidine and lysine are hydrophilic-basic amino acids and may be interchangeable. Similarly, isoleucine, a hydrophobic amino acid, may be replaced with leucine, methionine or valine. Such changes are expected to have little or no effect on the apparent molecular weight or isoelectric point of the protein or polypeptide.
[0056] Amino acids other than those indicated as conserved may differ in a protein so that the percent protein or amino acid sequence similarity between any two proteins of similar function may vary and may be, for example, from 70% to 99% as determined according to an alignment scheme. A “variant” also includes a polypeptide which has at least 60% amino acid identity as determined by BLAST or FASTA algorithms, preferably at least 75% most preferably at least 85%, and even more preferably at least 90%, and still more preferably at least 95%, and which has the same or substantially similar properties or functions as the native or parent protein to which it is compared. A particular variant is a “gain-of-function” variant, meaning a polypeptide variant in which the change of at least one given amino acid residue in a protein or enzyme improves a specific function of the polypeptide, including, but not limited to protein activity. The change in amino acid residue can be replacement of an amino acid with one having similar properties.
[0057] The term “antibody” is used herein in the broadest sense and refers generally to a molecule that contains at least one antigen binding site that immunospecifically binds to a particular antigen target of interest. The term “antibody” thus includes but is not limited to native antibodies and variants thereof, fragments of native antibodies and variants thereof, peptibodies and variants thereof, and antibody mimetics that mimic the structure and/or function of an antibody or a specified fragment or portion thereof, including single chain antibodies and fragments thereof. The term “antibody,” thus, includes full length antibodies and/or their variants, as well as fragments thereof. Binding of an antibody to a target can cause a variety of effects, such as but not limited to where such binding modulates, decreases, increases, antagonizes, agonizes, mitigates, alleviates, blocks, inhibits, abrogates and/or interferes with at least one target activity or binding, or with receptor activity or binding, in vitro, in situ, and/or in vivo.
[0058] Antibodies (Abs) can be assigned to different classes, which differ in their biological properties, functional locations, and ability to deal with different antigens. There are five major classes of immunoglobulins (Ig): IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2. The classes of immunoglobulins differ in their biological properties, functional locations, and interactions with different antigens. Immunoglobulin G (IgG), the major antibody in serum, is a heterotetrameric protein with two heavy chains and two light chains. IgG can be cleaved into three 50-kd fragments: two Fab fragments that bind antigen (F=fragment, ab=antigen binding), and an Fc fragment that crystallizes readily and does not bind antigen. The Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab fragments differ from Fab′ fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region. Fab′-SH is the designation herein for Fab′ in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab′)2 antibody fragments originally were produced as pairs of Fab′ fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
[0059] The term “antigen” refers to any substance that triggers the immune system to produce antibodies against it. An antigen acts by stimulating the proliferation of the small number of cells that were already forming an antibody capable of recognizing the antigen.
[0060] Antibodies have specific and high affinity for the antigens that elicited their synthesis. Synthetic peptides can serve as antigens to stimulate the formation of specific antibodies. An antibody recognizes, on a large molecule, a specific group or cluster of amino acids called an epitope.
[0061] As used herein, the term “epitope” refers to a portion of an antigenic molecule to which an antibody is produced and to which the antibody will bind. For example, a “Coronavirus epitope” comprises the part of a coronavirus protein to which an anti-coronavirus antibody specifically binds. Epitopes can comprise linear amino acid residues (i.e., residues within the epitope are arranged sequentially one after another in a linear fashion), nonlinear amino acid residues, or both linear and nonlinear amino acid residues.
[0062] The terms “immunogen” and “immunogenic” refer to any compound or substance that is capable of eliciting an immune response in a human or non-human individual to the compound or substance, such as an antigen.
[0063] As used herein, the term “binding” refers to an attractive interaction between two molecules which results in a stable association in which the molecules are in close proximity to each other. Molecular binding can be classified into the following types: non-covalent, reversible covalent and irreversible covalent. Molecules that can participate in molecular binding include proteins, nucleic acids, carbohydrates, lipids, and small organic molecules such as pharmaceutical compounds. For example, proteins that form stable complexes with other molecules are often referred to as receptors while their binding partners are called ligands. Nucleic acids can also form stable complex with themselves or others, for example, DNA-protein complex, DNA-DNA complex, DNA-RNA complex.
[0064] As used herein, the term “specific binding” refers to the specificity of a binder, e.g., a protein or an antibody, such that it preferentially binds to a target, such as a polypeptide antigen, a receptor, or an antibody. When referring to a binding partner, e.g., protein, nucleic acid, antibody or other affinity capture agent, etc., “specific binding” can include a binding reaction of two or more binding partners with high affinity and/or complementarity to ensure selective hybridization under designated assay conditions. Typically, specific binding will be at least three times the standard deviation of the background signal. Thus, under designated conditions the binding partner binds to its particular target molecule and does not bind in a significant amount to other molecules present in the sample. Recognition by a binder or an antibody of a particular target in the presence of other potential interfering substances is one characteristic of such binding. Preferably, binders, antibodies or antibody fragments, peptides, or fusion peptides that are specific for or bind specifically to a target bind to the target with higher affinity than binding to other non-target substances. Also preferably, binders, antibodies or antibody fragments, peptides, or fusion peptides that are specific for or bind specifically to a target avoid binding to a significant percentage of non-target substances, e.g., non-target substances present in a testing sample. The binding affinity of an antibody to a target antigen, antigenic fragment, peptide, or fusion peptide, comprising the cognate epitope can be readily determined using any of a number of methods available in the art including, but not limited to, enzyme linked immunosorbent assay (ELISA). In some embodiments, binders, antibodies or antibody fragments, peptides, or fusion peptides of the present disclosure avoid binding greater than about 90% of non-target substances, although higher percentages are clearly contemplated and preferred. For example, binders, antibodies or antibody fragments, peptides, or fusion peptides of the present disclosure avoid binding about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, and about 99% or more of non-target substances. In other embodiments, binders, antibodies or antibody fragments, peptides, or fusion peptides of the present disclosure avoid binding greater than about 10%, 20%, 30%, 40%, 50%, 60%, or 70%, or greater than about 75%, or greater than about 80%, or greater than about 85% of non-target substances.
[0065] A target or a marker may be any molecular structure produced by a cell, expressed inside the cell, accessible on the cell surface, or secreted by the cell. A marker may be any protein, carbohydrate, fat, nucleic acid, catalytic site, or any target of these such as an enzyme, glycoprotein, cell membrane, virus, cell, organ, organelle, or any uni- or multimolecular structure or any other such structure now known or yet to be disclosed whether alone or in combination. A target may also be called a marker and the terms are used interchangeably.
[0066] A target may be represented by the sequence of amino acids, or sequence of one or more strands of a nucleic acid from which it may be derived. For example, a target may be represented by a protein sequence. Alternatively, a target may be represented by a nucleic acid sequence, the protein or peptide or the fragments thereof encoded by the nucleic acid sequence. Examples of such nucleic acids include both single stranded and double stranded nucleic acid sequences including miRNA, tRNA, siRNA, mRNA, cDNA, or genomic DNA sequences including complimentary sequences. The concept of a marker is not limited to the products of the exact nucleic acid sequence or protein sequence by which it may be represented. Rather, a marker encompasses all molecules that may be detected by a method of assessing the expression of the marker. Examples of molecules encompassed by a marker include point mutations, silent mutations, deletions, frameshift mutations, translocations, alternative splicing derivatives, differentially methylated sequences, differentially modified protein sequences, truncations, soluble forms of cell membrane associated markers, and any other variation that results in a product that may be identified as the marker. The term “target” further encompasses the products (i.e., proteins) of the gene or a gene allele thereof, whose expression or activity is directly or indirectly associated with a particular phenotype or cellular condition, or physiological characteristic.
[0067] Indirect methods of detecting a marker generally involve assessing the expression of material created from a genomic DNA template such as an RNA or protein molecule. Such expression may be assessed by any of a number of methods used currently in the art and yet to be developed. Examples include any nucleic acid detection method including the following nonlimiting examples, microarray RNA analysis, RNA in situ hybridization, RNAse protection assay, Northern blot, reverse transcription PCR, and quantitative reverse transcription PCR. Other examples include any process of detecting expression that uses an antibody including the following nonlimiting examples, flow cytometry, immunohistochemistry, ELISA, Western blot, Northwestern blot, and immunoaffinity chromatography. Antibodies may be monoclonal, polyclonal, or any antibody fragment including a Fab, F(ab).sub.2, Fv, scFv, phage display antibody, peptibody, multispecific ligand, or any other reagent with specific binding to a target. Other methods of assessing protein expression include the following nonlimiting examples: HPLC, mass spectrometry, protein microarray analysis, PAGE analysis, isoelectric focusing, 2-D gel electrophoresis, and enzymatic assays.
[0068] One aspect of the disclosure encompasses methods of eliciting an immune response in a subject by administering to the subject an immunogenic composition. The methods may include recruiting an antiviral antibody in the subject, to protect the subject against a coronavirus infection. The methods, vaccines, and therapeutics may include including a peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-4 and 421-423. The methods, vaccines, and therapeutics may include, for example, a monoclonal antibody produced using the peptides disclosed herein.
[0069] Agents that interact with a therapeutic target to result in a desirable therapeutic effect may include a pharmaceutically active ingredient or pharmaceutically acceptable salt thereof, a drug, a toxin, a chemical, a small organic molecule, a large molecule or peptide or an antibody. Large-molecule pharmaceuticals refer to pharmaceutical agents having a molecular weight greater than about 1000 Daltons, e.g., peptidic drugs, vaccines and hormones. The term “antibody” is used herein in the broadest sense and refers generally to a molecule that contains at least one antigen binding site that immunospecifically binds to a particular antigen target of interest. Antibody thus includes but is not limited to native antibodies and variants thereof, fragments of native antibodies and variants thereof, peptibodies and variants thereof, and antibody mimetics that mimic the structure and/or function of an antibody or a specified fragment or portion thereof, including single chain antibodies and fragments thereof. The term, thus, includes full length antibodies and/or their variants as well as immunologically active fragments thereof, thus encompassing, antibody fragments capable of binding to a biological molecule (such as an antigen or receptor) or portions thereof, including, but not being limited to, Fab, Fab′, F(ab′)2, facb, pFc′, Fd, Fv or scFv (See, e.g., CURRENT PROTOCOLS IN IMMUNOLOGY, (Colligan et al., eds., John Wiley & Sons, Inc., NY, 1994-2001).
[0070] The screening or creation, identification and selection of appropriate therapeutic agent through the target identified herein can be accomplished by a variety of methods. One approach is to use structural knowledge about the target protein to design a candidate molecule with which it will precisely interact. An example would be computer assisted molecular design. A second approach is to use combinatorial or other libraries of molecules, whereby a large library of molecules is screened for inhibitory effect with regard to the target gene or protein expression, or ability to inhibit the transcriptional factor activity of the target protein. In a further example, a panel of antibodies may be screened for their ability to inhibit the target protein.
[0071] The term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Various procedures known in the art may be used for the production of polyclonal or monoclonal antibodies to Coronavirus polypeptides or derivatives or analogs thereof. For the production of antibodies, various host animals can be immunized by injection with the antigenic polypeptide, including but not limited to rabbits, mice, rats, sheep, goats, etc. For preparation of monoclonal antibodies directed toward the Coronavirus polypeptides, any technique that provides for the production of antibody molecules by continuous cell lines in culture may be used. These include but are not limited to the hybridoma technique originally developed by Kohler and Milstein (Nature 256:495-497, 1975), as well as the trioma technique, the human B-cell hybridoma technique (Kozbor et al., Immunology Today 4:72, 1983; Cote et al., Proc. Natl. Acad. Sci. U.S.A. 80:2026-2030, 1983), and the EBV-hybridoma technique to produce human monoclonal antibodies (Cole et al., in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96, 1985).
[0072] In the preparation of the pharmaceutical compositions comprising the antibodies described in the teachings herein, a variety of vehicles and excipients and routes of administration may be used, as will be apparent to the skilled artisan. Representative formulation technology is taught in, inter alia, Remington: The Science and Practice of Pharmacy, 19th Ed., Mack Publishing Co., Easton, Pa. (1995) and Handbook of Pharmaceutical Excipients, 3rd Ed, Kibbe, A. H. ed., Washington D.C., American Pharmaceutical Association (2000); hereby incorporated by reference in their entirety.
[0073] In other embodiments there is provided a pharmaceutical composition including an antibody or fragment as described above together with a pharmaceutically acceptable carrier, diluent or excipient. As used herein, “carrier(s)” can be used interchangeably with “excipient(s)” Carriers include any substance that may be administered with the one or more disclosed compounds with the intended purpose of facilitating, assisting, or helping the administration or other delivery of the compound. Carriers include any liquid, solid, semisolid, gel, aerosol or anything else that may be combined with the disclosed compound to aid in its administration. Examples include diluents, adjuvants, excipients, water, and oils (including petroleum, animal, vegetable or synthetic oils). Thus, the pharmaceutical compositions may generally comprise a pharmaceutically acceptable carrier and a pharmacologically effective amount of the antibodies, or mixture of antibodies. The pharmaceutical composition may be formulated as powders, granules, solutions, suspensions, aerosols, solids, pills, tablets, capsules, gels, topical creams, suppositories, transdermal patches, and other formulations known in the art.
[0074] The pharmaceutical compositions described herein may be administered by any means that enables the active agent to reach the agent's site of action in the body of the subject. The dosage administered varies depending upon factors, such as: pharmacodynamic characteristics; mode and route of administration; age, health, and weight of the recipient subject; nature and extent of symptoms; concurrent treatments; and frequency of treatment.
[0075] As used herein, the terms “administration” and “administering” of an agent to a subject include any route of introducing or delivering the agent to a subject to perform its intended function. Administration can be carried out by any suitable route, including intravenously, intramuscularly, intraperitoneally, inhalationally, intranasally, or subcutaneously. Administration includes self-administration and the administration by another.
[0076] The term “effective amount” or “therapeutically effective amount” refers to that amount of an agent or combination of agents as described herein that is sufficient to effect the intended application including, but not limited to, disease treatment and/or disease prevention. A therapeutically effective amount may vary depending upon the intended application (in vitro or in vivo), or the subject and disease condition being treated (e.g., the weight, age and gender of the subject), the severity of the disease condition, or the manner of administration. The term also applies to a dose that will induce a particular response in target cells. The specific dose will vary depending on the particular agents chosen, the dosing regimen to be followed, whether the agent is administered in combination with other agents, timing of administration, the tissue to which it is administered, and the physical delivery system in which the compound is carried.
[0077] The terms “treatment,” “treating,” “treat,” and the like, refer to obtaining a desired pharmacologic and/or physiologic effect. The effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease. “Treatment”, as used herein, covers any treatment of a disease in a mammal, particularly in a human, and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development or progression; and (c) relieving the disease, i.e., causing regression of the disease and/or relieving one or more disease symptoms. “Treatment” is also meant to encompass delivery of an agent in order to provide for a pharmacologic effect, even in the absence of a disease or condition. For example, “treatment” encompasses delivery of a composition that can elicit an immune response or confer immunity in the absence of a disease condition, e.g., in the case of a vaccine.
[0078] As used herein, the term “patient” or “subject” refers to any organism to which a provided composition is or may be administered, e.g., for experimental, diagnostic, prophylactic, cosmetic, and/or therapeutic purposes. For example, subject may refer to a human or a non-human animal. In some aspects, subject refers to any vertebrate including, without limitation, humans and other primates (e.g., chimpanzees and other apes and monkey species), farm animals (e.g., cattle, sheep, pigs, goats and horses), domestic mammals (e.g., dogs and cats), laboratory animals (e.g., rodents such as mice, rats, and guinea pigs), and birds (e.g., domestic, wild and game birds such as chickens, turkeys and other gallinaceous birds, ducks, geese, and the like). In some embodiments, the subject is a mammal. In further embodiments, the subject is a human.
[0079] The following examples are given for illustrative and non-limiting purposes of the present invention.
EXAMPLES
[0080] In this example, a multiplexed peptide assay (‘PepSeq’) was used to generate an epitope-resolved view of antibody reactivity across all human coronaviruses (CoVs). PepSeq accurately classified SARS-CoV-2 exposure status and revealed epitopes across the Spike and Nucleocapsid proteins. Two of these epitopes represent recurrent reactivities to conserved, functionally-important sites in the S2 subunit of Spike, regions that we show are also targeted for the endemic CoVs in pre-pandemic controls. At one of these sites, we demonstrate that the SARS-CoV-2 response strongly and recurrently cross-reacts with the endemic virus hCoV-OC43. Our epitope-resolved analysis reveals new targets for the development of diagnostics, vaccines and therapeutics, including a site that may have broad neutralizing potential.
Methods
Samples
[0081] COVID-19 convalescent serum and plasma samples were collected at four clinical sites from patients who had tested positive for SARS-CoV-2 by RT-PCR a median of 28.5 days prior. Pre-pandemic negative control samples were collected from two sites. Pre-pandemic negative control serum samples were characterized using our SCV2 library (n=17). These samples were collected during January 2015 from multiple locations in California. Pre-pandemic negative control serum samples characterized using our HV library (n=33) were collected during 2019 (latest collections were during the first week of December). Serum was obtained from whole blood using lithium heparin gel plasma separator tubes followed by centrifugation.
PepSeq Library Design
[0082] We designed two different libraries of peptides in order to assess antibody reactivity to SARS-CoV-2 peptides and to peptides from other human-infecting coronaviruses. The first set of peptides, referred to herein as the “human virome” (HV) peptides, was designed to broadly cover potential epitope diversity for all viruses known to infect humans. To generate this design, we downloaded all protein sequences available in UniProt, on Nov. 19, 2018, that were linked to 474 viral species-level taxonomy IDs. Following a series of quality filters to remove identical sequences, those that were too short (<30 aa), those that contained recombinant non-viral sequences and those that were taxonomically misclassified, we were left with 1,300,994 target protein sequences. In order to control for sampling bias within the database, we randomly subsampled overrepresented virus species, including no more than 2000 and 4000 sequences for viruses with RNA and DNA genomes, respectively. Additional protein sequences were allowed for DNA viruses because they often contain larger genomes and proteomes (i.e., more distinct genes). When down-sampling, priority was given to proteins from the Swiss-Prot database, which have been manually reviewed. The final down-sampled target set included 148,215 protein sequences and 88.78 M amino acids.
[0083] Our HV peptides were designed using an epitope-centric set cover design algorithm, with a focus on optimizing 9mer (i.e., 9 amino acid long) epitope coverage using 30mer peptides. To reduce the runtime and memory requirements of the algorithm, we partitioned our target protein sequences according to taxonomy. Given the high levels of genetic divergence between viral families and genera, we do not expect that this partitioning substantially impacted our final design. Including a small set of negative control peptides selected from eukaryotic proteins, this design included 244,000 unique 30mer peptides, and represents approximately 70% of all potential 9mer epitopes contained within the target protein sequences. Each of these peptides was represented by a single nucleotide encoding. This design does not contain any peptides derived from SARS-CoV-2, but does contain full proteome coverage of the other six coronaviruses known to infect humans: Human coronavirus 229E (NCBI taxID: 11137), Human coronavirus NL63 (NCBI taxID: 277944), Human coronavirus HKU1 (NCBI taxID: 290028), Betacoronavirus 1 (NCBI taxID: 694003, includes Human coronavirus OC43), Severe acute respiratory syndrome-related coronavirus (NCBI taxID: 694009, “SARS”), and Middle East respiratory syndrome-related coronavirus (NCBI taxID: 1335626, “MERS”).
[0084] Our second design (SCV2) focused almost entirely on SARS-CoV-2, including high density tiling of peptides across the two most immunogenic SARS-CoV-2 proteins: the spike glycoprotein (S) and the nucleocapsid protein (N). As targets for this design, we utilized 2303 SARS-CoV-2 genome sequences downloaded from GISAID on Apr. 3, 2020, along with six locally generated sequences. Using these genomes, we first generated consensus amino acid sequences for the S and N proteins. In our design, we included all of the unique 30mer peptides contained in these consensus sequences, equivalent to a 1-step sliding window approach (Shiryaev et al., 2012). Additionally, we used the same epitope-centric set cover design algorithm used for HV in order to capture amino acid-level polymorphisms present within our full set of target genomes. This aspect of the design ensured that 100% of the unique 16mer peptides present in the S and N proteins from the 2309 SARS-CoV-2 genomes were represented in our design. In total, this design included 1550 30mer peptides from the S protein and 557 30mer peptides from the N protein. Each of these peptides was represented by three different nucleotide encodings. This design also included a set of 373 control peptides. These controls represent a subset of the HV peptides, which we have determined are commonly recognized by IgG antibodies in human sera (unpublished results). Therefore, we expect that some fraction of these controls will be recognized by antibodies in each blood sample tested. Collectively, these peptides were designed from 55 different virus species, including the four endemic human coronaviruses.
PepSeq Library Synthesis and Assay
[0085] Libraries of covalently-coupled peptide:DNA conjugates were prepared from pools of DNA oligonucleotide templates in bulk enzymatic reactions using the method described previously (Kozlov et al., 2012), with minor modifications as noted hereafter. Briefly, pools of ssDNA templates (Agilent) were PCR-amplified and the dsDNA products were used as templates for in vitro transcription (Ampliscribe). The resulting mRNA was ligated to a hairpin oligonucleotide adapter bearing a puromycin molecule tethered by a PEG spacer and, following buffer exchange, the reaction mix was used as a template in an in vitro translation reaction (PURExpress, NEB). Constructs bearing mRNA—comprising of (i) mRNA, (ii) mRNA+adapter, (iii) mRNA+adapter+peptide—were isolated using magnetic beads coated with a DNA oligo complementary to a 30-mer sequence in the mRNA constant region. A reverse transcription reaction, primed by the adapter hairpin, was used to generate cDNA, after which RNase was applied to remove mRNA. Product was buffer-exchanged, quantified by running on a gel against standard DNA oligos of known concentrations, and used without further modifications or purification.
[0086] To perform serological assays, 5 uL of a 1:10 dilution of serum in Superblock T20 (Thermo) was added to 0.1 pmol of PepSeq library for a total volume of 10 uL and was incubated at 20° C. overnight. The binding reaction was applied to pre-washed protein G-bearing beads (Thermo) for 15 minutes, after which beads were washed 10 times with 1×PBST (washing steps were performed on an EpMotion robot, Eppendorf). After the final wash, beads were resuspended in 30 uL of water and heated to 95° C. for 5 minutes to elute bound product. Elutions were amplified and indexed using barcoded DNA oligos. Following PCR cleanup, products were pooled, quantified and sequenced on a NextSeq instrument (Illumina).
PepSeq Data Analysis
[0087] We used PepSIRF v1.3.0 (Fink et al., 2020), along with custom scripts, to analyze the PepSeq HTS data. The data analysis included three primary steps: 1) demultiplexing and assignment of reads to peptides, 2) calculation of enrichment Z-scores individually for each assay and peptide and 3) identification of enriched peptides for each sample based on the consistency of Z-scores across replicates.
[0088] Demultiplexing and assignment of reads to peptides was done using the demux module of PepSIRF (Fink et al., 2020), allowing up to 1 mismatch within each of the index sequences and up to 2 mismatches with the expected DNA tag (90 nt in length). Z-scores were calculated using a method adapted from (Mina et al., 2019). This process involved the generation of peptide bins, each of which contained ≥300 peptides with similar starting abundance in our PepSeq assay. Starting abundance for each peptide was estimated using buffer-only controls. In total, 4-8 independent buffer-only controls were used to generate the bins for this study. The raw read counts from each of these controls were first normalized to reads per million (RPM) using the column sum normalization method in the norm module of PepSIRF. This was to ensure that independent assays were weighted evenly, regardless of differences in the depth of sequencing. Bins were then generated using the bin PepSIRF module.
[0089] Z-scores were calculated using the zscore module of PepSIRF, and each Z-score corresponds to the number of standard deviations away from the mean, with the mean and standard deviation calculated independently for the peptides from each bin. It is important that the mean and standard deviation reflect the distribution of unenriched peptides within a bin. Therefore, these calculations were based on the 75% highest density interval of read counts within each bin. Prior to Z-score calculation, RPM counts for each peptide were further normalized by subtracting the average RPM count observed within our superblock-only controls. This second normalization step controlled for variability in peptide starting abundance within a bin. Finally, the “p_enrich” module of PepSIRF was used to determine which peptides had been enriched through our assay. This module identifies peptides that meet or exceed minimum thresholds, in both replicates, for Z-score and normalized read count. Decision tree analysis was conducted using the DecisionTreeClassifier method in the Scikit-learn Python module, v0.20.1.
Visualization of Protein Structure
[0090] To visualize our identified SARS-CoV-2 epitopes within the 3D conformational structure of the S protein, we utilized the cryo-electron microscopy (Cryo-EM) structure available in the RCSB Protein Data Bank (PDB id: 6VY). To compare epitope positions across CoV species, we built three additional structures using Cryo-EM templates from PDB: 5SZS for hCoV-NL63, 6ACD for SARS-CoV and 6NZK for hCoV-OC43. We performed structural modelling using Swiss-Model software (Waterhouse et al., 2018). Structural alignments and image preparation were done with PyMOL (version 2.3.2, Schrodinger, LLC). For positioning of epitopes in the structures with respect to the SARS-CoV-2 spike protein, we performed corresponding amino acid sequence alignments with Clustal Omega. To build models of the post-fusion state for S2 subunit fragments, we used the Cryo-EM structure for murine SARS-CoV, determined by Walls et al. (PDB id: 6B3O) (Walls et al., 2017).
Results
A Highly-Multiplexed Peptide Assay to Evaluate CoV Antibody Responses
[0091] To generate a broad and high-resolution view of the antibody response to human coronaviruses, including SARS-CoV-2, we designed and synthesized two separate DNA-barcoded 30mer peptide libraries, using the method described previously (Kozlov et al., 2012) (
[0092] Each library began as a pool of DNA oligonucleotide templates, which was modified using bulk enzymatic steps consisting of transcription, ligation of a puromycin-containing adapter oligo, translation, and reverse transcription. One library was focused on SARS-CoV-2 (‘SCV2’) and contained 2,107 peptides representing the Spike and Nucleocapsid—the 2 most immunogenic coronavirus proteins—at high redundancy, with an average of 38 peptides covering each amino acid position (
[0093] The other library (human virome or ‘HV’) comprised 244,000 peptides designed to cover the full proteomes of all viruses known to infect humans, as of the end of 2018. Therefore, HV included peptides from the complete proteomes of 6/7 human coronaviruses: HCoV-229E, HCoV-OC43, HCoV-NL63, HCoV-HKU1, SARS-CoV, and MERS-CoV, but not SARS-CoV-2 (
[0094] In total, we assayed and analyzed 27 COVID-19 convalescent and 21 SARS-CoV-2 negative (both pre- and post-pandemic) serum samples using our SCV2 PepSeq library (TABLE 1).
TABLE-US-00001 TABLE 1 Summary of samples characterized in this study. Median PepSeq Sample Sample Males/Females/ from Median Library Type Size Unreported Age* diagnosis* days SCV2 COVID-19 27 10/12/5 51 28.5 Convalescent Negative 21 11/6/4 37 — Control HV Negative 33 0/0/33 NA Control “NA” = Not available; “—” = Not applicable. *Median values were calculated from a subset of total samples for which this information was available.
[0095] Separately, we assayed 33 SARS-CoV-2 negative (pre-pandemic) serum samples using the HV PepSeq library. For each assay, we incubated our PepSeq probes overnight with serum (or buffer as a negative control), captured the IgG on protein G beads, washed away the non-binding library members, eluted binders, and then performed PCR and high-throughput sequencing on the DNA tags to identify the distribution of bound peptides. Each sample was run in duplicate, and we observed strong signal concordance between technical replicates of the same sera, including those run on different days (
[0096] Comparative analysis of peptide abundance between serum and buffer-only negative controls revealed a strong correlation in abundance for the majority of peptides, while a subset of peptides showed distinctly higher relative abundance in each serum sample (
[0097]
Accurate Detection of SARS-CoV-2 Exposure and Identification of Epitopes
[0098] For the SCV2 PepSeq library, we evaluated the sensitivity/specificity for detection of SARS-CoV-2 exposure by generating receiver operating characteristic (ROC) curves with a sliding Z-score threshold and three different criteria for the number of enriched SARS-CoV-2 peptides needed for a positive result (
[0099]
[0100] Based on the ROC analysis and a qualitative assessment of the ability to discriminate signal from noise (
[0101] To explore the potential for increasing sensitivity and specificity using a subset of SARS-CoV-2 peptides, we utilized a decision tree algorithm to identify the most discriminatory subset of peptides from our library. This analysis identified four SARS-CoV-2 peptides (indicated by green lines in
TABLE-US-00002 TABLE 2 SARS-CoV-2 peptides chosen by decision tree algorithm for discriminating between COVID-19 convalescent and negative control samples Reactive SEQ Start End conv ID Peptide Sequence Protein position position samples NO: SFKEELDKYFKNHTSPDVDLGDISGINAS S 1147 1176 12 1 V SKPSKRSFIEDLLFNKVTLADAGFIKQYG S 810 839 9 2 D NAAIVLQLPQGTTLPKGFYAEGSRGGSQ N 154 183 8 3 AS GDAALALLLLDRLNQLESKMSGKGQQQ N 215 744 3 4 QGQ
[0102] Using only these four peptides in the ROC analysis of all 48 donors increased the AUC to 0.97. With the same Z-score threshold of 11, the specificity increased to 100%, while sensitivity stayed at 81.5% (
[0103] As predicted, multiple positive control peptides were found to be enriched in every serum sample that we tested (
[0104] Unexpectedly, we observed a small, but significant increase in the average number of enriched control peptides between convalescent and control donors, which involved peptides designed from a wide variety of virus species (t-test, p=0.01, 1.2 fold difference). However, this difference was small compared to the difference in the number of enriched SARS-CoV-2 peptides (56-fold, p=2e-5). There was a significant difference in age between our convalescent and negative control donors, with our negative control donors being slightly younger on average than our COVID-19 convalescent donors (
[0105] However, within our sample set, we did not observe a correlation between donor age and the number of enriched control peptides (
[0106] In contrast, we did observe several significant pairwise differences in the number of enriched control peptides when we compared samples obtained from different sources (
[0107] Specifically, we observed significantly fewer enriched control peptides in our pre-pandemic negative controls (1.2-1.5-fold, p=0.001-0.01). Therefore, this difference can likely be attributed to subtle differences in patient characteristics, sample collection, handling and/or storage among our different donor cohorts. We do not expect this difference to impact the conclusions discussed herein.
[0108] In total, we identified IgG reactivity (i.e., peptide enrichment) against 142 and 8 SARS-CoV-2 peptides in convalescent and negative control samples, respectively. All peptides that were enriched in any of the convalescent samples, regardless of the virus from which they were designed, are shown in TABLE 3. TABLE 3 shows the 142 SARS-CoV-2 enriched peptides, including SEQ ID NOS: 1-4 and 275-412, along with the other enriched peptides, including SEQ ID NOS: 5-274 and 413-420.
TABLE-US-00003 TABLE 3 Peptides enriched in convalescent samples. Pro- Pro- COVID-19 portion Negative portion SEQ Conv COVID-19 Control Negative ID Peptide sequence Organism Samples Conv Samples Control NO: SLIKRQGNRVIDAEPREIPLEYADDLLEAM Aichivirus A 17 0.63 6 0.286 5 EACWKCSQDKPRRKYNTVPPEEWLYDSDVQ Aichivirus A 5 0.185 0 0 6 ALPGIRRQGLLTLSADTETNQTLNKITESV Aichivirus A 7 0.259 5 0.238 7 KFFDKLALLSLPGAYQAKTPEERALAGALT Aichivirus A 4 0.148 1 0.048 8 TQSGNAAILTGSTAPSFLAYPTATPVPLPN Aichivirus A 6 0.222 2 0.09:5 9 GSSNKVGSRFSKWWEPAAARALERATDSAI Aichivirus A 4 0.148 0 0 10 MATQGPRVNWGDEPSKRRGRSNSRGRKSSD Alphacoronavirus 1 1 0.037 0 0 11 MSLWRPSEATVYLPPAPVSKVYSTDEYVTR Alphapapillomavirus 9 1 0.037 0 0 12 TTGYRFTNFEPFTVNSVNDSLEPVGGLYEI Betacoronavirus 1 13 0.481 10 0.476 13 APDVMLNISTPKLPDFKEELDQWFKNQTSV Betacoronavirus 1 21 0.778 1 0.048 14 KWADQSDQFRNVQTRGRRAQPKQTVTSQQP Betacoronavirus 1 1 0.037 2 0.095 15 AANTAASAHSLGTGRVPALQAAETGASSNS Enterovirus A 12 0.444 11 0.524 16 VSDYIKGLGDAFGVGFTDAVSREVEALKNH Enterovirus A 18 0.667 15 0.714 17 DSIADMIDQAVNNQVNRSLTAMQVLPTAAN Enterovirus A 10 0.37 8 0.381 18 DMANAAKGFEWISNKISKFIDWIKEKIIPA Enterovirus A 9 0.333 9 0.429 19 PPKFRPVRISLDEKPAPDAISDLLASVDSE Enterovirus A 10 0.37 6 0.286 20 NLEAIDLHTSAGYPYSALGIKKRDILDPTT Enterovirus A 2 0.074 1 0.048 21 DKRLEVDFETALFSKYIGNKIYEPDEYMIQ Enterovirus A 6 0.222 6 0.286 22 TAEYQNDPITNAVENAVSALADTTISRVTA Enterovirus A 2 0.074 3 0.143 23 VSKMKFYMDKYGLDLPYSTYVKDELRSMDK Enterovirus A 3 0.111 7 0.333 24 FTNINYYKDSYAASAAKHDFTQDPGKFTQP Enterovirus A 2 0.074 4 0.19 25 SNKETGRLSINGPTRTKLEPSAFYDVFEGS Enterovirus A 2 0.074 3 0.143 26 QQVPALTAVETGHTSQVAPSDTIQTRHVHN Enterovirus B 21 0.778 15 0.714 27 VEGAIGRVADTIRSGPSNSEAVPALTAAET Enterovirus B 15 0.556 16 0.762 28 KDAGYPVINAPSKTKLEPSVFHQVFEGNKE Enterovirus B 17 0.63 13 0.619 29 NRQDFTQDPSRFTEPVQDVLIKTLPALNSP Enterovirus B 6 0.222 6 0.286 30 ALYQNDPESALNRAVGRVADTVASGPVNTE Enterovirus B 8 0.296 6 0.786 31 ASEVTVSDTQPSGPSNSVSVPMLTAAETGH Enterovirus B 5 0.185 7 0.333 32 DVVEAIESAVARVADTISSGPTNSQAVPAL Enterovirus B 8 0.296 8 0.381 33 SPFVRQTVFYQNDVQNAIDRAMTRVADTMP Enterovirus B 2 0.074 3 0.143 34 NEPSNAIERAMVRVADTMASGPANSEQIPA Enterovirus B 7 0.259 5 0.238 35 SQDNKLQGDVEEAIERAVVHVADTMRSGPS Enterovirus B 5 0.185 3 0.143 36 ITDYIQSLGNAFGAGFTETISSKAKEVQDM Enterovirus D 70 0.741 13 0.619 37 IIKTATDTVKSEINAELGVVPSLNAVETGA Enterovirus D 13 0.481 9 0.429 38 KDKRLKVDFEEAIFSKYVGNKTMLMDEYME Enterovirus D 7 0.259 8 0.381 39 GVIPSLNAAETGATSNTTPEEAIQTRAVIN Enterovirus D 3 0.111 0 0 40 RDIFNRQTRDTTEMTKMLDKYGVDLPFVTF Enterovirus D 1 0.037 5 0.238 41 RGKERAPNALNAIIGNRDSVKAMPHNIVTT Enterovirus D 3 0.111 2 0.095 42 LFQGPPQFREIKISVSPETPAPDAINDLLR Enterovirus D 1 0.037 0 0 43 ANYKGKEKTPNALNALIGNRDNVKTMTHNI Enterovirus D 1 0.037 0 0 44 RRYFTAEQGKIEYIEKSKEAGYPIINAPTQ Enterovirus E 7 0.259 4 0.19 45 KFTEAVNAFKGLDWIAAKFSKFLDWIKSKI Enterovirus E 1 0.037 0 0 46 SVDSEDVREYCRQKGWIVQEKITKESLERN Enterovirus E 3 0.111 3 0.143 47 WMRRRTQKAPKRIRLPHIREDDQPSAHQPL Human alphaherpesvirus 14 0.519 10 0.476 48 1 GDFDEAKLAEAREMIRYMALVSAMEHTEHK Human alphaherpesvirus 16 0.593 10 0.476 49 1 PLDGCGPLHPSWVSLMPPKQVPETVVDAAC Human alphaherpesvirus 13 0.481 9 0.429 50 1 AWGQVHDWTEQTDPWFLDGLGMDRMYWRDT Human alphaherpesvirus 11 0.407 10 0.476 51 1 SGTPAPAPPGDGSYLWIPASHYNQLVAGHA Human alphaherpesvirus 16 0.593 10 0.476 52 1 PSTQTRAPLPTEPAFPPAATGSQPEASNAE Human alphaherpesvirus 13 0.481 8 0.381 53 1 HRPAPGSPPGIPEYAEDPYAISYGGQLDRY Human alphaherpesvirus 12 0.444 9 0.429 54 1 AAPASPYIEAENPLYDWGGSALFSPPGRTG Human alphaherpesvirus 13 0.481 10 0.476 55 1 WHIPSIQDAATPYHPPATPNNMGLIAGAVG Human alphaherpesvirus 12 0.444 8 0.381 56 1 RSMAESDVVMEDVAIAERALGLSAFGVAGG Human alphaherpesvirus 12 0.444 6 0.286 57 1 ASGKGPTYIRVADSELYADWSSDSEGERDQ Human alphaherpesvirus 11 0.407 7 0.333 58 1 FWVRRRAQMAPKRLRLPHIRDDDAPPSHQP Human alphaherpesvirus 7 0.259 3 0.143 59 2 EAYYSESEDEAANDFLVRMGRQQSVLRRRR Human alphaherpesvirus 14 0.519 3 0.143 60 2 DQTLQLHREGVSTQDPRFVGAFMAAKAAHL Human alphaherpesvirus 8 0.296 6 0.286 61 2 PSEAVRPSRIPRAPRVPREPRVPREPREPR Human alphaherpesvirus 9 0.333 6 0.286 62 2 ASGPHETITALVGAVTSLQQELAHMRARTN Human alphaherpesvirus 5 0.185 0 0 63 2 RRRHEVEQPEYDCGRDEPDRDFPYYPGEAR Human alphaherpesvirus 8 0.296 5 0.238 64 2 KKGTSALLSSKVTNMVLRKRNKARYSPLHN Human alphaherpesvirus 5 0.185 2 0.095 65 2 AGVYDAVRTWGPDAEAEPDQMENTYLLPDD Human alphaherpesvirus 5 0.185 1 0.048 66 2 APHAWGMLNDMQWLASSDSEEETEVGISDD Human alphaherpesvirus 5 0.185 1 0.048 67 2 DRDSSMSLADFHGEEFEKLYEHLEAMGEGE Human alphaherpesvirus 4 0.148 4 0.19 68 2 DPIYDEVAPDHEAELYARVQRPGPVPDAEP Human alphaherpesvirus 1 0.037 1 0.048 69 2 LENAHEHHGVYNQGRGIDSGERLMQPTQMS Human alphaherpesvirus 6 0.222 5 0.238 70 3 AVAPTSAATRKPDPAVAPTSAASRKPDPAV Human alphaherpesvirus 8 0;296 4 0.19 71 3 KGLKQLPEGMDPFAEKPNATDTPIEEIGDS Human alphaherpesvirus 10 0.37 2 0.095 72 3 DKFREAQEMIKYMTLVSAAERQESKARKKN Human alphaherpesvirus 12 0.444 3 0.143 73 3 HAESSWVNRGESSRKAYDHNSPYPNPRNDY Human alphaherpesvirus 5 0.185 4 0.19 74 3 VVTTETKSVVKEGIENHVYPTDMSTLPEKS Human alphaherpesvirus 4 0.148 2 0.095 75 3 HQPNDSSGSEDDFEDIDEVVAAFREARLRH Human alphaherpesvirus 3 0.111 0 0 76 3 EPMYAQVRKPKSRTDTQTTGRITNRSRARS Human alphaherpesvirus 1 0.037 0 0 77 3 IPADEEAPTTPEDPRHPLHAHQLVPNSLNV Human alphaherpesvirus 6 0.222 2 0.095 78 3 APTPTFAGTQTPVNGNSPWAPTAPLPGDMN Human betaherpesvirus 5 14 0.519 8 0.381 79 PANWPRERAWALKNPHLAYNPFRMPTTSTA Human betaherpesvirus 5 14 0.519 5 0.238 80 STPRAAVTQTASQNAADEVWALRDQTAESP Human betaherpesvirus 5 4 0.148 6 0.286 81 VKYQALATASGEEVAALSHHDSLESRRLRE Human betaherpesvirus 5 5 0.185 7 0.095 82 ASEALDPHAFHLLLNTYGRPIRLLRENTTQ Human betaherpesvirus 5 5 0.185 4 0.19 83 PSLKPTLGGKAVVGRPPSVPVSGSAPGRLS Human betaherpesvirus 5 10 0.37 3 0.143 84 QQNGTDSLDGRTGTQDKGQKPNLLDRLRIR Human betaherpesvirus 5 7 0.259 7 0.095 85 EQPTETPPEDLDTLSLAIEAAIQDLRNKSQ Human betaherpesvirus 5 10 0.37 4 0.19 86 ASTTPTYPAVTTVYPPSSTAKSSVSNAPPV Human betaherpesvirus 5 6 0.222 1 0.048 87 ALYMGSRRIPRKPRYTRLPKHDPDEFWTKT Human betaherpesvirus 5 8 0.296 2 0.095 88 GRGSPLTIESHLSDNEEDPIRYVVSVYDEL Human betaherpesvirus 5 6 0.222 2 0.095 89 SDPLEAFKTVNRHNWSDEQREHFYDLRNLY Human betaherpesvirus 6 17 0.63 12 0.571 90 RKQKKLDLLGSWTKEKNDKAIVHSREVTGD Human betaherpesvirus 6 13 0.481 12 0.571 91 NTAANADVFDPVHRLVSEQTGTPFVLNNSD Human betaherresvirus 6 4 0.148 6 0.286 92 PESDSVDNAGGKILIKKETLGGRDVRATTP Human betaherpesvirus 6 9 0.333 6 0.786 93 KLPGNGEREIDLALQKVKAGERETSDFKVG Human betaherpesvirus 6 8 0.296 2 0.095 94 GDEYSQEDALKMLKAIKSLDESYRRKPSSS Human betaherpesvirus 6 9 0.333 4 0.19 95 EISDNIYSSPKNSIYLKSKSQQSTTKFTDT Human betaherpesvirus 6 8 0.296 1 0.048 96 TTHSTETGVSPHNVSLIKDLRDKDGFRKQK Human betaherpesvirus 6 3 0.111 3 0.143 97 VQSPFRLPNADLSRDLDSASFKDALDLKLP Human betaherpesvirus 6 3 0.111 3 0.143 98 KEKRKVEDIDKKKEDEKRKQEEKKRNDEDK Human betaherpesvirus 6 4 0.148 7 0.095 99 LKNLLNSRKRDPLFQNFSFTEKMQPVRSPF Human betaherpesvirus 7 7 0.259 1 0.048 100 QLVKDVKWTPSSSLLDLSRRNDLLQKELFE Human betaherpesvirus 7 5 0.185 0 0 101 NKIDYHSTFFLPENEVNRQNGVQSRDQLSK Human betaherpesvirus 7 6 0.222 4 0.19 107 DLIDLENSVQKDDDIVNKLVSHLTHSEEDV Human betaherpesvirus 7 5 0.185 1 0.048 103 QDFDSGSLLTGKETQNTIFGASKAQENGDK Human betaherpesvirus 7 4 0.148 0 0 104 ATPIERSSRSASIISGESVPGFFNDQERLS Human betaherpesvirus 7 3 0.111 1 0.048 105 RRKRELETNKDIVYVQLQYLYDTLKDYINT Human betaherpesvirus 7 1 0.037 0 0 106 PVLNISRPGSTTPSGNSARYGNNTPRSITP Human betaherpesvirus 7 3 0.111 0 0 107 NSVLQATQSVQAQVKEPLDSSPPYLKTNKD Human betaherpesvirus 7 1 0.037 2 0.095 108 KRRKEIVHENLQSFDDEHNEMSLPPQDQKS Human betaherpesvirus 7 1 0.037 0 0 109 YTVPDLVVEQYNQTILNLTSEISTRENKSA Human coronavirus 229E 2 0.074 0 0 110 SDRNHNSQDDIMKAVAAALKSLGFDKPQEK Human coronavirus 229E 4 0.148 3 0.143 111 EFNPSQTSPATVEPVRDEVSIETDIIDEVN Human coronavirus 229E 7 0.259 4 0.19 112 GAMLSENFTSYGFSNVVEMPKFFYASNGTY Human coronavirus 229E 5 0.185 5 0.238 113 SNQDDIMAAVAAALEKLGFERPNDASQPQK Human coronavirus 229E 1 0.037 0 0 114 DYALPSSRRKRRGISSPYRFVTFEPENVSF Human coronavirus HKU1 10 0.37 2 0.095 115 KPDMADEIASLVLAKLGKDSKPQQVTKQNA Human coronavirus HKU1 5 0.185 3 0.143 116 FGLQDGFYSANFLDDNVLPETYVALPTYYQ Human coronavirus NL63 7 0.259 6 0.286 117 NTVLNASIPESKPLADDDSAIIEIVNEVLH Human coronavirus NL63 2 0.074 3 0.143 118 ERWRMRRGQRVDLPPKVHFYYLGTGPHKDL Human coronavirus NL63 1 0.037 0 0 119 VSNGGNNCTTAVMTYSNFGICADGSLIPVR Human coronavirus NL63 1 0.037 1 0.048 120 PGRRPFFHPVGQADYFEYHQEGGPDGEPDM Human 71 0.778 18 0.857 121 gammaherpesvirus 4 SPSLPSSKKGADEFEAWLEAQDANFEDVQR Human 20 0.741 17 0.81 122 gammaherpesvirus 4 MMDPNSTSEDVKFTPDPYQVPFVQAFDQAT Human 24 0.889 12 0.571 123 gammaherpesvirus 4 QHASGEGPGINPISKTELQAIMLALHEQNQ Human 16 0.593 Q 0.429 124 gammaherpesvirus 4 EQEYGDKEVKLPHWTPTLHTFQVPKNYTKA Human 18 0.667 5 0.238 125 gammaherpesvirus 4 GPRHRDGVRRPQKRPSCIGCKGAHGGTGTG Human 11 0.407 13 0.619 126 gammaherpesvirus 4 QPMEGPLVPEQWMFPGAALSQRVRPGVAQS Human 16 0.593 11 0.524 127 gammaherpesvirus 4 MHPLTHQSIPNDPDSPEPRSPTVFYNIPPM Human 21 0.778 9 0.429 128 gammaherpesvirus 4 LPPRVRGGGRVSAAAITWVPKPNVEVWPVD Human 15 0.556 10 0.476 129 gammaherpesvirus 4 RKPGGPWRPEPNTSSPSMPELSPVLGLHQG Human 13 0.481 6 0.286 130 gammaherpesvirus 4 SPIHEPESHNSPEAPILFPDDWYPPSIDPA Human 20 0.741 12 0.571 131 gammaherpesvirus 4 LAAPRRGNVYWVRDAVTGTRVPVRTRPPHP Human mastadenovirus A 17 0.63 12 0.571 132 IESINDKMSRWKTYAQERHEWEERQPKPVP Human mastadenovirus A 18 0.667 10 0.476 133 EENDDFNPVYPFDPYDTAHVPFVTPPFTSS Human mastadenovirus A 5 0.185 2 0.095 134 MSKDIPTPYMWSFQPQMGLAAGAAQDYSSK Human mastadenovirus A 11 0.407 3 0.143 135 PPGFYTGEFDLPEGNDGFLWDDVTDSLFSP Human mastadenovirus A 1 0.037 0 0 136 VLEYMKVDPNIQPDVKIRPIKKVAPGLGVQ Human mastadenovirus A 7 0.259 1 0.048 137 EAPPPSYETVMAAAQTSALEAPYVPPRYLA Human mastadenovirus A 1 0.037 0 0 138 GHYRAPWGAHTRGRTGRTTVDDVIDSVVAD Human mastadenovirus A 1 0.037 0 0 139 LKDQNFQQKVVDGLASGINGVVDIANQAVQ Human mastadenovirus A 1 0.037 3 0.143 140 NNPQVVFYTEDVNLEMPDTHLVFKPTVTDG Human mastadenovirus A 1 0.037 0 0 141 RASRRRQRHDRQRGLVWEDEDSADDSSVLD Human mastadenovirus B 13 0.481 6 0.286 142 WPAALVYQESPAPTTVLLPRDAQAEVQMTN Human mastadenovirus B 7 0.259 4 0.19 143 TLVTRADEPPSYEEAVKLGMPTTRPVAHMA Human mastadenovirus B 14 0.519 9 0.429 144 SFNPVYPYEDESTSQHPFINPGFISPNGFT Human mastadenovirus B 6 0.222 7 0.333 145 TVDDTDGTLQENIGTTTPLVKTGESIGLSL Human mastadenovirus B 4 0.148 1 0.048 146 PPLQPFDPPTLHDLYDLEVDGPDDPNEEAV Human mastadenovirus B 3 0.111 1 0.048 147 EEIEADVEQDPGYVTPAEHEEELKRFLDRE Human mastadenovirus B 1 0.037 0 0 148 DMNDHAIRGDTFATRAEEKRAEAEAAAEAA Human mastadenovirus C 25 0.926 19 0.905 149 AATQKQRRPDSKTLTKPKKSTAAAAAGGGA Human mastadenovirus C 9 0.333 6 0.286 150 TTDYRNTTATGLTSALNLPQVHAFVNDWAS Human mastadenovirus C 10 0.37 7 0.333 151 PSAPAVSTVDEAIESVVQGARHYANLKNRR Human mastadenovirus C 11 0.407 2 0.095 152 ARNYTPTPPPVSTVDAAIQTVVRGARRYAK Human mastadenovirus C 10 0.37 4 0.19 153 EVLDEEEEMMEDWDSLDEEASEAEEVSDET Human mastadenovirus C 6 0.222 5 0.238 154 ARRTGRRAAMRAARRLAAGIVTVPPRSRRR Human mastadenovirus C 5 0.185 1 0.048 155 IAPMATGVLGHHTPVTLDLPPPADTQQKPV Human mastadenovirus C 5 0.185 2 0.095 156 SYESVVSAASVAAALGSPFDAPLDPPFVPP Human mastadenovirus C 11 0.407 8 0.381 157 TTRPRLLGEEEYLNNSLLQPQREKNLPPAF Human mastadenovirus C 6 0.222 2 0.095 158 PEDARPVVSDEMLARWLGTRDPQALEQRRK Human mastadenovirus D 2 0.074 1 0.048 159 MTKRLRVEDDFNPIYPYGYARNQNIPFLTP Human mastadenovirus D 1 0.037 1 0.048 160 ESYKNEIKKLTYKNNKTTFEDSGNYEHQKL Human mastadenovirus D 1 0.037 1 0.048 161 EKINQSLTFIRKSDELLHNVNVGKSTTNIM Human 10 0.37 6 0.286 162 orthopneumovirus FEAFNFVPCSICSGNPTCWAICKRIPNKKP Human 17 0.63 10 0.476 163 orthopneumovirus NYQRKPLVSFKEDPTPSDNPFSKEYKETIE Human 2 0.074 2 0.095 164 orthopneumovirus NKLGEKEKEKDKIKSNNEQDENNSVITTII Human 6 0.222 3 0.143 165 orthopneumovirus STYMLTNSELLSLINDMPITNDQKKLMSSN Human 14 0.519 6 0.286 166 orthopneumovirus TNKPSTKPHPKIPPKKPKDDYHFEVFNFVP Human 10 0.37 2 0.095 167 orthopneumovirus CSICGNNQLCKSICKTIPGNKPKKKPTIKP Human 8 0.296 1 0.048 168 orthopneumovirus QAITCQKPTPEKEKPDVYKNLSFWEVNLKE Human papillomavirus 1 0.037 1 0.048 169 PPAEKKDPYADLTFWEVDLKERFSLELDQF Human papillomavirus 1 0.037 1 0.048 170 AGKEGDSIPMEGTDYYIARQDSKLASHIYY Human papillomavirus 1 0.037 1 0.048 171 AHQPDFGTWNSSEVPTYGTEEWESWWSSFN Human polvomavirus 1 6 0.222 3 0.143 172 RVFDGTERLPGDPDMIRYIDKQGQLQTKML Human polyomavirus 1 2 0.074 1 0.048 173 LSDEIQRLLRDLEYGFRATLASIGESDPVN Human polyomavirus 3 6 0.222 5 0.238 174 NIWQSSQIPTYGTPDWDEWWSQFNTYWEEE Human polvomavirus 3 3 0.111 0 0 175 LQSVHKPIHAPYSGMALVPIPEYQLETGIP Human polyomavirus 3 1 0.037 0 0 176 DEDITDIENKIARRLADRKQRLSQANNKRD Human respirovirus 1 13 0.481 4 0.19 177 NETTDYSSEGIEDLVFDILDLKGKTKSHRY Human respirovirus 1 1 0.037 0 0 178 GAIEVAIDHTDITFGAEDTADRDNKNWAND Human respirovirus 1 1 0.037 0 0 179 KKQGSQPPTNPTNRTNQDEIDDLFNAFGSN Human respirovirus 3 19 0.704 12 0.571 180 EQATESDNIKTEQQNIRDRLNKRLNDKKKQ Human respirovirus 3 7 0.259 2 0.095 181 IVLINSIKSERAHESLLQDINNEFMEVTEK Human respirovirus 3 14 0.519 10 0.476 187 ENRADQEQGGEPQSSIIQYAWAEGNRNDDR Human respirovirus 3 5 0.185 1 0.048 183 SIKSEKAHESLLRDINNEFIGITEKIQMAS Human respirovirus 3 11 0.407 12 0.571 184 STHQEDDKRIKKGGKGKDWFKKSKDTDNQT Human respirovirus 3 1 0.037 0 0 185 MESDAKNYQVMDSWEEESRDKSTNISSALN Human respirovirus 3 2 0.074 1 0.048 186 SLESIGTPDTRSISVVTAATPDDEEEILMK Human respirovirus 3 2 0.074 0 0 187 PQRTSGMSSEEFQHSMNQYIRAMHEQYRGS Human rubulavirus 2 14 0.519 s 0.738 188 MAEEPTYTTEQVDELIHAGLGTVDFFLSRP Human rubulavirus 2 5 0.185 1 0.048 189 QLPRGRQPISDPFAGANDREIGGQANDTPV Human rubulavirus 2 2 0.074 1 0.048 190 PSSSAGLKDDLLENLQAYQKRMGVQMQRFK Influenza A virus 8 0.296 1 0.048 191 LATGMRNVPEKQTRGIFGAIAGFIENGWEG Influenza A virus 2 0.074 3 0.143 192 SEQAAEAMEIASQARQMVQAMRTVGTHPSS Influenza A virus 3 0.111 1 0.048 193 NPLIRHENRMVLASTTAKAMEQMAGSSEQA Influenza A virus 3 0.111 4 0.19 194 RTLDYHDSNVKNLYEKVRSQLKNNAKEIGN Influenza A virus 1 0.037 0 0 195 IWDPNGWTGTDNNFSIKQDIVGINEWSGYS Influenza A virus 2 0.074 0 0 196 ATCEQIADAQHRSHRQMATTTNPLIKHENR Influenza A virus 2 0.074 0 0 197 VETYVLSIIPSGPLKAEIAQKLEDVFAGKN Influenza A virus 3 0.111 3 0.143 198 NPHRILDGIDCTLIDALLGDPHCDGFQNET Influenza A virus 1 0.037 0 0 199 FAVERPIALSKQAVRKMLSMNIEGRDADVK Influenza B virus 70 0.741 11 0.524 200 TTRPIIRPATLAPPSNKRTRNPSPERATTS Influenza B virus 17 0.63 11 0.524 201 GTFNAGEFSLPTFDSLNITAASLNNDGLDN Influenza B virus 9 0.333 3 0.143 202 RTRGKLCPECLNCTDLDVALGRPMCVGTTP Influenza B virus 7 0.259 5 0.738 203 TNPIEIPIKQTIPNFFFGRDTAEDYDDLDY Influenza B virus 6 0.222 2 0.095 204 SLSELEVKNLQRLSGAMDELHSEILELDEK Influenza B virus 1 0.037 0 0 205 SNSPHVVKIATQGEVNVTGVIPLTTTPTKS Influenza B virus 5 0.185 1 0.048 206 MSNMDIDGINTGTIDKAPEEITSGTSGTTR Influenza B virus 3 0.111 2 0.095 207 NTAKTMNGMGKGEDVQKLAEELQSNIGVLR Influenza B virus 1 0.037 2 0.095 208 GEADDHHGDQEMRELLSGLDYEARCISQSG Influenza C virus 2 0.074 2 0.095 209 YLLPPKFGRCPLAAKEESIPKIPDGLLIPT Influenza C virus 2 0.074 1 0.048 210 PTYGTDEWEQWWNAFNEENLFCSEEMPSSD Macaca mulatta 3 0.111 1 0.048 211 polyomavirus 1 VGVLDWLRNSDDDDDDEDGGEKNMEDSGHE Macaca mulatta 1 0.037 0 0 212 polyomavirus 1 RELVINTLVNQGISRDRATYIGMSAYPNVE Mamastrovirus 1 3 0.111 1 0.048 213 DIIDTSDEEYENETDRVTLLSTLVNQGMTM Mamastrovirus 1 7 0.259 5 0.238 214 FDEDPIATLHAVDAERKIRRAIFNALMEEG Mamasfrovirus 1 3 0.111 1 0.048 215 DQREKYRHVHEWYVDNLLNRHVLLPSGEVT Mamastrovirus 1 3 0.111 4 0.19 216 TSIPRSRASGHGYESDNTEYLDAPDSADQF Mamastrovirus 1 1 0.037 0 0 217 EEYGPTPWGPQAFIKSFDKFFYAEPIDFFS Mamasfrovirus 1 1 0.037 0 0 218 DRATLLSTLLNQGISVEPATRITNGAFPAR Mamastrovirus 1 4 0.148 3 0.143 219 DDEADRFDLHSSYGSEPEDDDENNRVTLLS Mamastrovirus 1 1 0.037 0 0 220 VTSDDTDYDTDTEDEDEFFGEDPIAALHAV Mamasfrovirus 6 15 0.556 7 0.333 221 SADGANEPVEMLIPVNEWNMKAQYGGNGTL Mamastrovirus 6 2 0.074 1 0.048 772 KGLSDEEYEEYKRVREERNGKYSIEEYLQD Norwalk virus 16 0.593 17 0.81 223 DDFKLKGKLWADDDRSVDYNERLNFEAPPS Norwalk virus 4 0.148 3 0.143 224 ISGLPDLTTVPQPDATNTAFSVPPLSLREN Norwalk virus 10 0.37 5 0.238 225 APDIEKAKRDFPGQPDMWKDHFRPDFSHIK Norwalk virus 8 0.296 2 0.095 226 TTGFFRPYQDWNKKPLPTVDDSKLKKVANI Norwalk virus 3 0.111 0 0 227 NNYDPTEEIPAPLGTPDFVGKIQGVLTQFT Norwalk virus 1 0.037 1 0.048 228 AYSVPPLSQREVGEAKEPLPGSILEMWDGE Norwalk virus 1 0.037 0 0 229 DEEYDEYKKIREERGGKYSIQEYLEDRERF Norwalk virus 4 0.148 3 0.143 230 MMMASKDAPTNMDGTSGAGQLVPEANTAEP Norwalk virus 1 0.037 3 0.143 231 VVSYSVKDGVSGLPDLSTVRQPEESNTAFS Norwalk virus 1 0.037 0 0 232 QDIHLIDDLGQTRKEKDIEMLCNCISSVPF Parechovirus A 2 0.074 0 0 233 TTNLTQHPSAPTIPFTPDFRNVDNFHSMAY Parechovirus A 1 0.037 0 0 234 SAPTMPFTPDFSNVDTFHSMAYDVTTGEKN Parechovirus A 2 0.074 2 0.095 235 QIHKSPVYGAVEVKMGPAVLSKSDPRLEEP Parechovirus A 1 0.037 2 0.095 236 VPITQNPVENYIDEVLNEVLVVPNIKESHP Rhinovirus A 27 1 21 1 237 EQYIDGVLNEVLIVPNINESHPSTSNAAPA Rhinovirus A 25 0.926 20 0.952 238 SAIFQGPISLGAPPPPAIADLLQSVRTPEV Rhinovirus A 76 0.963 20 0.952 239 IFQGPIDMRNPPPPAITDLLQAVRTPEVIK Rhinovirus A 16 0.593 14 0.667 240 ADEQGITDYIHTLGEAFGAGFVDNIKDQIQ Rhinovirus A 25 0.926 20 0.952 241 VMEQNPVEKYTEAVLNEVLAVPNITPSNSQ Rhinovirus A 25 0.926 21 1 247 NPSGEDMTLFCQMVSSVPFIPPMADLPDKG Rhinovirus A 26 0.963 21 1 243 KLQPSVFYDVFPGSKEPAVLTSNDPRLEVD Rhinovirus A 12 0.444 17 0.81 244 DFIADEQGLGDYITSLGRAFGTGFTDQISA Rhinovirus A 74 0.889 18 0.857 745 PPPPAIMDLLKSVKNPEVIKYCEDNKWIIP Rhinovirus A 25 0.926 19 0.905 246 TISQTDALTEGLGDELEEVIVEKTKQTLAS Rhinovirus A 24 0.889 19 0.905 247 ECINDLLRSVDSEEVREYCKRKNWIIPQIP Rhinovirus B 70 0.741 12 0.571 248 QSLHQETALTEGLEDELMEVIVDKTQQTLA Rhinovirus B 18 0.667 12 0.571 249 VVPEHQLASHTQGNVSVKYKYTHPGEQGID Rhinovirus B 16 0.593 13 0.619 250 QLASHDGGTVSVKYKFTHPGDQGIDLSTAE Rhinovirus B 18 0.667 13 0.619 251 ISDLLKSVDSEEIREYCKQKNWLIPEIPTN Rhinovirus B 20 0.741 12 0.571 252 HTQSVPALTANETGATLPTRPSDNVETRTT Rhinovirus B 19 0.704 5 0.238 253 AATKMDFSQDPSKFTEPVKDVMIKTAPALN Rhinovirus B 17 0.63 11 0.524 254 EDELEEVVIDKMKQVTASSQSGPKHTQKVP Rhinovirus B 13 0.481 5 0.238 255 ELNMNPINTPTKSKLHPSVFYNVFPGDKEP Rhinovirus B 14 0.519 15 0.714 256 LMKDTQTISQTEALTEGFEEELEEVVVDKM Rhinovirus B 12 0.444 9 0.429 257 DVLEEVIVDKAKQTIASINSNSKYTQQVPT Rhinovirus B 10 0.37 2 0.095 258 VEHNLTAIFQGLGDDTTPGFIIDLLSASKD Rhinovirus C 19 0.704 19 0.905 259 NPVEDFIDTTLKEVLVVPDTHPSGPVHTTR Rhinovirus C 22 0.815 18 0.857 260 AHQGLVSDYVNQLGAAFGDGFSSNIKDHLT Rhinovirus C 15 0.556 12 0.571 261 AYIGGTNANVGYNHTHPGEIGHEIGRNTGR Rhinovirus C 12 0.444 12 0.571 262 TNDLQNNDPIDTYVHDVLNEVVVVPDTKPS Rhinovirus C 18 0.667 16 0.762 263 DTPMITQDKNTLQNPVEQFVDDVLEEVLVV Rhinovirus C 21 0.778 14 0.667 264 IPEHQLAYAGGANASVGYKHTHPGENGHKI Rhinovirus C 14 0.519 9 0.429 265 SSLSEHQGVTDYITQLGSAFGDGFTSSIKQ Rhinovirus C 20 0.741 13 0.619 266 LRPYNNLAQTQGPISDYVTQLGNAFGNGFT Rhinovirus C 17 0.63 12 0.571 267 DPVSDFIDATLQEVLVVPETKPSGPQHTTK Rhinovirus C 22 0.815 13 0.619 268 PINTPSTTKLYPSVFYEIFPGEKEPAVLSD Rhinovirus C 6 0.222 13 0.619 269 IDMSKEFNQKNIKTLDEWESGKNPYEPSEV Rotavirus A 6 0)22 2 0.095 270 NERLQEKEIEKNADAIMENKNGNKKQQLSD Rotavirus A 4 0.148 5 0.238 271 KEIENNTDVTMENKNKNKNKNNNRKQQLSD Rotavirus A 1 0.037 0 0 272 KRRNVQQKDVEKEKQIEKMEEKEIKEVKEQ Rotavirus C 3 0.111 0 0 273 IKTVPLENELKQKEKQRDNKEKNEKENKDE Rotavirus H 3 0.111 1 0.048 274 FNGLTGTGVLTESNKKFLPFQQFGRDIADT SARS-CoV-2 1 0.037 0 0 275 GVLTESNKKFLPFQQFGRDIADTTDAVRDP SARS-CoV-2 1 0.037 0 0 276 KKFLPFQQFGRDIADTTDAVRDPQTLEILD SARS-CoV-2 1 0.037 0 0 277 KFLPFQQFGRDIADTTDAVRDPQTLEILDI SARS-CoV-2 2 0.074 0 0 278 FLPFQQFGRDIADTTDAVRDPQTLEILDIT SARS-CoV-2 2 0.074 0 0 279 LPFQQFGRDIADTTDAVRDPQTLEILDITP SARS-CoV-2 3 0.111 0 0 280 QILPDPSKPSKRSFIEDLLFNKVTLADAGF SARS-CoV-2 8 0.296 0 0 281 DPSKPSKRSFIEDLLFNKVTLADAGFIKQY SARS-CoV-2 5 0.185 0 0 282 PSKPSKRSFIEDLLFNKVTLADAGFIKQYG SARS-CoV-2 6 0.222 0 0 283 SKPSKRSFIEDLLFNKVTLADAGFIKQVCD SARS-CoV-2 9 0.333 0 0 2 SSVLNDILSRLDKVEAEVQIDRLITGRLQS SARS-CoV-2 2 0.074 0 0 284 NTVYDPLQPELDSTKEELDKYFKNHTSPDV SARS-CoV-2 12 0.444 0 0 285 TVYDPLQPELDSFKEELDKATKNHTSPDVD SARS-CoV-2 10 0.37 0 0 286 YDPLQPELDSFKEELDKYFKNHTSPDVDLG SARS-CoV-2 6 0.222 0 0 287 DPLQPELDSFKEELDKYFKNHTSPDVDLGD SARS-CoV-2 7 0.259 0 0 288 LQPELDSFKEELDKYFKNHTSPDVDLGDIS SARS-CoV-2 8 0.296 0 0 289 QPELDSFKEELDKYFKNHTSPDVDLGDISG SARS-CoV-2 11 0.407 0 0 290 PELDSFKEELDKYFKNHTSPDVDLGDISGI SARS-CoV-2 9 0.333 0 0 291 ELDSFKEELDKYFKNHTSPDVDLGDISGIN SARS-CoV-2 8 0.296 0 0 292 LDSFKEELDKYFKNHTSPDVDLGDISGINA SARS-CoV-2 8 0.296 0 0 293 DSFKEELDKYFKNHTSPDVDLGDISGINAS SARS-CoV-2 11 0.407 0 0 294 SFKEELDKYFKNHTSPDVDLGDISGINASV SARS-CoV-2 12 0.444 0 0 1 NTPKDHIGTRNPANNAAIVLQLPQGTTLPK SARS-CoV-2 8 0.296 0 0 295 TPKDHIGTRNPANNAAIVLQLPQGTTLPKG SARS-CoV-2 8 0.296 0 0 296 PKDHIGTRNPANNAAIVLQLPQGTTLPKGF SARS-CoV-2 6 0.222 0 0 297 KDHIGTRNPANNAAIVLQLPQGTTLPKGFY SARS-CoV-2 7 0.259 0 0 298 DHIGTRNPANNAAIVLQLPQGTTLPKGEYA SARS-CoV-2 7 0.259 0 0 299 HIGTRNPANNAAIVLQLPQGTTLPKGFYAE SARS-CoV-2 7 0.259 0 0 300 IGTRNPANNAAIVLQLPQGTTLPKGFYAEG SARS-CoV-2 8 0.296 0 0 301 GTRNPANNAAIVLQLPQGTTLPKGFYAEGS SARS-CoV-2 7 0.259 0 0 302 TRNPANNAAIVLQLPQGTTLPKGFYAEGSR SARS-CoV-2 7 0.259 0 0 303 RNPANNAAIVLQLPQGTTLPKGFYAEGSRG SARS-CoV-2 8 0.296 0 0 304 NPANNAAIVLQLPQGTTLPKGFYAEGSRGG SARS-CoV-2 8 0.296 0 0 305 PANNAAIVLQLPQGTTLPKGFYAEGSRGGS SARS-CoV-2 8 0.296 0 0 306 ANNAAIVLQLPQGTTLPKGFYAEGSRGGSQ SARS-CoV-2 8 0.296 0 0 307 NNAAIVLQLPQGTTLPKGFYAEGSRGGSQA SARS-CoV-2 8 0.296 0 0 308 NAAIVLQLPQGTTLPKGFYAEGSRGGSQAS SARS-CoV-2 8 0.296 0 0 3 AAIVLQLPQGTTLPKGFYAEGSRGGSQASS SARS-CoV-2 7 0.259 0 0 309 AIVLQLPQGTTLPKGFYAEGSRGGSQASSR SARS-CoV-2 8 0.296 0 0 310 IVLQLPQGTTLPKGFYAEGSRGGSQASSRS SARS-CoV-2 7 0.259 0 0 311 VLQLPQGTTLPKGFYAEGSRGGSQASSRSS SARS-CoV-2 8 0.296 0 0 312 LQLPQGTTLPKGFYAEGSRGGSQASSRSSS SARS-CoV-2 8 0.296 0 0 313 QLPQGTTLPKGFYAEGSRGGSQASSRSSSR SARS-CoV-2 8 0.296 0 0 314 LPQGTFLPKGFYAEGSRGGSQASSRSSSRS SARS-CoV-2 8 0.296 0 0 315 PQGTTLPKGFYAEGSRGGSQASSRSSSRSR SARS-CoV-2 6 0.222 0 0 316 QGTTLPKGFYAEGSRGGSQASSRSSSRSRN SARS-CoV-2 5 0.185 0 0 317 AGNGGDAALALLLLDRLNQLESKMSGKGQQ SARS-CoV-2 3 0.111 0 0 318 IGTRNPANNASIVLQLPQGTTLPKGFYAEG SARS-CoV-2 7 0.259 0 0 319 GTRNPSNNAAIVLQLPQGTTLPKGFYAEGS SARS-CoV-2 7 0.259 0 0 PO QLPQGTTLPKGFYAEGSRGGSQASSRSSLR SARS-CoV-2 8 0.296 0 0 321 AIVLQLPQMPTLPKGFYAEGSRGGSQAYSR SARS-CoV-2 8 0.296 0 0 322 IGTRNPANNAAIVLQLPQGTTLPKGFYAKG SARS-CoV-2 8 0.296 0 0 323 GIVNNTVYDPLQPELESFKEELDKYFKNHT SARS-CoV-2 7 0.259 0 0 324 VNNTVYDPLQPELESFKEELDKYFKNHTSP SARS-CoV-2 7 0.259 0 0 325 YDPLQPELDSFKEELDKYFKNHTSLDVDLG SARS-CoV-2 6 0.222 0 0 326 GDAALALLLLDRLNQLESKMSGKGQQQQGQ SARS-CoV-2 3 0.111 0 0 4 TGVLTESNKKFLPFQQFGRDIADITDAVRD SARS-CoV-2 1 0.037 0 0 327 DFGGFNFSQILPDPSKPSKRSFIEDLLFNK SARS-CoV-2 3 0.111 0 0 328 GGFNFSQILPDPSKPSKRSFIEDLLFNKVT SARS-CoV-2 3 0.111 0 0 329 NFSQILPDPSKPSKRSFIEDLLFNKVTLAD SARS-CoV-2 5 0.185 0 0 330 SQILPDPSKPSKRSFIEDLLFNKVTLADAG SARS-CoV-2 5 0.185 0 0 331 ILPDPSKPSKRSFIEDLLFNKVTLADAGFI SARS-CoV-2 4 0.148 0 0 332 LPDPSKPSKRSFIEDLLFNKVTLADAGFIK SARS-CoV-2 6 0.222 0 0 333 PDPSKPSKRSFIEDLLFNKVTLADAGFIKQ SARS-CoV-2 4 0.148 0 0 334 KPSKRSFIEDLLFNKVTLADAGFIKQYGDC SARS-CoV-2 4 0.148 0 0 335 PSKRSFIEDLLFNKVTLADAGFIKQYGDCL SARS-CoV-2 3 0.111 0 0 336 SKRSFIEDLLFNKVTLADAGFIKQYGDCLG SARS-CoV-2 4 0.148 0 0 337 KRSFIEDLLFNKVTLADAGFIKQYGDCLGD SARS-COV-2 3 0.111 0 0 338 FIEDLLFNKVTLADAGFIKQYGDCLGDIAA SARS-CoV-2 3 0.111 0 0 339 IEDLLFNKVTLADAGFIKQYGDCLGDIAAR SARS-CoV-2 4 0.148 0 0 340 EDLLFNKVTLADAGFIKQYGDCLGDIAARD SARS-CoV-2 1 0.037 0 0 341 YFKNHTSPDVDLGDIPGINASVVNIQKEID SARS-CoV-2 1 0.037 0 0 342 LPDPSKPSKRSFIEDILFNKVTLADAGFIK SARS-CoV-2 7 0.259 0 0 343 FSQILPDSSKPSKRSFIEDLLFNKVTLADA SARS-CoV-2 4 0.148 0 0 344 FKNLREFVFKNIDGYFNIYSKHTPINLVRD SARS-CoV-2 1 0.037 0 0 345 KDFGGFNFSQILPDPSKPSKRSFIEDLLFN SARS-CoV-2 1 0.037 0 0 346 GFNFSQILPDPSKPSKRSFIEDLLFNKVTL SARS-CoV-2 2 0.074 0 0 347 DVVIGTVNNTVYDPLQPELDSFKEELDKYF SARS-CoV-2 4 0.148 0 0 348 VVIGIVNNTVYDPLQPELDSFKEELDKYFK SARS-CoV-2 2 0.074 0 0 349 VIGPINNTVYDPLQPELDSFKEELDKYFKN SARS-CoV-2 0.111 0 0 350 IGIVNNTVYDPLQPELDSFKEELDKYFKNH SARS-CoV-2 4 0.148 0 0 351 GIVNNTVYDPLQPELDSFKEELDKYFKNHT SARS-CoV-2 5 0.185 0 0 352 IVNNTVYDPLQPELDSFKEELDKYFKNHTS SARS-CoV-2 5 0.185 0 0 353 VNNTVYDPLQPELDSFKEELDKYFKNHTSP SARS-CoV-2 6 0.222 0 0 354 NNTVYDPLQPELDSFKEELDKYFKNHTSPD SARS-CoV-2 6 0.222 0 0 355 VYDPLQPELDSFKEELDKYFKNHTSPDVDL SARS-CoV-2 5 0.185 0 0 356 PLQPELDSFKEELDKYFKNHTSPDVDLGDI SARS-CoV-2 6 0.222 0 0 357 FKEELDKYFKNHTSPDVDLGDISGINASVV SARS-CoV-2 6 0.222 0 0 358 LQLELDSFKEELDKYFKNHTSPDVDLGDIS SARS-CoV-2 5 0.185 0 0 359 FKEELDKYFKNHTSLDVDLGDISGINASVV SARS-CoV-2 5 0.185 0 0 360 NNTAAIVLQLPQGTTLSKGFYAEGSRGGSA SARS-CoV-2 2 0.074 0 0 361 DRLNEVAKNLNESLIDLQELGKYEQYIKWP SARS-CoV-2 1 0.037 0 0 367 LNEVAKNLNESLIDLQELGKYEQYIKWPWY SARS-CoV-2 1 0.037 0 0 363 KLDDKDPNFKDQVILLNKHIDAYKTFPPTE SARS-CoV-2 1 0.037 0 0 364 GAISSVLNDILSRLDKVEAEVQIDRLITGR SARS-CoV-2 1 0.037 0 0 365 ISSVLNDILSRLDKVEAEVQIDRLITGRLQ SARS-CoV-2 1 0.037 0 0 366 VLNDILSRLDKVEAEVQIDRLITGRLQSLQ SARS-CoV-2 1 0.037 0 0 367 LNDILSRLDKVEAEVQIDRLITGRLQSLQT SARS-CoV-2 1 0.037 0 0 368 DETQALPQRQKKQQIVTLLPAADLDDFSKQ SARS-CoV-2 3 0.111 0 0 369 AVRDPQTLEILDITPCSFGGVSVITPGTNT SARS-CoV-2 1 0.037 0 0 370 RATRRIRGGDGKMKDLSPRWYFYYLGTGPE SARS-CoV-2 1 0.037 0 0 371 ATRRIRGGDGKMKDLSPRWYFYYLGTGPEA SARS-CoV-2 1 0.037 0 0 372 RIRGGDGKMKDLSPRWYFYYLGTGPEAGLP SARS-CoV-2 1 0.037 0 0 373 IRGGDGKMKDLSPRWYFYYLGTGPEAGLPY SARS-CoV-2 1 0.037 0 0 374 RGGDGKMKDLSPRWYFYYLGTGPEAGLPYG SARS-CoV-2 1 0.037 0 0 375 GGDGKMKDLSPRWYFYYLGTGPEAGLPYGA SARS-CoV-2 1 0.037 0 0 376 GDGKMKDLSPRWYFYYLGTGPEAGLPYGAN SARS-CoV-2 1 0.037 0 0 377 DGKMKDLSPRWYFYYLGTGPEAGLPYGANK SARS-CoV-2 1 0.037 0 0 378 GKMKDLSPRWYFYYLGTGPEAGLPYGANKD SARS-CoV-2 2 0.074 0 0 379 KMKDLSPRWYFYYLGTGPEAGLPYGANKDG SARS-CoV-2 1 0.037 0 0 380 MKDLSPRWYFYYLGTGPEAGLPYGANKDGI SARS-CoV-2 1 0.037 0 0 381 GTTLPKGFYAEGSRGGSQASSRSSSRSRNS SARS-CoV-2 1 0.037 0 0 382 SPARMAGNGGDAALALLLLDRLNQLESKMS SARS-CoV-2 1 0.037 0 0 383 ARMAGNGGDAALALLLLDRLNQLESKMSGK SARS-CoV-2 1 0.037 0 0 384 RMAGNGGDAALALLLLDRLNQLESKMSGKG SARS-CoV-2 2 0.074 0 0 385 MAGNGGDAALALLLLDRLNQLESKMSGKGQ SARS-CoV-2 2 0.074 0 0 386 GNGGDAALALLLLDRLNQLESKMSGKGQQQ SARS-CoV-2 2 0.074 0 0 387 NGGDAALALLLLDRLNQLESKMSGKGQQQQ SARS-CoV-2 1 0.037 0 0 388 GGDAALALLLLDRLNQLESKMSGKGQQQQG SARS-CoV-2 2 0.074 0 0 389 DAALALLLLDRLNQLESKMSGKGQQQQGQT SARS-CoV-2 1 0.037 0 0 390 LALLLLDRLNQLESKMSGKGQQQQGQTVTK SARS-CoV-2 1 0.037 0 0 391 LLDRLNQLESKMSGKGQQQQGQTVTKKSAA SARS-CoV-2 1 0.037 0 0 392 RATRRIRGGDGKMKYLSPRWYFYYLGTGPE SARS-CoV-2 1 0.037 0 0 393 NAAIVLQLPQGTTLSKGFYAEGSRGGSQAS SARS-CoV-2 1 0.037 0 0 394 SDAALALLLLDRLNQLESKMSGKGQQQQSQ SARS-CoV-2 1 0.037 0 0 395 GKMKDLSPRWYFYYLGTGPEAGLLYGANKD SARS-CoV-2 1 0.037 0 0 396 GTTLPKGFYAEGSRGGSQASSRYSSRSRNS SARS-CoV-2 1 0.037 0 0 397 DGKMKDLSPRWYFYYLGTGSEAGLPYGANK SARS-CoV-2 I 0.037 0 0 398 NGGDAALALLLLDRLNQLETKMSGKGQQQQ SARS-CoV-2 1 0.037 0 0 399 VKQIYKIPPIKDFGGFNFSQILPDPSKPSK SARS-CoV-2 1 0.037 0 0 400 QMAYRFNGIGVTQNVLYENQKLIANQFNSA SARS-CoV-2 1 0.037 0 0 401 LYQDVNCTEVPVAIHADQLTPTWRVYSTGS SARS-CoV-2 1 0.037 0 0 402 YQDVNCTEVPVAIHADQLTPTWRVYSTGSN SARS-CoV-2 1 0.037 0 0 403 TEVPVAIHADQLTPTWRVYSTGSNVFQTRA SARS-CoV-2 I 0.037 0 0 404 EVPVAIHADQLTPTWRVYSTGSNVFQTRAG SARS-CoV-2 1 0.037 0 0 405 FNFSQILPDPSKPSKRSFIEDLLFNKVTLA SARS-CoV-2 1 0.037 0 0 406 RSFIEDLLFNKVTLADAGFIKQYGDCLGDI SARS-CoV-2 1 0.037 0 0 407 SFIEDLLFNKVTLADAGFIKQYGDCLGDIA SARS-CoV-2 1 0.037 0 0 408 GRRGPEQTQGNFGDQELIRQGTDYKHWPQI SARS-CoV-2 1 0.037 0 0 409 SFIEDLLFNKVTLADVGFIKQYGDCLGDIA SARS-CoV-2 1 0.037 0 0 410 PNITNLCPFGEVFNATRFTSVYAWNRKRIS SARS-CoV-2 1 0.037 0 0 411 SFIEDLLFNKVTLADAGFIKQYGDCLGDIV SARS-CoV-2 1 0.037 0 0 412 LQKTVQIKNPKKQAPESFLHTWDFRRGFVT Torque teno midi virus 1 0.037 0 0 413 QQHTKLQLLQLINNLKKKQKLIQLQTGILD Torque teno midi virus 11 2 0.074 1 0.048 414 QIENPERQDPRSILHQWDYRRGFIKERALK Torque teno midi virus 12 1 0.037 0 0 415 IQIVNPEKQSPETIIHPWDYRRGLIKEKAL Torque teno midi virus 7 4 0.148 0 0 416 KAMLRDWDYRRGIITTTALKRMSEHLQTDS Torque teno midi virus 8 1 0.037 0 0 417 ENLQQLILHQQQQQQKLKSNILKLLMDLKH Torque teno midi virus 8 2 0.074 1 0.048 418 SQEIPQTQNLQELIQQQQQQQQQLKYNILK Torque teno midi virus 9 2 0.074 1 0.048 419 QLQQQLQFLTREMFKTQAGLHINPMLLNQR Torque teno virus 2 0.074 1 0.048 420
[0109] There was no overlap between the reactive peptides observed in the convalescent and negative control samples (
[0110] To evaluate the potential for the identified S protein epitopes to be targeted by neutralizing antibodies, we evaluated these within the context of the protein's structure. Of the S epitopes identified, four were recurrent across multiple convalescent samples, occurring at positions 1127-1177, 795-848, 543-589 and 971-1006 (of SARS-Cov-2 S protein sequence GenBank: YP_009724390.1) and found in 14/27, 11/27, 4/27 and 2/27 convalescent donors, respectively.
[0111] The enriched peptides at each of these four high-confidence regions were mapped onto a rendering of the recently-solved 3-dimensional structure of the native S trimer (
[0112] All four epitope regions are accessible for antibody binding on the surface of the trimer. The most widely-recognized reactive region (1127-1177) is located within the ‘stem helix’ just upstream and partially overlapping with the heptad repeat region 2 (HR2); this region is proximal to the transmembrane domain and partially unresolved in the native structure. The second epitope (795-848) resides at the S2′ cleavage site, spanning the fusion peptide whose exposure and incorporation into the host membrane are essential steps in virus entry into cells. Comparison of pre- and post-fusion structures (
Antibody Epitopes and Protein Conservation Across the Human CoVs
[0113] To compare the SARS-CoV-2 reactivity profile described above with those of the other human coronaviruses, we performed a similar analysis but using the HV library (which covers all of the endemic human CoVs) and focusing on pre-pandemic donors. Applying the same Z-score threshold described above to the HV library, we identified reactivity to at least one endemic human coronavirus in 17 (51.5%) of the negative control samples we tested (n=33). To avoid false positives, we required ≥2 enriched peptides for a sample to be considered seropositive. Across all of the different coronaviruses, the vast majority of the recognized peptides were from the S and N proteins (95% of all enriched coronavirus peptides), with occasional reactivity observed to peptides in Orflab and a single peptide from the Membrane (M) protein recognized in one sample (
[0114] Within the S protein, we observed reactivity to homologous regions across multiple coronavirus species with highly variable percent identity to SARS-CoV-2 depending on the region and virus species (12.1-92.5% identical, average=40%)(
[0115] Notably, we observed a correlation between amino acid sequence conservation among members of the Betacoronavirus genus and peptide enrichment in our assay. Across the full S protein, we identified five highly conserved regions (≥70% identical across 15mer sliding windows, blue bars in
[0116] Across the different coronavirus species, the most commonly recognized S protein region, HR2, is also the most commonly reactive SARS-CoV-2 region within our convalescent sera. We detected reactivity in this region to ¾ of the endemic human coronaviruses, though the precise locations of the recognized epitopes likely vary somewhat between species (
[0117]
[0118] In contrast, we did not observe any reactivity for the endemic coronaviruses within the most commonly immunogenic SARS-CoV-2 N protein region (shown by double asterisks “**” in
[0119] Recurrent Interspecies Cross-Reactivity Elicited by SARS-CoV-2 Exposure
[0120] To explore the possibility that the antibody response to SARS-CoV-2 cross-reacts with other viruses, we focused on the panel of control peptides present in both the SCV2 and HV libraries (
[0121] This panel comprises 393 peptides from 55 virus species (range: 1-11 per species; 22 from the Coronaviridae family) for which we have previously observed recurrent reactivity in the general population. Consistent with previous results (not shown) and expected viral prevalences, we observed a range of positivity rates, including 25-100% for Rhinovirus-derived peptides and 0-48% for endemic human CoV-derived peptides. Comparing convalescent and negative control groups, Fisher's exact tests identified a single peptide as significantly different between the groups at a Bonferroni-corrected threshold of p<1.3e-4 (
[0122] By comparison, a second Spike-derived beta-CoV-1 peptide (‘Beta1-S12’) was reactive in about half of all samples tested (13/27 convalescents and 10/21 controls), indicating a high level of exposure to beta-CoV-1/hCoV-OC43 that did not differ between the groups (
[0123] To further test the hypothesis that reactivity to Beta1-HR2 represents cross-reactivity with SARS-CoV-2, we compared donor-level reactivity to this peptide and the homologous SARS-CoV-2 peptide, referred to herein as SARS-CoV-2-HR2 (
Discussion
[0124] Like most viruses, SARS-CoV-2 elicits a robust antibody response whose targets are likely to be important determinants of disease outcome and the extent of protection conferred following natural infection or vaccination. In this study, we describe a customizable platform that enables epitope-resolved profiling of the antibody response (‘PepSeq’), and its application to the study of human CoVs including SARS-CoV-2. Using this system, we identify immunodominant epitopes in both the S and N proteins, several of which overlap conserved, functional sites in the Spike S2 subunit, and therefore have the potential to be sites of broadly neutralizing reactivity. By examining reactivity in pre-pandemic donors to homologous peptides from multiple human CoVs, we also show that the response to SARS-CoV-2 strongly cross-reacts with an endemic human CoV at one of these epitopes.
[0125] By independently testing reactivity across thousands of potential epitopes, we identified several with promise for use in both diagnostics and functional characterization assays. For two of the epitopes, we detected in the S2 subunit of Spike structural considerations, as well as previous characterization of related epitopes (Keng et al., 2005; Lai et al., 2005; Poh et al., 2020), strongly indicate neutralization potential. In these cases, a peptide-based assay may provide a facile means of profiling functional reactivities independently of cell/viral culture, and in a way that complements ACE2:RBD binding inhibition assays that cannot measure S2 reactivity (Tan et al.). We also identified a set of 4 peptides across the S and N proteins that together exhibit great potential for generating an accurate profile of SARS-CoV-2 exposure. Although the precise diagnostic performance of this particular set needs to be quantified on a larger, independent sample set, our results provide a blueprint for a new generation of peptide-based diagnostics that would be easier to manufacture, and in some cases more informative, than existing full-protein/domain assays.
[0126] Our PepSeq analysis identified a novel epitope contained within positions 1127-1177 in Spike, where the minimal reactive sequence is FKEELDKYF (SEQ ID NO: 421), as the most widely-recognized SARS-CoV-2 linear epitope target in convalescent donors (
[0127] A second immunodominant reactivity that we identified in Spike S2 also occurs in a region whose sequence is highly-conserved across CoV species: positions 795-848, where the minimal reactive sequence is EDLLFN (SEQ ID NO: 422), which overlaps the S2′ cleavage site and the Fusion Peptide (FP). Since the minimal region needed to explain the reactive peptides included residues on both sides of S2′ in many donors, this reactivity has the potential to block proteolytic processing and thereby prevent maturation of the S protein. Alternatively, and perhaps additionally, binding of antibody to the FP is expected to prevent its insertion into the host membrane and therefore prevent fusion and cell entry. A recent study, using a lower-throughput peptide-based approach also identified this FP epitope as reactive in two SARS-CoV-2 convalescent donors, and while they did not characterize the mechanism of action, they demonstrated the neutralization potential of antibodies against this epitope using antibody depletion assays (Poh et al., 2020). This study also reported an epitope downstream of the Spike RBD to which antibodies also exhibited neutralization potential. We observed reactivity to this same epitope in four of our SARS-CoV-2 convalescent donors, the epitope have positions 543-589, where the minimal reactive sequence is LPFQQFGRDIADT (SEQ ID NO: 423)). In addition to Spike S2 epitopes, we detected an immunodominant reactivity at positions 140-193 (see also SEQ ID NO: 3) of the SARS-CoV-2 nucleocapsid (N) protein, which lies at the C-terminal end of the domain that is primarily responsible for binding viral RNA (Chang et al., 2009). Unlike the reactivities described in Spike S2, this region does not appear to be targeted in the response to other CoVs (
[0128] Despite well-documented serological reactivity in studies using the full-length RBD antigen (Amanat et al., 2020), we observed very little reactivity to peptides designed from the RBDs of human CoVs, including SARS-CoV-2 (
[0129] The observation that ˜80% of SARS-CoV-2 convalescent donors react strongly to a Beta1-HR2 peptide targeted in ˜5% of our negative control samples (
[0130] The HR2 cross-reactivity characterized here represents a possible source of background reactivity for SARS-CoV-2 serological assays that include the S2 subunit of Spike, which would be absent in those targeting only the RBD, for which sequence conservation is lower across species (Khan et al., 2020). Furthermore, based on the level of sequence conservation at the S2′ cleavage/fusion peptide site, we expect that similar cross-reactivity may also occur at this site, and, in fact, we observed preliminary evidence for such cross-reactivity in one of the pre-pandemic controls analyzed with our HV library (
[0131] Due to the absence of an hCoV-OC43 S2′ control peptide in our SCV2 library, we were not able to directly evaluate the potential for this cross-reactivity in COVID-19 convalescent donors. Nonetheless, our findings indicate that analysis of S2 reactivity is crucial for a complete assessment of the humoral response to SARS-CoV-2 and is consistent with the observation that S2-only assays provide an equally strong correlate of neutralization compared to RBD-only assays. Our findings also indicate that the incorporation of related beta-CoV antigens may improve the sensitivity of SARS-CoV-2 serological analyses, and in particular, that a differential analysis of SARS-CoV-2 and hCoV-OC43 Spike reactivity may provide an important measure of the efficiency with which pre-existing cross-reactive responses can be redirected.
[0132] The identification of broadly-immunogenic epitopes in conserved functional domains of SARS-CoV-2 Spike S2, including cross-reactivity with an endemic human CoV, also has implications for the design of therapeutic antibodies and vaccines. SARS-CoV-2 vaccines currently under development predominantly use 2 forms of the S antigen—whole protein or the RBD—and in each case are designed primarily to elicit neutralizing antibodies. Relative to RBD-focused vaccines, we hypothesize that vaccines that include the Spike HR2 and FP sites. (i) will be able to induce a broader array of neutralizing reactivities, (ii) may be more capable of rapidly recruiting pre-existing memory B cells that are prevalent in the population and (iii) may be less prone to viral escape due to a lower tolerance for amino acid substitutions. In particular, the identification of HR2 as a conserved, functionally-important and broadly-immunogenic site capable of eliciting cross-reacting antibodies, makes this region a candidate for the development of broadly-neutralizing responses against betacoronaviruses.
[0133] The epitope regions identified herein may be used in peptide-based diagnostics, development of subunit vaccines, and development of therapeutic binders, including monoclonal antibodies. The correlation between reactivity to SARS-CoV-2 and the endemic Coronavirus may be used to develop enhanced (more sensitive, more informative) diagnostic assays.
Characterization of Additional SARS-CoV-2 Antibody Epitopes
[0134] As expected, multiple positive control peptides were found to be enriched in every serum sample that we tested (
[0135] In total, we identified IgG reactivity (i.e., peptide enrichment) against 229 and 95 SARS-CoV-2 peptides in convalescent and negative control samples, respectively; 70 of these peptides were enriched in both sample types. The peptides enriched in convalescent samples clustered together into 10 putative epitopes within the S protein and 9 putative epitopes within the N protein (
[0136] To evaluate the potential for the highly recurrent S protein epitopes to be targeted by neutralizing antibodies, we evaluated these within the context of the structure of the protein. The inferred core regions (i.e., sequences present in all enriched peptides from assays of convalescent donors) of each of these epitopes were mapped onto a rendering of the three-dimensional structure of the native S trimer. All three epitope regions are accessible for antibody binding on the surface of the trimer. The most widely recognized region (1,150-1,156) is located within the “stem helix” just upstream and partially overlapping with the heptad repeat region 2 (HR2). This region is proximal to the transmembrane domain and unresolved in the native structure; however, comparison of pre- and post-fusion structures indicated that the HR2 epitope lies within a region that undergoes a dramatic conformational rearrangement during fusion. The second epitope (819-824) resides near the S2′ cleavage site, spanning the fusion peptide (FP), whose exposure and incorporation into the host membrane are essential steps in virus entry into cells. Based on their proximity to these important functional sites, these epitopes are hereafter referred to as HR2 and FP, respectively. Finally, the 560-572 epitope occurs in the subdomain SD1 region (in the S1 subunit but C-terminal of the RBD).
[0137] To explore the diagnostic potential of the six highly recurrent S and N epitopes, we compared the maximum Z scores per epitope across the full set of convalescent and negative samples (
[0138]
[0139]
[0140]
[0141]
[0142] Additional experimental work by the inventors supporting the present invention is presented in Ladner J T, et al. Epitope-resolved profiling of the SARS-CoV-2 antibody response identifies cross-reactivity with endemic human coronaviruses. Cell Rep Med. 2021 Jan. 19; 2(1):100189. doi: 10.1016/j.xcrm.2020.100189. PMID: 33495758; PMCID: PMC7816965, which is hereby incorporated by reference.
TABLE-US-00004 TABLE 4 Putative epitope regions inferred using SCV2 PepSeq library. Enriched Enriched COV-19 Negative SEQ First Last Convalescent Control ID Protein Residue Residue Sequence* Samples Samples NO: Spike 186 215 FKNLREFVFKNIDGYFKIYSKHTPINLVRD 1 0 424 273 302 RTFLLKYNENGTITDAVDCALDPLSETKCT 0 1 425 330 359 PNITNLCPFGEVFNATRFASVYAWNRKRIS 1 0 426 402 431 IRGDEVRQIAPGQTGKIADYNYKLPDDFTG 0 1 417 441 464 LDSKVGGNYNYLYRLFRKSNLKPF 2 2 428 481 510 NGVEGFNCYFPQSYGFQPTNGVGYQPYRV 0 1 429 532 559 NLVKNKCVNFNFNGLTGTGVLTESNKKF 0 1 430 560 572 LPFQQFGRRDIADT 7 0 423 619 647 EVPVAIHADQLTPTWRVYSTGSNVFQTRA 1 0 431 647 668 AGCLIGAEHVNNSYECDIPIGA 1 0 432 785 791 VKQIYKT 3 0 433 819 824 EDLLFN 22 2 422 901 930 QMAYRFNGIGVTQNVLYENQKLIANQFNSA 1 0 401 939 968 SSTASALGKLQDVVNQNAQALNTLVKQLSS 0 1 434 1150 1156 EELDKYF 27 14 435 1155 1184 YFKNHTSPDVDLGDISGINASVVNIQKEID 1 1 436 1184 1195 DRLNEVAKNLNE 0 4 437 Nucleocapsid 25 30 GSNQNG 3 2 438 99 127 GKMKDLSPRWYFYYLGTGPEAGLPYGANK 1 0 439 133 152 VATEGALNTPKDHIGTRNPA 1 1 440 166 169 TLPK 12 3 441 223 229 LLDRLNQ 19 0 442 245 274 TVTKKSAAEASKKPRQKRTATKAYNVTQAF 1 0 443 281 301 QTQGNFGDQFLIRQGTDYKHW 2 3 444 346 361 FKDQVILLNKHIDAYK 2 0 445 3643 375 PKKDKKKK 0 3 446 390 402 QTVTLLPAADLDD 11 1 447 *Reported epitopes represent inferred minimally reactive regions based on enriched peptides across all samples. These regions may not represent the full epitope, due to slight differences in epitopes recognized across different individuals. All positions and sequences relative to GenBank: YP_009724390.1 (Spike) and YP_009724397.2 (Nucleocapsid).
[0143] Some embodiments of the invention may comprise the administration of a pharmaceutical composition to the subject that has been previously diagnosed with a viral infection, such as coronavirus infection. For example, in some embodiments, the subject may have been previously diagnosed with COVID-19 by one skilled in the art (e.g., a physician or a veterinarian) such that a therapeutic treatment is warranted by the diagnosis. Moreover, in other embodiments, the invention may comprise the administration of a pharmaceutical composition to a subject that may have not yet been exposed to a coronavirus-infected environment or individual. As such, the administration of the pharmaceutical composition may function as a vaccine or prophylactic agent to limit any potential viral infection that could occur, or to improve the subject's immune response to the virus.
[0144] All headings are for the convenience of the reader and should not be used to limit the meaning of the text that follows the heading, unless so specified.
[0145] Unless defined otherwise, all technical and scientific terms herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials, similar or equivalent to those described herein, can be used in the practice or testing of the present invention, the preferred methods and materials are described herein. All publications, patents, and patent publications cited are incorporated by reference herein in their entirety for all purposes.
[0146] The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention.
[0147] While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure as come within known or customary practice within the art to which the invention pertains and as may be applied to the essential features hereinbefore set forth.
REFERENCES
[0148] Amanat, F., Stadlbauer, D., Strohmeier, S., Nguyen, T. H. O., Chromikova, V., McMahon, M., Jiang, K., Arunkumar, G. A., Jurczyszak, D., Polanco, J., et al. (2020). A serological assay to detect SARS-CoV-2 seroconversion in humans. Nat. Med. [0149] Callow, K. A., Parry, H. F., Sergeant, M., and Tyrrell, D. A. (1990). The time course of the immune response to experimental coronavirus infection of man. Epidemiol. Infect. 105, 435-446. [0150] Casadevall, A., and Pirofski, L.-A. (2020). The convalescent sera option for containing COVID-19. J. Clin. Invest. 130, 1545-1548. [0151] Chang, C.-K., Hsu, Y.-L., Chang, Y.-H., Chao, F.-A., Wu, M.-C., Huang, Y.-S., Hu, C.-K., and Huang, T.-H. (2009). Multiple nucleic acid binding sites and intrinsic disorder of severe acute respiratory syndrome coronavirus nucleocapsid protein: implications for ribonucleocapsid protein packaging. J. Virol. 83, 2255-2264. [0152] Chi, X., Yan, R., Zhang, J., Zhang, G., Zhang, Y., Hao, M., Zhang, Z., Fan, P., Dong, Y., Yang, Y., et al. (2020). A neutralizing human antibody binds to the N-terminal domain of the Spike protein of SARS-CoV-2. Science. [0153] Deeks, J. J., Dinnes, J., Takwoingi, Y., Davenport, C., Spijker, R., Taylor-Phillips, S., Adriano, A., Beese, S., Dretzke, J., Ferrante di Ruffano, L., et al. (2020). Antibody tests for identification of current and past infection with SARS-CoV-2. Cochrane Database Syst. Rev. 6, CD013652. [0154] Dijkman, R., Jebbink, M. F., El Idrissi, N. B., Pyrc, K., Müller, M. A., Kuijpers, T. W., Zaaijer, H. L., and van der Hoek, L. (2008). Human coronavirus NL63 and 229E seroconversion in children. J. Clin. Microbiol. 46, 2368-2373. [0155] Du, L., He, Y., Zhou, Y., Liu, S., Zheng, B.-J., and Jiang, S. (2009). The spike protein of SARS-CoV—a target for vaccine and therapeutic development. Nat. Rev. Microbiol. 7, 226-236. [0156] Eroshenko, N., Gill, T., Keaveney, M. K., Church, G. M., Trevejo, J. M., and Raj aniemi, H. (2020). Implications of antibody-dependent enhancement of infection for SARS-CoV-2 countermeasures. Nat. Biotechnol. [0157] Fink, Z. W., Martinez, V., Altin, J., and Ladner, J. T. (2020). PepSIRF: a flexible and comprehensive tool for the analysis of data from highly-multiplexed DNA-barcoded peptide assays. arXiv. [0158] Fleri, W., Paul, S., Dhanda, S. K., Mahajan, S., Xu, X., Peters, B., and Sette, A. (2017). The Immune Epitope Database and Analysis Resource in Epitope Discovery and Synthetic Vaccine Design. Front. Immunol. 8, 278. [0159] Friesen, R. H. E., Lee, P. S., Stoop, E. J. M., Hoffman, R. M. B., Ekiert, D. C., Bhabha, G., Yu, W., Juraszek, J., Koudstaal, W., Jongeneelen, M., et al. (2014). A common solution to group 2 influenza virus neutralization. Proc. Natl. Acad. Sci. U.S.A 111, 445-450. [0160] Gorse, G. J., Patel, G. B., Vitale, J. N., and O'Connor, T. Z. (2010). Prevalence of antibodies to four human coronaviruses is lower in nasal secretions than in serum. Clin. Vaccine Immunol. 17, 1875-1880. [0161] Gostic, K. M., Ambrose, M., Worobey, M., and Lloyd-Smith, J. O. (2016). Potent protection against H5N1 and H7N9 influenza via childhood hemagglutinin imprinting. Science 354, 722-726. [0162] Grifoni, A., Weiskopf, D., Ramirez, S. I., Mateus, J., Dan, J. M., Moderbacher, C. R., Rawlings, S. A., Sutherland, A., Premkumar, L., Jadi, R. S., et al. (2020). Targets of T Cell Responses to SARS-CoV-2 Coronavirus in Humans with COVID-19 Disease and Unexposed Individuals. Cell 181, 1489-1501.e15. [0163] Halstead, S. B., and O'rourke, E. J. (1977). Antibody-enhanced dengue virus infection in primate leukocytes. Nature 265, 739-741. [0164] Hansen, J., Baum, A., Pascal, K. E., Russo, V., Giordano, S., Wloga, E., Fulton, B. O., Yan, Y., Koon, K., Patel, K., et al. (2020). Studies in humanized mice and convalescent humans yield a SARS-CoV-2 antibody cocktail. Science. [0165] Hoofnagle, J. H., Gerety, R. J., Ni, L. Y., and Barker, L. F. (1974). Antibody to hepatitis B core antigen. A sensitive indicator of hepatitis B virus replication. N. Engl. J. Med. 290, 1336-1340. [0166] Katzelnick, L. C., Gresh, L., Halloran, M. E., Mercado, J. C., Kuan, G., Gordon, A., Balmaseda, A., and Harris, E. (2017). Antibody-dependent enhancement of severe dengue disease in humans. Science 358, 929-932. [0167] Keng, C.-T., Zhang, A., Shen, S., Lip, K.-M., Fielding, B. C., Tan, T. H. P., Chou, C.-F., Loh, C. B., Wang, S., Fu, J., et al. (2005). Amino acids 1055 to 1192 in the S2 region of severe acute respiratory syndrome coronavirus S protein induce neutralizing antibodies: implications for the development of vaccines and antiviral agents. J. Virol. 79, 3289-3296. [0168] Khan, S., Nakajima, R., Jain, A., de Assis, R. R., Jasinskas, A., Obiero, J. M., Adenaiye, O., Tai, S., Hong, F., Milton, D. K., et al. (2020). Analysis of Serologic Cross-Reactivity Between Common Human Coronaviruses and SARS-CoV-2 Using Coronavirus Antigen Microarray. bioRxiv. [0169] Khurana, S., Loving, C. L., Manischewitz, J., King, L. R., Gauger, P. C., Henningson, J., Vincent, A. L., and Golding, H. (2013). Vaccine-induced anti-HA2 antibodies promote virus fusion and enhance influenza virus respiratory disease. Sci. Transl. Med. 5, 200ra114. [0170] Kozlov, I. A., Thomsen, E. R., Munchel, S. E., Villegas, P., Capek, P., Gower, A. J., Pond, S. J. K., Chudin, E., and Chee, M. S. (2012). A highly scalable peptide-based assay system for proteomics. PLoS One 7, e37441. [0171] Krammer, F., and Simon, V. (2020). Serology assays to manage COVID-19. Science 368, 1060-1061. [0172] Lai, S.-C., Chong, P. C.-S., Yeh, C.-T., Liu, L. S.-J., Jan, J.-T., Chi, H.-Y., Liu, H.-W., Chen, A., and Wang, Y.-C. (2005). Characterization of neutralizing monoclonal antibodies recognizing a 15-residues epitope on the spike protein HR2 region of severe acute respiratory syndrome coronavirus (SARS-CoV). J. Biomed. Sci. 12, 711-727. [0173] Larman, H. B., Zhao, Z., Laserson, U., Li, M. Z., Ciccia, A., Gakidis, M. A. M., Church, G. M., Kesari, S., Leproust, E. M., Solimini, N. L., et al. (2011). Autoantigen discovery with a synthetic human peptidome. Nat. Biotechnol. 29, 535-541. [0174] Liu, A., Li, Y., Peng, J., Huang, Y., and Xu, D. (2020). Antibody responses against SARS-CoV-2 in COVID-19 patients. J. Med. Virol. [0175] Liu, S., Xiao, G., Chen, Y., He, Y., Niu, J., Escalante, C. R., Xiong, H., Farmar, J., Debnath, A. K., Tien, P., et al. (2004). Interaction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors. Lancet 363, 938-947. [0176] Lu, R., Zhao, X., Li, J., Niu, P., Yang, B., Wu, H., Wang, W., Song, H., Huang, B., Zhu, N., et al. (2020). Genomic characterisation and epidemiology of 2019 novel coronavirus: implications for virus origins and receptor binding. Lancet 395, 565-574. [0177] Lubroth, J., Grubman, M. J., Burrage, T. G., Newman, J. F., and Brown, F. (1996). Absence of protein 2C from clarified foot-and-mouth disease virus vaccines provides the basis for distinguishing convalescent from vaccinated animals. Vaccine 14, 419-427. [0178] Lucchese, G., Stufano, A., Trost, B., Kusalik, A., and Kanduc, D. (2007). Peptidology: short amino acid modules in cell biology and immunology. Amino Acids 33, 703-707. [0179] Lv, H., Wu, N.C., Tsang, O. T.-Y., Yuan, M., Perera, R. A. P. M., Leung, W. S., So, R. T. Y., Chan, J. M. C., Yip, G. K., Chik, T. S. H., et al. (2020). Cross-reactive Antibody Response between SARS-CoV-2 and SARS-CoV Infections. Cell Rep. 31, 107725. [0180] Mina, M. J., Kula, T., Leng, Y., Li, M., de Vries, R. D., Knip, M., Silj ander, H., Rewers, M., Choy, D. F., Wilson, M. S., et al. (2019). Measles virus infection diminishes preexisting antibodies that offer protection from other pathogens. Science 366, 599-606. [0181] Monto, A. S., Malosh, R. E., Petrie, J. G., and Martin, E. T. (2017). The Doctrine of Original Antigenic Sin: Separating Good From Evil. J. Infect. Dis. 215, 1782-1788. [0182] Ni, L., Ye, F., Cheng, M.-L., Feng, Y., Deng, Y.-Q., Zhao, H., Wei, P., Ge, J., Gou, M., Li, X., et al. (2020). Detection of SARS-CoV-2-Specific Humoral and Cellular Immunity in COVID-19 Convalescent Individuals. Immunity 52, 971-977.e3. [0183] Nie, J., Li, Q., Wu, J., Zhao, C., Hao, H., Liu, H., Zhang, L., Nie, L., Qin, H., Wang, M., et al. (2020). Establishment and validation of a pseudovirus neutralization assay for SARS-CoV-2. Emerg. Microbes Infect. 9, 680-686. [0184] Pillay, T. S. (2020). Gene of the month: the 2019-nCoV/SARS-CoV-2 novel coronavirus spike protein. J. Clin. Pathol. 73, 366-369. [0185] Pinto, D., Park, Y.-J., Beltramello, M., Walls, A. C., Tortorici, M. A., Bianchi, S., Jaconi, S., Culap, K., Zatta, F., De Marco, A., et al. (2020). Cross-neutralization of SARS-CoV-2 by a human monoclonal SARS-CoV antibody. Nature. [0186] Poh, C. M., Carissimo, G., Wang, B., Amrun, S. N., Lee, C. Y.-P., Chee, R. S.-L., Fong, S.-W., Yeo, N. K.-W., Lee, W.-H., Torres-Ruesta, A., et al. (2020). Two linear epitopes on the SARS-CoV-2 spike protein that elicit neutralising antibodies in COVID-19 patients. Nat. Commun. 11, 2806. [0187] Price, J. V., Tangsombatvisit, S., Xu, G., Yu, J., Levy, D., Baechler, E. C., Gozani, O., Varma, M., Utz, P. J., and Liu, C. L. (2012). On silico peptide microarrays for high-resolution mapping of antibody epitopes and diverse protein-protein interactions. Nat. Med. 18, 1434-1440. [0188] Robbiani, D. F., Gaebler, C., Muecksch, F., Lorenzi, J. C. C., Wang, Z., Cho, A., Agudelo, M., Barnes, C. O., Gazumyan, A., Finkin, S., et al. (2020). Convergent Antibody Responses to SARS-CoV-2 Infection in Convalescent Individuals. bioRxiv. [0189] Routledge, E., Stauber, R., Pfleiderer, M., and Siddell, S. G. (1991). Analysis of murine coronavirus surface glycoprotein functions by using monoclonal antibodies. J. Virol. 65, 254-262. [0190] Shiryaev, S. A., Thomsen, E. R., Cieplak, P., Chudin, E., Cheltsov, A. V., Chee, M. S., Kozlov, I. A., and Strongin, A. Y. (2012). New details of HCV NS3/4A proteinase functionality revealed by a high-throughput cleavage assay. PLoS One 7, e35759. [0191] Tan, C. W., Chia, W. N., Chen, M. I.-C., Hu, Z., Young, B. E., Tan, Y.-J., Yi, Y., Lye, D. C., Anderson, D. E., and Wang, L.-F. A SARS-CoV-2 surrogate virus neutralization test (sVNT) based on antibody-mediated blockage of ACE2-spike (RBD) protein-protein interaction. [0192] Thanh Le, T., Andreadakis, Z., Kumar, A., Gomez Roman, R., Tollefsen, S., Saville, M., and Mayhew, S. (2020). The COVID-19 vaccine development landscape. Nat. Rev. Drug Discov. 19, 305-306. [0193] Walls, A. C., Tortorici, M. A., Snijder, J., Xiong, X., Bosch, B.-J., Rey, F. A., and Veesler, D. (2017). Tectonic conformational changes of a coronavirus spike glycoprotein promote membrane fusion. Proc. Natl. Acad. Sci. U.S.A 114, 11157-11162. [0194] Waterhouse, A., Bertoni, M., Bienert, S., Studer, G., Tauriello, G., Gumienny, R., Heer, F. T., de Beer, T. A. P., Rempfer, C., Bordoli, L., et al. (2018). SWISS-MODEL: homology modelling of protein structures and complexes. Nucleic Acids Res. 46, W296W303. [0195] Whitman, J. D., Hiatt, J., Mowery, C. T., Shy, B. R., Yu, R., Yamamoto, T. N., Rathore, U., Goldgof, G. M., Whitty, C., Woo, J. M., et al. (2020). Test performance evaluation of SARS-CoV-2 serological assays. medRxiv. [0196] Xia, S., Yan, L., Xu, W., Agrawal, A. S., Algaissi, A., Tseng, C.-T. K., Wang, Q., Du, L., Tan, W., Wilson, I. A., et al. (2019). A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike. Sci Adv 5, eaav4580. [0197] Xu, G. J., Kula, T., Xu, Q., Li, M. Z., Vernon, S. D., Ndung'u, T., Ruxrungtham, K., Sanchez, J., Brander, C., Chung, R. T., et al. (2015). Viral immunology. Comprehensive serological profiling of human populations using a synthetic human virome. Science 348, aaa0698. [0198] Yuan, M., Wu, N.C., Zhu, X., Lee, C.-C. D., So, R. T. Y., Lv, H., Mok, C. K. P., and Wilson, I. A. A highly conserved cryptic epitope in the receptor-binding domains of SARS-CoV-2 and SARS-CoV. [0199] Zhu, N., Zhang, D., Wang, W., Li, X., Yang, B., Song, J., Zhao, X., Huang, B., Shi, W., Lu, R., et al. (2020). A Novel Coronavirus from Patients with Pneumonia in China, 2019. N. Engl. J. Med. 382, 727-733. [0200] Zost, S. J., Gilchuk, P., Case, J. B., Binshtein, E., Chen, R. E., Reidy, J. X., Trivette, A., Nargi, R. S., Sutton, R. E., Suryadevara, N., et al. (2020). Potently neutralizing human antibodies that block SARS-CoV-2 receptor binding and protect animals. bioRxiv. [0201] Centers for Disease Control and Prevention (CDC) (2003). Revised U.S. surveillance case definition for severe acute respiratory syndrome (SARS) and update on SARS cases—United States and worldwide, December 2003. MMWR Morb. Mortal. Wkly. Rep. 52, 1202-1206. [0202] Jia, N., Liu, H.-B., Ni, X.-B., Bell-Sakyi, L., Zheng, Y.-C., Song, J.-L., Li, J., Jiang, B.-G., Wang, Q., Sun, Y., et al. (2019). Emergence of human infection with Jingmen tick virus in China: A retrospective study. EBioMedicine. [0203] Woolhouse, M. E. J., and Brierley, L. (2018). Epidemiological characteristics of human-infective RNA viruses. Sci Data 5, 180017.