Safety for Treating Cancers with a Glycosylated Chimeric Antibody to EGFR
20170247458 · 2017-08-31
Assignee
Inventors
Cpc classification
C07K2317/41
CHEMISTRY; METALLURGY
C07K16/2863
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/94
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
There is disclosed a chimeric cetuximab-like monoclonal antibody (CMAB009 mAb) having at least 80% NANA glycosylation terminal sialic acid at an N-glycosylation site Asn297 and a glycosylation pattern of Gal-α(2,3/6)-Gal. The disclosed CMAB009 monoclonal antibody is a chimeric antibody having the same amino acid sequence (light chain/heavy chain of SEQ ID NO. 1/SEQ ID NO. 3) as cetuximab (Erbitux®) which has at least 80% NGNA terminal sialic acid and a glycosylation pattern of Gal-α(1,3)-Gal.
Claims
1. An anti-EGFR antibody pharmaceutical composition comprising a light chain amino acid sequence set forth in SEQ ID NO: 1 and a heavy chain amino acid sequence set forth in SEQ ID NO: 3, wherein the anti-EGFR antibody has a z-average (z-avg) of about 10-25 nm as determined by dynamic light scattering (DLS) analysis, and wherein the anti-EGFR antibody comprises a Gal-α(2, 3/6)-Gal glycan.
2. The anti-EGFR antibody pharmaceutical composition of claim 1, wherein the z-avg of the antibody is 15-20 nm.
3. The anti-EGFR antibody pharmaceutical composition of claim 1, wherein the the sialic acid glycosylation is at least 80% NANA glycosylation terminal sialic acid at an N-glycosylation site.
4. A chimeric anti-EGFR monoclonal antibody having at least 80% NANA glycosylation terminal sialic acid at an N-glycosylation site and a glycosylation pattern of Gal-α(2,3/6)-Gal.
Description
DESCRIPTION OF THE FIGURES
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
DETAILED DESCRIPTION
[0023] The present disclosure provides safety-based therapeutic advantages when producing an anti-EGFR antibody in Chinese Hamster Ovary (CHO) cells. CMAB009 is an anti-EGFR antibody that is produced in CHO cells and has the amino acid sequence of cetuximab. In comparison to cetuximab, administration of CMAB009 to patients having cancer showed reduced immunogenicity reactions and improved efficacy, including an increase in the time in which the disease progressed.
[0024] Structurally, cetuximab has a light chain comprising the amino acid sequence set forth in SEQ ID NO: 1, and a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 3. The amino acid sequences of the cetuximab light and heavy chains are described below:
TABLE-US-00001 (SEQ ID NO: 1) DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPS 60 RFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPP 120 SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT 180 LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 3) QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYN 60 TPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAA 120 STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG 180 LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGP 240 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS 300 TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM 360 TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ 420 QGNVFSCSVMHEALHNHYTQKSLSLSPGK
[0025] As used herein, the term “CMAB009” refers to an antibody which is produced in a CHO cell. Thus, the CMAB009 antibody comprises a light chain comprising the amino acid sequence set forth in SEQ ID NO: 1 and a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 3. Further, the CMAB009 antibody does not contain either an N-glycolylneuraminic acid (NGNA) glycan or a Gal-α(1,3)-Gal glycan. The CMAB009 antibody does contain glycans associated with CHO cell expression, including, for example, a Gal-α(2, 3/6)-Gal glycan.
[0026] The glycosylation mechanism in CHO cells is similar to an IgG glycosylation mechanism in humans. The present disclosure provides a genetically engineered anti-EGFR antibody (CMAB009 mAb) with different glycan structures than cetuximab. By structure analysis, it was determined the cetuximab glycan contains a lot of α-Gal, and mostly NGNA as the terminal sialic acid. NGNA has very high immunogenicity. CMAB009 mAb glycan, by contrast, does not contain α-Gal, and terminal sialic acid is predominately in the form of NANA. The clinical trial, described herein, shows that the predominant NANA CMAB009 antibody has a good tolerance, with no drug-related hypersensitivity observed, and no IgE specific ADA was detected. At the same time of greatly reduced immunogenicity, the characteristics of CMAB009 monoclonal antibody in vivo clearance is in line with the in vivo metabolic of chimeric antibodies, and the pharmacokinetic parameters are consistent with those of cetuximab.
[0027] Compared with cetuximab monoclonal antibody, CMAB009 monoclonal antibody has the same amino acid primary structure, while does not contain α-Gal, and the terminal sialic acid is mainly N-acetylneuraminic acid (NANA). This is consistent with better tolerance that was observed in clinical studies. At the same time of greatly reduced immunogenicity, the characteristics of CMAB009 monoclonal antibody in vivo clearance is in line with the in vivo metabolic of chimeric antibodies, and the pharmacokinetic parameters are consistent with those of cetuximab.
[0028] The present disclosure provides a chimeric cetuximab-like monoclonal antibody (CMAB009 mAb) having at least 80% NANA glycosylation terminal sialic acid at an N-glycosylation site and a glycosylation pattern of Gal-α(2,3/6)-Gal. The disclosed CMAB009 monoclonal antibody is a chimeric antibody having the same amino acid sequence (light chain/heavy chain of SEQ ID NO. 1/SEQ ID NO. 3) as cetuximab (Erbitux®) which has at least 80% NGNA terminal sialic acid and a glycosylation pattern of Gal-α(1,3)-Gal.
Comparison of CMAB009 to Cetuximab
[0029] Both antibodies were compared to each other for binding, efficacy in vitro and in vivo.
[0030] Efficacy was also measured and compared in vitro.
Example 1: CHO Cell Production
[0031] Preferred codons of Chinese hamster were chosen. A signal peptide was selected from Chinese hamster B cell antigen receptor complex associated protein β chain.
TABLE-US-00002 SEQ ID NO 2 MATMVPSSVPCHWLLFLLLLFSGSS, SEQ ID NO 4 ATGGCCACCATGGTGCCCTCTTCTGTGCCCTGCCACTGG, and SEQ ID NO 5 CTGCTGTTCCTGCTGCTGCTGTTCTCTGGCTCTTCT.
[0032] Liposome based co-transfection of CHO—CR-GS.sup.−/− was performed and screened under pressure of CS selection system to obtain stable cell clones. After several rounds of transfection and screening, cell clones were obtained with expressing amount greater than 20 pg/cell/day.
Example 2: Identification of Culture Conditions
[0033] A universal basal medium for CHO—CR-G5.sup.−/ is a chemically defined type of medium (Chemical Defined, CD). This basal medium is made by combining amino acids, vitamins, inorganic salt, glucose and trace elements according to cell growth needs and certain percentages. This basal medium met initial growth needs of the engineered cells obtained from Example 1. In order to further improve the desired antibody yield from the engineered cells, optimizations were performed for the basal medium, including adding hormones, genetically engineered recombinant growth factors, adjusting amino acids amounts.
[0034] The culture PH was: 6.5˜6.9. The expression yield of the engineered cells was greater than 30 pg/cell/day in the optimized medium, using Fed-batch culture mode.
[0035] Following purification, CMAB009 was characterized according to standard dynamic light scattering (DLS) analysis. It was determined that CMAB009 has a more homogenous size distribution in comparison to Erbitux. The z-average (z-avg) for Erbitux was determined to be 31.56 nm, while the z-avg. for CMAB009 was 16.79 nm. Furthermore, the Pdl (Polydispersity Index) of Erbitux was determined to be 0.313, versus 0.128 for CMAB009.
Example 3: Comparison of the Glycosylation of the Culture Product
[0036] LC/MS, MS/MS techniques were used for comparative analysis of the sugar chains of CMAB009 monoclonal antibody and cetuximab (Erbitux®).
[0037] Sample preparation: Fc fragment and oligosaccharide from Fab were prepared after glucosidase digestion; oligosaccharides exonuclease treatment of oligosaccharides on Fab; 2-AB fluorescence labeling of oligosaccharides; After HILIC solid phase extraction to remove excess 2-AB, oligosaccharides were obtained with fluorescence labeled sugar chains, then analyzed via LC/MS and MS/MS chromatography.
[0038] The free glycans from glycosidase treatment of MAb, after fluorescent labeling, were analyzed by LC/MS, MS/MS and oligosaccharide exonuclease treatment. The results show that CMAB009 antibody and cetuximab each have two glycosylation sites. But Fab segments showed different glycan chain structures. The disclosed CMAB009 antibody contained at least 80% NANA glycan chain structure. However, cetuximab had at least 80% NGNA glycan chain structure. Stated otherwise, the glycans of CMAB009 Fab did not contain α-galactose, while the glycans of cetuximab Fab contained a large amount of α-galactose.
Example 4: Clinical Tolerance Study
Initial Evaluation of CMAB009 mAb Clinical Tolerance
[0039] An initial study enrolled a total of 18 subjects, with 3, 6, 6 subjects each assigned to dose groups of 100 mg/m.sup.2 dose, 250 mg/m.sup.2 dose and 400 mg/m.sup.2 dose, respectively, in the study of single intravenous administration. Among the subjects enrolled in single dose study, 3 subjects withdrew due to disease progression, according to the study design the remaining 15 subjects multiple administration inclusion criteria were enrolled in the multiple dose group meeting, with 3 extra subjects were enrolled to multiple dose (Table 1)
TABLE-US-00003 TABLE 1 Allocation of patients to the different dose groups Patient No. Single dose phase Multiple dose phase 01 100 mg/m.sup.2 Group A 02 100 mg/m.sup.2 Disease progression 03 100 mg/m.sup.2 Group A 04 250 mg/m.sup.2 Group A 05 250 mg/m.sup.2 Group A 06 250 mg/m.sup.2 Group A 07 250 mg/m.sup.2 Group A 08 250 mg/m.sup.2 Group A 09 250 mg/m.sup.2 Group B 10 400 mg/m.sup.2 Group B 11 400 mg/m.sup.2 Disease progression 12 400 mg/m.sup.2 Group B 13 400 mg/m.sup.2 Group B 14 400 mg/m.sup.2 Disease progression 15 400 mg/m.sup.2 Group B 16 — Group B 17 — Group B 18 — Group B
[0040] Subjects enrolled in this study were refractory to effective conventional treatment methods, experienced failure from conventional treatment or patients with relapse of advanced cancers, including 10 cases of colorectal cancer, 7 cases of lung cancer, 1 case of gastric cancer, the demographic statistical characteristics and prior treatment of the subjects are shown in Table 2. The multiple dose phase was designed into two groups: Group A was given 250 mg/m.sup.2 of infusion once a week for four weeks. Group B was given an initial infusion of 400 mg/m.sup.2, and a maintenance dose of 250 mg/m.sup.2 infusion, once a week for total of 4 weeks.
TABLE-US-00004 TABLE 2 Patient characteristics No. patients Total 18 Treated on fixed dose extension phase 14 Median age, year range 52 (29-64) Sex male 9 female 9 Tumor type colorectal 10 NSCLC (non small cell lung cancer) 7 gastric 1 Number of prior chemotherapy regimens 2 7 3 4 ≧3 4 radiotherapy 7
[0041] Comparisons and analyses were performed on subjects' baselines, and the age, height, weight, body surface, ECOG score of subjects from the three groups of single dose and the two groups of multiple doses. The results are shown in Table 3 with no statistically significant differences.
TABLE-US-00005 TABLE 3 Subject characteristics at baseline. Mean ± SD Single dose phase Multiple dose phase 100 mg/m.sup.2 250 mg/m.sup.2 400 mg/m.sup.2 group A group B Characteristic (n = 3) (n = 6) (n = 6) (n = 7) (n = 8) Age 58.00 55.00 55.50 57.00 54.00 (years) (31.00-61.00) (48.00-57.00) (42.00-61.00) (48.00-61.00) (49.00-58.00) Height (cm) 161.00 168.50 173.00 165.00 171.00 (145.00-170.00) (165.00-172.00) (160.00-176.00) (152.00-172.00) (160.00-175.00) Weight (kg) 54.00 67.50 63.50 67.00 66.50 (37.00-58.00) (67.00-70.00) (54.00-81.00) (46.00-71.00) (61.75-76.00) BSA 1.55 1.75 1.75 1.74 1.76 (m.sup.2) (1.20-1.67) (1.70-1.80) (1.50-1.90) (1.40-1.81) (1.61-1.87) ECOG 1.00 1.00 1.00 1.00 1.00 (1.00-2.00) (1.00-1.00) (1.00-1.00) (1.00-2.00) (1.00-1.00)
[0042] The results showed that the CMAB009 monoclonal antibody was well tolerated. Among the 18 subjects, there was no grade III-IV drug-related toxicity as showed in Table 4, with all occurring drug-related toxicity at grade I-II, and the incidence of toxicity was independent of the doses or the dosing frequency. No dose-limiting toxicity was observed, and no drug-related hypersensitivity was observed.
TABLE-US-00006 TABLE 4 CMAB009-related toxicities CTC Grade N = 18 I II III-IV Total no events % Acne-like rash 10 1 0 11 61.1 Fever chills 6 4 0 10 55.6 Nausea/vomiting 5 0 0 5 27.8 Headache 3 0 0 3 16.7 Fatigue/melaise 1 0 0 1 5.6 transaminase elevation 1 0 0 1 5.6 paronychia 1 0 0 1 5.6 nasal discharge 1 0 0 1 5.6
[0043] There was no CMAB009 antibody related hypersensitivity observed in this study. The published the incidence of hypersensitivity reactions associated with cetuximab, by contrast, reached 31%, including class III-IV hypersensitivity incidence of 13%. Among 76 subjects who received cetuximab treatment, 25 subjects had hypersensitivity, with hypersensitivity incidence reached 33% (Chung et al. “Cetuximab-induced anaphylaxis and IgE specific for galactose-alpha-1,3-galactose” New Engl. J. Med. 2008; 358 (11): 1109-17).
Example 5: Clinical Result Safety, Immunogenicity Study
[0044] CMAB009 monoclonal antibody clinical safety were most adverse events were drug-related rash. There was no clinically significant new toxicity observed, and there no was severe hypersensitivity observed among 73 subjects studied.
[0045] In this study, a biosensor was made with biofilm interference technology and optical fibers, in which the bottom was covered with SA ligands conjugated with biomolecule compatible layers. Once the captured biotinylated antibody was bound to its ligand, biofilm thickness increased and reflected light interference spectral curve drifted a measurable distance. Thus, a real-time measurement of intermolecular interactions was made. This method is equivalent to a self-assembly process of the captured antibodies, which formed a range of optimal conformations at a certain density for capturing antibody on the surface of the biosensor, which not only improves the analytical sensitivity but also increases the linear range, which helps reduce the false-positive reactions from non-specific binding.
[0046] As to the immunogenicity analysis of CMAB009 monoclonal antibody in this study, the results showed that there was ADA (Anti-drug antibody) detected in 1.4% ( 1/73) of the subjects, with IgG type confirmed by subtype analysis. This was not an IgE type ADA mediated by hypersensitivity. The results of this study were consistent with the results of clinical safety evaluation, since there were no severe hypersensitivity reactions observed among subjects in clinical studies.
Example 6: CMAB009 Treatment Results in Improved Efficacy for Treating Cancer and Reduced Immunogenicity
[0047] CMAB009 was administered to patients having metastatic colorectal cancer in a Phase 2/3 study to determine the efficacy and immunogenicity of CMAB009. As described below, the results from the study were then compared to similar studies performed using cetuximab. Surprisingly, it was determined that CMAB009 has additional efficacy beyond that known for cetuximab. For example, CMAB009 was able to increase the overall survival and length of time to disease progression in patients. The below study is comparable to the cetuximab study described in Cunningham et al. (2004) New Eng. J. Med. 351:337-345.
[0048] The CMAB900 study was initiated by screening patients to identify those with EGFR positive, metastatic colorectal cancer. 501 patients were identified and randomized in a 2:1 manner to group 1 or group 2. Group 1 included 337 patients who were administered a combination of CMAB009 and irinotecan. Specifically, the patients in group 1 were administered an initial dose of 400 mg/m.sup.2 of CMAB009 followed by weekly infusions of 250 mg/m.sup.2 thereafter. Irinotecan doses were maintained according to each patient's pre-trial therapy. Group 2 included 164 patients who were administered irinotecan monotherapy at a dose consistent with the patient's therapy prior to the study. Patients in both groups were treated until the disease progressed or the patient reached an unacceptable level of toxicity. Patient baseline characteristics are provided in Table 5.
TABLE-US-00007 TABLE 5 Baseline characteristics CMAB009 Ph2/3 trial CMAB009 + Irinotecan irinotecan monotherapy (n = 337) (n = 164) Age (yr) Median 55 55 Range 20-72 20-71 Sex-no. (%) Male 195 (57.9) 104 (63.4) Female 142 (42.1) 60 (36.6) Race-no. (%) White 0 0 Black 0 0 Asian 334 (99.1) 159 (97.0) Others 3 (0.9) 5 (3.0)
[0049] Patients were evaluated for radiologic response in both group 1 and group 2. The results are described in Table 6. Note the overall response rate (ORR) in Table 6 was determined according to the sum of the rate of CR and PR, and the disease control rate (DCR) was determined according to the sum of the rates of CR, PR, and SD.
[0050] When compared to data reported for cetuximab from a similar study (see Cunningham et al. (2004) New Eng. J. Med. 351:337-345), patients receiving CMAB900 showed better overall survival (8.6 months for patients receiving cetuximab+irinotecan vs. 17.6 months for patients receiving CMAB900+irinotecan) and an increased time to disease progression (4.1 months for patients receiving cetuximab+irinotecan vs, 6.6 months for patients receiving CMAB900+irinotecan).
TABLE-US-00008 TABLE 6 Radiologic response of CMAB009 CMAB009 Ph2/3 trial CMAB009 + Irinotecan irinotecan monotherapy (n = 337) (n = 164) P-value Complete response 4 (1.2) 1 (0.6) Partial response 107 (31.8) 20 (12.2) Stable disease 159 (47.2) 86 (52.4) Progressive disease 47 (13.9) 44 (26.8) Unable to evaluate 20 (5.9) 13 (7.9) Overall response rate 111 (32.9 [27.9- 21 (12.8 [8.1- <0.001 38.2]) 18.9]) Disease control rate 270 (80.1 [75.5- 107 (65.2 [57.4- 0.0004 84.2]) 72.5]) Overall survival 17.5 16.8 (months) Time to disease 6.6 4.1 progression (months)
[0051] When compared to reported data for cetuximab, surprisingly the overall survival of the patients was greater in the patients receiving CMAB009, i.e., 8.6 months for cetuximab+irinotecan vs. 17.5 months for CMAB009+irinotecan. Data showing an increase in disease progression from this CMAB009 study is also provided in
[0052] A safety evaluation of the study is provided below in Table 7.
TABLE-US-00009 TABLE 7 Safety evaluation Antibody + Irino Irino Total (N = 342) (N = 170) (N = 512) PValue At least one AE 332 (97.1%) 148 (87.1%) 480 (93.8%) <.0001 At least one ADR 320 (93.6%) 126 (74.1%) 446 (87.1%) <.0001 At least one 302 (88.3%) 120 (70.6%) 422 (82.4%) <.0001 important AE At least one Level □ 38 (11.1%) 12 (7.1%) 50 (9.8%) 0.1458 or above AE At least one Level □ 27 (7.9%) 10 (5.9%) 37 (7.2%) 0.4076 or above ADR At least one Level □ 37 (10.8%) 11 (6.5%) 48 (9.4%) 0.1119 or above important AE At least one SAE 23 (6.7%) 8 (4.7%) 31 (6.1%) 0.3669 At least one test 7 (2.0%) 1 (0.6%) 8 (1.6%) 0.2800 drug-related SAE At least one AE 73 (21.3%) 27 (15.9%) 100 (19.5%) 0.1420 which lead to stop drug treatment Test drug-related 1 (0.3%) 0 1 (0.2%) 1.0 death AE
[0053] Notably, adverse events from the CMBA009 study were lower than those reported for cetuximab. The grade 3-4 adverse events are described below in Table 8 (compare to Table 4 of Cunningham et al. (2004) New Eng. J. Med. 351:337-345).
TABLE-US-00010 TABLE 8 Grade 3-4 adverse events for CMBA009 study. STI001 + Irinotecan irinotecan monotherapy (n = 337) (n = 164) Any 180 (54.2) 57 (38.9) Anemia 3 (0.9) 3 (1.8) Neutropenia 53 (15.7) 14 (8.5) Thrombocytopenia 0 0 Diarrhea 35 (10.4) 12 (7.3) Asthenia 19 (5.6) 6 (3.7) Acne-like rash 0 0 Nausea and vomiting 16 (4.7) 16 (9.8) Abdominal pain 3 (0.9) 0 Stomatitis 1 (0.3) 0 pnea N/A N/A Fever 5 (1.5) 1 (0.9)
[0054] In sum, despite having the same primary structure, CMAB900 surprisingly was not only more effective than cetuximab, providing, for example, a longer time to disease progression, but had a reduced rate of adverse events associated with hypersensitivity reactions, e.g., acne-like rash or diarrhea.
Example 7: CMAB009 Treatment Results i
[0055] This example describes a comparison of physicochemical, biochemical, and functional properties of two anti-EGFR Cetuximabs, STI-001 and Erbitux®. Results from these studies disclose that STI-001 and Erbitux® possess the same amino acid sequence, primary structure, secondary and tertiary structure and thermal stability. Comparative biological activities, product related size variants, aggregate and particle levels were similar. STI-001 has different charge variants and glycosylation patterns than Erbitux, which is caused by using a different host cell expressing system. STI-001 has over 99% human sialic acid form NANA. Erbitux has majority non-human type sialic acid NGNA.
[0056] Experiments presented in this example aim to assess analytical similarity between STI-001 and two cetuximab reference products using the state-of-the-art analytical methods. The comparison studies used seven batches of STI-001, three batches of Erbitux-US and three batches of Erbitux-EU. Biochemical and biophysical in vitro characterization of STI-001 and US and EU licensed Erbitux®. STI-001 was manufactured by Mabtech Inc. and Erbitux was purchased on US market and EU market. The materials and equipment used in these studies are summarized in Table.
TABLE-US-00011 TABLE 8 Materials and Equipment Used Equipment/ Instrument Name Equipment ID Serial Number Source Agilent 1260 HPLC EQN1590 NA Agilent Agilent 1290 UHPLC EQN1592 Agilent Agilent bioanalyzer EQN1594 DE13806785 Agilent Q-TOF LC-MS Waters LC-MS YCA234 Waters Protein Simple iCE3 (icIEF) EQN1593 JW0740/10339 Protein Simple MicroCal VP-DSC SYS12901 Malvern Dynamic light scattering DLS MAL1087922 Malvern IntelliCyt ® HTFC screening IntelliCyt 3286 NA system Biacore T200 Biacore 1950211 NA Flexstation 3 Multimode NA 05933 NA Microplate Reader Hypercyt Model C6 NA NA Microscope CK2 NA NA Countess ® II Automated AMQAX1000 1615 185A 213 NA Cell Counter Culture cell Incubator Model 3326 35166-6207 NA Centrifuge 5702 NA Centrifuge Sorvall RT6000 NA 820 6005 NA Refrigerated Raw Material Name (Reagents/Standards/Chemicals) Mfg. Catalog # IAM Sigma/I1149 DTT Thermo Scientific/20290 Trpsin Endoproteinase Thermo Scientific/90055 Water Fisher/W6-4 DPBS Corning Cell Grow 21-031-CM NAP-5 column GE/17-0853-02 Waters CSH 130 C18 Waters/186006938 Formic acid Fisher/A117-50 Guanidine-HCl Pierce/24115 Tris-HCl SIGMA/T6666 0.5M EDTA pH 7.5 Fisher/BP2482 Acetonitrile Fisher/LS120-4 4-20% Tris-glycine gel Thermo Fisher/EC6025BOX Agilent protein 230 Kit Agilent/5067-1517 Potassium phosphate, monbasic J. T. Baker/3052-01 Potassium phosphate, dibasic J. T. Baker/4012-01 Potassium chloride J. T. Baker/4008-01 Pharmalyte pH 3-10 GE/17045601 pI marker 6.61 ProteinSimple/102409 pI marker 9.50 ProteinSimple/101996 Rapid PNGase F NEB/P0710S Cell Dissociation Buffer Gibco/13151-014 PBS Corning-CellGro/21-031-CM MDA-MB-468 NCI/507784 Assay Plate, 96 well, no lid, V-bottom, non-treated Costar/3897 Anti-human IgG-PE Southern Biotech/2040-09 RPMI 1640 Medium, GlutaMAX ™ Supplement Lif Technologies/61870-036 Premium-grade Fetal Bovine Serum, 100% US origin Seradigm/1500-500 Costar ™ 96-Well White Clear-Bottom Plates Fisher/07-200-587 CellTiter-Glo ® Luminescent Cell Viability Assay Promega/G7572
[0057] Reducing and non-reducing capillary electrophoresis sodium dodecyl sulphate (CE-SDS) were performed on the cetuximab samples using Agilent Bioanalyzer 2100 following the manufacturer's instructions. Size exclusion chromatography (SEC) was performed on cetuximab samples using a TSKgel SuperSW mAb HR column (4 μm, 7.8 mm×300 mm) and a mobile phase of 0.2 M potassium phosphate, 0.25 M potassium chloride, pH 6.2, at a flow rate of 0.8 mL/min. A 50 μg sample was loaded onto the column. Data were monitored and collected at 280 nm by an ultraviolet (UV) detector.
[0058] The charge variants of STI-001 and Erbitux samples were determined by icIEF (Imaging Capillary Isoelectric Focusing) using an iCE3 Analyzer with a fluorocarbon (FC) coated capillary cartridge. The ampholyte solution consisted of 4% Pharmalyte pH 3-10, 0.35% (V/V) methyl cellulose, 1M urea with 0.7% (V/V) of each of the pI markers 6.61 and 9.50. The cetuximab samples were diluted to 2 mg/mL with DI water and then mixed with ampholyte solution at a 3:17 (V/V) ratio. The analyte was 80 mM phosphoric acid, and the catholyte was 100 mM sodium hydroxide, both in 0.1% MC. Once loaded, the sample was focused by introducing a potential of 1,500 volts for one minute, followed by potential of 3,000 volts for 6 minutes. An image of focused cetuximab was obtained by passing 280 nm UV light through the capillary and into the lens of a charge coupled device (CCD) digital camera.
[0059] DSC (Differential scanning calorimetry) experiment was done on a MicroCal VP-DSC. Samples were diluted to 1 mg/mL in formulation buffer and was degassed for 10 minutes before analysis. The reference cell was filled with formulation buffer. The sample was heated from 20° C. to 90° C. at a heating rate of 60° C./hour. The pre-scan was 15 minutes, the filtering period was 10 seconds, and the feedback mode/gain was set to passive. The midpoint of a thermal transition temperature (Tm, or thermal transition temperature) was obtained by analyzing the data using Origin 7 software.
[0060] For reduced protein analysis of Erbitux and STI-001 (deglycosylated), antibody (20 μg) was first treated with FabRICATOR to cleave the protein at the hinge region. The resulting solution was then treated with Rapid PNGase F buffer at 80° C. for 10 min for denaturation and reduction, and with Rapid PNGase F at 50° C. for 15 min for deglycosylation.
[0061] For LCMS analysis, an aliquot (5 μg) sample was injected onto a Waters Acquity column (BEH300 C4, 1.7 μm, 2.1×150 mm, 80° C. column temperature). Antibody was eluted from the column with a 12 min gradient (25-40% B, 0.4 mL/min flow rate). For reduced antibody analysis, all experiments were performed on a Waters H class UPLC system coupled to a Waters Xevo G2 TOF mass spectrometer. The mass spectrometer was operated in positive ion, sensitivity mode with detection in the range of 500-4000 m/z. Source parameters were as follows: capillary voltage, 3.0 kV; sampling cone voltage, 40.0 V; source temperature, 125° C.; desolvation temperature, 350° C.; cone gas flow, 10 L/hr; desolvation gas flow, 800 L/hr. The protein peak was deconvolved by MassLynx MaxEnt1 function according to the following parameters: output resolution, 2.0 Da/channel; uniform Gaussian width at half height, 0.8 Da for intact antibody, 0.5 Da for reduced antibody; minimum intensity ratios 33% for left and right; maximum number of iteration of 20.
[0062] For reducing peptide mapping with trypsin, the antibody was diluted with denaturation buffer (6M GuHCl, 360 mM Tris, ImM EDTA, pH 8.6) to 1 mg/ml, reduced with DTT (final concentration 5 mM, 80° C. for 15 min) and alkylated with iodoacetamide (final concentration 15 mM, 37° C. for 15 min). The sample was then exchanged into digestion buffer (25 mM Tris, ImM CaCl.sub.2, pH 8.3). The sample in digestion buffer was digested with Trypsin for 4 hours at 37° C. The digestion was then quenched with formic acid to get a final concentration of 0.2% (v/v).
[0063] The peptides were then analyzed on a Waters UPLC coupled online with Q-TOF Mass Spectrometer. An aliquot (10 μg) sample was injected onto an Agilent AdvanceBio peptide mapping column (C18, 2.7 μm, 2.1×150 mm). Antibody was eluted from the column with a gradient of 0-19% in 30 min, 19%-27% in 18 min and 27-51% in 27 min, the flow rate was 200 μL/min, and the column temperature was set to 45° C. Mobile phase A was 0.1% formic acid and mobile phase B was 0.1% formic acid in acetonitrile.
[0064] FTIR experiment was performed by HTL Biosolution Inc., Camarillo, Calif. In brief, FTIR spectra were collected on a JASCO 4200 FTIR spectrometer equipped with a room temperature TGS detector and a sATR device. Spectra were collected at a 4 cm.sup.−1 resolution with data average of 256 scans. Residual moisture peaks were also subtracted from the spectra of samples before further analysis. FTIR spectra of buffers have also been collected and the spectrum of buffer has been subtracted from that of the protein sample. After subtraction of buffer spectrum, residual moisture peaks were also subtracted from all spectra collected. Finally, second derivative spectra were calculated by using the Savitzky-Golay method, with a 2.sup.nd order of polynomial function and the number of convolution point is 13.
[0065] CD experiments were performed by Alliance Protein Laboratories, San Diego, Calif. Antibody samples were diluted with formulation buffer to 1 mg/ml for near UV CD. CD measurements were carried out at room temperature on a Jasco J-715 spectropolarimeter using 1 cm cell. After subtracting buffer spectrum, the CD spectrum of the protein was converted to the mean residue ellipticity (CD intensity per amino acid) using the protein concentration, the mean residue weight (average weight per amino acid) of 109.85 and the path-length of the cell.
[0066] Dynamic light scattering (DLS) measurements were made on a Malvern ZEN3600 at room temperature. The scattered light was detected at an angle of 90°. For N-linked oligosaccharide analysis, N-glycans were released from 200 μg of protein under denatured condition using PNGase F followed by purification of the glycans using SPE cartridges (C18 and PGC). N-linked glycans were labeled with 2-Ab and detected by UPLC-FLR and mass spectrometer. For total sialic acid analysis, sialic acid analysis was performed by UCSD (University of California, San Diego) Glycotechnology Core Facility, La Jolla, Calif. The antibody sample was dissolved in a final concentration of 2 M acetic acid and heated to 80° C. for 3 hours to release sialic acids. The released sialic acids were collected by filtrating through an ultra-10 filter with 3,000 MWCO, dried and analysed by HPAEC-PAD using a Dionex CarboPac PA-1 column eluted with a sodium acetate gradient that separates N-acetylneuraminic acid and N-glycolylneuraminic acid.
[0067] A cell binding assay provided MDA-MB-468 triple-negative breast cancer (TNBC) cells highly expressing EGFR harvested with enzyme-free Cell Dissociation Buffer (GIBCO) and transferred to V-Bottom 96 well-plates (50,000 cells/well). Cells were incubated on ice for 45 min with serial dilutions of STI-001 antibody in FACS buffer (PBS+2% FBS). After 2 washes in FACS buffer, a 1:1000 dilution of Phycoerythrin-conjugated anti-Human IgG was added and incubated for 20 min. Following a final wash, fluorescence intensity was measured on the Hypercyt High Throughput Flow Cytometer (HTFC, Intellicyt). Data were analysed using Graphpad Prism software and non-linear regression fit. Data points are shown as the median fluorescence intensity (MFI) of positively labeled cells +/−Standard Error. EC.sub.50 values are reported as the concentration of antibody to achieve 50% of maximal binding to the cells.
[0068] A cell proliferation assay provided EGFR-expressing cells (MDA-MB-468) in log phase were lifted and resuspended in RPMI+1% FBS to 55,555 cells/ml. Cells were seeded in white 96-Well Clear Bottom plates (5,000 cells/well in 90 ul). On the same day, serial dilutions of the antibodies were prepared in RPMI+1% FBS, in 10× premixes, and added to cells (10 μl/well) in triplicate. After 3 days incubation at 37° C., cell proliferation was analysed as follows: 100 ul of Cell Titer Glo buffer (Promega) was added to each well. Plates were incubated with shaking at room temperature for 20 min. Luminescence signal was then measured on a Flexstation 3 plate reader. Data were reported as Relative Luminescence Units. Dose-response curves were generated in GraphPad prism, and IC.sub.50 values were calculated using non-linear regression fit (Log (inhibitor) vs. response—Variable slope equation).
[0069] Anti-human Fc antibody (GE, BR-1008-39) was immobilized on CM5 sensor chip (Biocore) to approximately 1000RU using standard NHS/EDC coupling methodology. Antibodies (about 5 μg/mL) were captured for 60 s at a flow rate 10 μL/min. Recombinant human EGFR/His was serially diluted in running buffer (HBS-EP). All measurements were conducted in HBS-EP buffer with a flow rate of 30 μL/min. The antibody was diluted appropriately to obtain a series of concentrations. A 1:1 (Langmuir) binding model was used to fit the data. The experiment was run on a GE Biacore T200.
[0070] A triple negative breast cancer cell line, pre-incubated with or without test antibodies, was cultured with natural killer cells (effector cells). After an appropriate period, the amount of tumor cell lysis was determined.
[0071] Preparation of effector cells (NK cells): Peripheral blood mononuclear cells were prepared from blood obtained from a San Diego blood bank using SepMate-50 tubes (Cat.#15450) and Lymphoprep (Cat.#0780), both from Stemcell technologies. From this, NK cells were isolated using EasySep negative selection “Human NK cell Enrichment Kit” Cat.#19055 also from Stemcell Technologies. The resultant NK cell (>95% pure) population were then cultured in RPMI medium supplemented with 10% fetal calf serum plus interleukin 2 (Prospec, Ness Ziona, Israel) at 100 U/ml. The next day, cells were harvested, washed and resuspended in fresh RPMI+10% FCS.
[0072] Preparation of target cells: EGFR positive, triple negative, breast cancer cell line MDA-MB-468 were maintained in RPMI+10% FCS. On the day of assay, the cells were removed from the culture flask with the aid of cell dissociation buffer (Gibco cat#13151-014). Once cells had detached, they were washed and resuspended in fresh RPMI+10% FCS.
[0073] Assay performance: Target cells were added to the wells of a flat bottom white plate (Costar cat#3917) at 5×10.sup.3 per well. Test antibodies at 10 microgram/ml or medium was added to appropriate wells. After 20 minutes at 37° C., the plate is washed followed by the addition of the effector cells (1.5×10.sup.5 per well) to give an effector to target ratio of 30:1. After 4 hours at 37° C., substrate from the CytoTox-Glo kit (Promega Cat.# G9291) was added and the plate processed according to the instructions provided in the kit.
[0074] An anti-EGFR binding ELISA assay used a direct binding ELISA format. Recombinant human EGFR-His (Cat#10001-H08H, lot# LC08DE1601, Sino Bio) was adsorbed onto a microtiter plate followed by blocking of the plate and addition of anti-EGFR mAb dilutions (2.5-fold serial dilution with starting concentration 10 ng/mL of mAb). An HRP (horse radish peroxidase)-labelled anti-Human IgG reagent binds the anti-EGFR mAb. Finally, a substrate (TMB) was added which is converted by HRP to a visible colour. The HRP enzyme reaction was then stopped with acid and the colour signal is detected by a plate reader. The amount of anti-EGFR bound was directly proportional to the amount of colour generated. Wash steps were included between incubations to remove excess unbound reagents after each step prior to substrate addition. EC50 values of the mAbs were calculated in Prism 7 by plotting A450 versus the mAb concentrations and fitting the curves with the sigmoidal dose-response analysis (four parameters fit).
[0075] Antibody STI-001 was compared, head-to-head, with Reference Medicinal Product (RMP)—Erbitux® sourced from EU and US market. The lot information is provided in Table 8.
TABLE-US-00012 TABLE 8 Reference Medicinal Product Lot information Product/Strength Lot Number Manuf. Date Exp. Date Source STI-001 (20 mg/mL) aDS-20160623 June 2016 June 2019 Sorrento STI-001 (20 mg/mL) aDS-20160702 July 2016 July 2019 STI-001 (18 mg/mL) aDS-20160711 July 2016 July 2019 STI-001 (10 mg/mL) 20160201 February 2016 February 2019 STI-001 (10 mg/mL) Clinical trial Lot June 2010 May 2013 T20100601 STI-001 (10 mg/mL) Clinical trial Lot June 2010 May 2013 T20100602 STI-001 (10 mg/mL) Clinical trial Lot July 2010 June 2013 T20100701 Erbitux ® (2 mg/mL) IMD246 NA January 2017 US Erbitux ® (2 mg/mL) IMF411 NA July 2018 Erbitux ® (2 mg/mL) IMF417 NA October 2018 Erbitux ® (5 mg/mL) 214376 NA October 2019 EU Erbitux ® (5 mg/mL) 212461 NA September 2019 Erbitux ® (5 mg/mL) 210683 NA September 2019
[0076] The comparative characterization results are summarized in tables 9 and 10. The primary and higher-order structure of STI-001, as well as size variants are similar to Erbitux (US) and Erbitux (EU) RMPs. The aggregate, particle levels, and product purity between STI-001 and Erbitux RMPs are similar. Furthermore, functional biological characterization, including proliferation bioassay, antigen binding assay, effector functions such as ADCC and CDC, FcγR binding assays revealed that STI-001 has equivalent biological activities to Erbitux (US) and Erbitux (EU). STI-001 has shown different glycosylation patterns with Erbitux RMPs. STI-001 has predominant human sialic acid form N-Acetylneuraminic acid (NANA). Erbitux has predominant non-human sialic acid form N-Glycolyneuraminic acid (NGNA).
TABLE-US-00013 TABLE 9 Summary of Comparability Assessment Results Method Result Identity; Peptide mapping STI-001 has the same amino acid sequence for both Primary and Amino acid heavy chain and light chain as those for Erbitux ® structure sequencing based on amino acid sequencing analysis of peptides fragments after digestions with trypsin protease. Reduce and Same molecular weights for separated heavy chain deglycosylated HC and light chain based on the deglycosylated heavy and LC by LC-MS chain and light chain; Higher order Secondary structure STI-001 exhibits the same spectrum by FTIR, structure by FT-IR demonstrating the same secondary structure as that of Erbitux ®. Tertiary structure STI-001 exhibits the same spectrum by Near-UV by Near-UV CD CD, demonstrating the same tertiary structure as that of Erbitux ®. Thermal stability STI-001 has the same thermal stability profile as that by DSC of Erbitux ®. Potency Antigen binding STI-001 has the same binding affinity to EGFR as affinity by Biacore that of Erbitux ®. Antigen binding STI-001 has the same binding affinity to EGFR as assay ELISA that of Erbitux ®. Cell based Antigen Based on the binding assay of STI-001 and of binding assay Erbitux ® to MDA-MB468 an EGFR expressing breast cancer cell line, the EC.sub.50 for both products are comparable. Cell proliferation Based on the ability of STI-001 and of Erbitux ® to assay inhibit the cell proliferation of HCC827 cell line, a lung cancer cell line, the IC.sub.50 for both products are comparable. FcγR binding STI-001 and Erbitux (US/EU) was bound to affinity recombinant FcγRI with similar affinity.
TABLE-US-00014 TABLE 10 Summary of Quality Comparability Results of STI-001 Compared with Erbitux ® Authorized US and EU. Method Result Potency ADCC The level of cytotoxic activity in the presence of the STI-001 antibodies was as good as Erbitux US and EU. CDC The level of cytotoxic activity in the presence of the STI-001 antibodies was as good as Erbitux US and EU. Purity (Particle SEC-HPLC The purity of STI-001 and Erbitux ® size; as determined by SEC-HPLC, are aggregates) comparable. The content of monomer is >98% for both products. Dynamic Light STI-001 exhibits similar size Scattering distribution and polydispersity index (DLS) (PdI) as those of Erbitux. CE-SDS The purity of STI-001 and Erbitux ® as determined by CE-SDS, are comparable. Charge icIEF STI-001 has a different charge profile variants with a slight shift to more basic species for Erbitux ®, which is consistent with a lower level of sialic acid observed in Erbitux ®. Glycan profile N-linked release Erbitux has more complex glycan oligosaccharide profiles than STI-001. Erbitux ® has non-human glycans, which may induce immunogenicity/ hypersensitivity. Sialic acid STI-001 has only human sialic acid, analysis NANA (N-Acetylneuraminic acid) while Erbitux ® has only Non- human sialic acid NGNA (N-Glycolyneuraminic acid).
[0077] Antibody amino acid sequence identifications were performed by trypsin peptide mapping coupled with LC-MS analysis on the intact molecular of STI-001 and Erbitux. There were identical amino acid sequences.
[0078] The similarity for the primary structures between STI-001 and Erbitux (US) and Erbitux (EU) was also investigated using reduced and deglycosylated HC and LC mass analysis. Results of HC and LC analysis are shown in Table 11, which provided further assurance that polypeptide compositions were similar measuring molecular weight.
TABLE-US-00015 TABLE 11 Summary of Reduced and deglycosylated HC and LC mass analysis Light Heavy Heavy Chain Chain Chain MW Fc MW Fab MW Product Lot Number (Da) (Da) (Da) STI-001 aDS-20160623 23425 25452 23789 aDS-20160702 23425 25452 23789 aDS-20160711 23426 25451 23789 20160201 23425 25452 23789 T20100601 23425 25451 23788 T20100602 23425 25452 23788 T20100701 23425 25453 23789 Erbitux ® (US) IMD246 23425 25451 23788 IMF411 23425 25450 23788 IMF417 23425 25451 23788 Erbitux ® (EU) 214376 23425 25450 23788 212461 23424 25450 23788 210683 23425 25450 23788
[0079] Fourier Transform Infrared Spectroscopy (FT-IR) was used to compare secondary structure of STI-001 and Erbitux over the wavelength range of 1700-1500 cm.sup.−1. The spectra showed (
[0080] The tertiary structure of the antibodies was determined by near-UV circular dichroism (CD). CD spectra of a protein in the “near-UV” spectral region (250-350 nm) can be sensitive to certain aspects of tertiary structure. At these wavelengths the chromophores are the aromatic amino acids and disulfide bonds, and the CD signals they produce are sensitive to the overall tertiary structure of the protein. The near UV-CD spectral of all individual STI-001 lots were similar compared with Erbitux.
[0081] The thermodynamic properties of STI-001 and Erbitux (US and EU licensed) products were assessed and compared by DSC (differential scanning calometry). The DSC scans were visually similar for STI-001 and Erbitux RMPs (
TABLE-US-00016 TABLE 12 Summary of Tm (melting temperature) values Product Lot Number T.sub.m (° C.) STI-001 aDS-20160623 72.5 aDS-20160702 72.8 aDS-20160711 73.1 20160201 72.8 T20100601 72.8 T20100602 72.6 T20100701 72.9 Erbitux ® (US) IMD246 72.9 IMF411 73.0 IMF417 72.7 Erbitux ® (EU) 214376 72.7 212461 72.9 210683 72.5
[0082] Antigen binding was measured to determine binding affinity of anti-EGFR antibodies (STI-001 and Erbitux US and Erbitux EU) to recombinant EGFR/His. This was measured by Biacore. The Kd values are reported in Table 13. The anti-EGFR antibody Erbitux (US and EU) and ST-001 showed similar kinetic properties for their binding to human EGFR protein as shown in Table 13.
TABLE-US-00017 TABLE 13 Comparison of binding affinity between STI-001 and Erbitux US and EU ka kd Rmax KD Source Lot (1/Ms) (1/s) (RU) (M) Erbitux IMD246 9.87E4 1.48E−4 84.22 1.50E−9 (US) IMD417 7.63E4 1.75E−4 80.59 2.29E−9 IMD411 5.52E4 1.41E−4 56.91 2.54E−9 Erbitux 214376 8.57E4 1.38E−4 138.60 1.61E−9 (EU) 212461 7.79E4 1.63E−4 103.50 2.10E−9 210683 7.78E4 1.65E−4 96.89 2.12E−9 STI-001 aDS-20160623 8.67E4 1.01E−4 82.14 1.17E−9 aDS-20160702 5.49E4 1.95E−4 275.5 3.55E−9 aDS-20160711 5.07E4 1.97E−4 280.6 3.88E−9 20160201 5.40E4 1.86E−4 247.8 3.44E−9 T20100601 1.16E5 1.54E−4 62.92 1.32E−9 T20100602 6.72E4 1.65E−4 92.46 2.45E−9 T20100701 1.94E5 2.38E−4 73.12 1.23E−9
[0083] STI-001, Erbitux (US/EU) were titrated in a standard ELISA against cognate antigen and detected using an HRP-labeled secondary antibody to measure antigen binding affinity by ELISA. Table 14 shows that the EC50 values are similar between the antibody lots.
TABLE-US-00018 TABLE 14 Relative binding affinity by ELISA Relative binding Source Lot affinity Erbitux (US) IMD246 120% IMD417 123% IMD411 100% Erbitux (EU) 214376 100% 212461 103% 210683 111% STI-001 aDS-20160623 110% aDS-20160702 109% aDS-20160711 100% 20160201 101% T20100601 99% T20100602 112% T20100701 103%
[0084] A cell-based antigen binding assay measured binding of STI-001 and Erbitux with MDA-MB-468 cells, a triple negative breast cancer cell line highly expressing EGFR.
[0085] According to results presented in Table 15, no significant differences were observed between STI-001 and Erbitux (US and EU). The antibodies bound to cellular antigen with the comparable affinity.
TABLE-US-00019 TABLE 15 EC50 Source Lot EC50 (nM) Erbitux (US) IMD246 0.70 IMD417 0.47 IMD411 0.70 Erbitux (EU) 214376 0.56 212461 0.41 210683 0.47 STI-001 aDS-20160623 1.32 aDS-20160702 1.52 aDS-20160711 1.53 20160201 0.25 T20100601 0.46 T20100602 0.35 T20100701 0.37
[0086] A cell proliferation assay measured anti-proliferative effects of STI-001 and Erbitux (US and EU) in a cell proliferation assay. Briefly MDA-MB-468 cells were grown for 3 days in the presence of increasing amounts of either STI-001 or Erbitux, and cell viability was then measured. The results, shown in Table 16, indicate that STI-001 and Erbitux display very similar inhibitory activity on cell proliferation.
TABLE-US-00020 TABLE 16 IC50 Source Lot Relative IC50 Erbitux (US) IMD246 92% IMD417 87% IMD411 100% Erbitux (EU) 214376 92% 212461 94% 210683 105% STI-001 aDS-20160623 93% aDS-20160702 46% aDS-20160711 155% 20160201 66% T20100601 100% T20100602 128% T20100701 87%
[0087] STI-001 or Erbitux (US/EU) was bound to recombinant FcγRI in a standard ELISA in increasing concentrations. The EC50 values were derived from 4PL curve analysis. The results show that the EC50 values of the antibodies are all similar between STI-001 and Erbitux.
TABLE-US-00021 TABLE 17 FcγR Relative binding affinity Relative binding Source Lot affinity Erbitux (US) IMD246 82% IMD417 86% IMD411 100% Erbitux (EU) 214376 130% 212461 124% 210683 82% STI-001 aDS-20160623 122% aDS-20160702 119% aDS-20160711 111% 20160201 89% T20100601 91% T20100602 97% T20100701 91%
[0088] STI-001 antibodies were compared with Erbitux EU and Erbitux US for their ability to support ADCC. For these studies, the triple negative EGFR expressing breast cancer cell line, MDA-MB-468 was cultured with natural killer (NK) cells in the presence or absence of test antibody at 10 μg/ml. Measurement of cytotoxicity was performed after four hours of incubation using a luciferase based kit from Promega.
[0089] STI-001 antibodies were compared with Erbitux EU and Erbitux US for their ability to support complement dependent cytotoxicity (CDC). For these studies, the triple negative EGFR expressing breast cancer cell line, MDA-MB-468 was incubated with or without the test antibodies added at 10 μg/ml. After 20 minutes, baby rabbit complement was added as a 10% v/v solution. To evaluate cytotoxicity, propidium iodide was added after a one hour incubation and the percentage dead cells quantitated by flow cytometry.
[0090] Product monomer content was determined by SEC-HPLC (Table 18). Both STI-001 and Erbitux (US) and Erbitux (EU) exhibited predominant monomer content (>97%). These results confirmed that STI-001 and Erbitux (US) and Erbitux (EU) are similar regards to monomer purity.
TABLE-US-00022 TABLE 18 Summary Result of SEC-HPLC % % % Source Lot HMWS Main Peak LMWS Erbitux (US) IMD246 0.3 98.1 1.6 IMF411 1.5 97.2 1.3 IMF 417 1.5 97.5 1.0 Erbitux (EU) 210683 0.7 97.9 1.4 212461 0.6 98.0 1.4 214376 1.3 97.4 1.3 STI-001 20160201 1.0 97.7 1.3 aDS 20160711 0.6 97.6 1.8 aDS 20160702 0.7 97.4 1.9 aDS 20160623 1.4 96.3 2.3 T20100601 1.7 95.2 3.1 T20100602 1.8 96.3 1.9 T20100701 1.9 95.7 2.4
[0091] Dynamic light scattering (DLS) is a technique that can measure the size of particles down to 1 nm in diameter. Particles in suspension undergo random Brownian motion. If these particles are illuminated with a laser beam, the intensity of the scattered light fluctuates at a rate that is dependent upon the size of the particles. Analysis of these intensity fluctuations yields the velocity of the Brownian motion and hence the particle size. Table 19 shows intensity size distributions obtained from 3 repeat measurements of STI-001 and Erbitux samples. STI-001 and Erbitux have similar main size distribution.
TABLE-US-00023 TABLE 19 Comparison of particle size between STI-001, Erbitux (US) and Erbitux (EU) Z-Avg. Source Lot (d .Math. nm) PdI Erbitux (US) IMD246 20.0 0.19 IMF411 11.9 0.07 IMF 417 11.6 0.04 Erbitux (EU) 210683 15.2 0.10 212461 15.8 0.13 214376 15.4 0.11 STI-001 20160201 14.1 0.06 aDS 20160711 15.3 0.14 aDS 20160702 15.9 0.11 aDS 20160623 15.6 0.07 T20100601 13.5 0.06 T20100602 13.5 0.08 T20100701 13.5 0.07
[0092] CE-SDS was used to assess the product purity. STI-001 and Erbitux (US and EU) were analyzed under non-reducing and reducing conditions. Protein markers with known molecular weights and sample were run in parallel. CE-SDS showed STI-001 and Erbitux (US and EU) have the same purity under both reducing and non-reducing conditions (Table 20).
TABLE-US-00024 TABLE 20 Summary of CE-SDS Result Non- reducing Reducing Condition Main Band HC LC Sum Source Lot % % % (HC + LC) Erbitux IMD246 97.4 64.2 35.7 99.9 (US) IMF411 98.3 64.1 35.6 99.9 IMF 417 98.1 64.4 35.7 100.0 Erbitux 210683 98.2 66.5 33.4 99.9 (EU) 212461 98.3 64.8 34.8 99.6 214376 98.6 65.6 34.4 100.0 STI-001 20160201 97.4 68.6 31.5 100.0 aDS 20160711 96.9 66.0 31.7 97.7 aDS 20160702 97.6 67.7 32.1 99.8 aDS 20160623 97.5 68.2 30.0 98.2 T20100601 93.4 66.4 33.6 100.0 T20100602 94.4 66.5 33.2 99.7 T20100701 94.8 66.1 33.4 99.4
[0093] Charge variants in STI-001 and Erbitux were analyzed by imaging capillary isoelectric focusing (icIEF). STI-001 and Erbitux RMPs were expressed by using different host cells. STI-001 used CHO cell system and Erbitux used SP2/0 cell lines. The processes are also different. Therefore, the charge variants are expected to be different. However, their main pIs and charge variants percentages were very similar.
1.1 Glycan Analysis
[0094] In addition to the conserved Fc glycosylation at Asn 297, cetuximab also contains another N-linked glycosylation site at V.sub.H domain Asn 99. To compared the glycan heterogeneity associated with STI-001 and Erbitux RMPs, several methods were used including LC-MS, released glycans mass spectrometry and total sialic acid analysis.
[0095] Fc and Fab glycosylations were released by PNGase F and labelled with 2-AB (2-aminobenzamide). 2-Ab labelled glycans are analyzed by UPLC and TOF-MS. The UPLC chromatograms showed STI-001 and Erbitux have different glycan profiles. Erbitux showed more oligosaccharide species than STI-001. Table 21 lists all the glycan forms identified and their relative abundances.
[0096] The types of amounts of sialic acids capping the glycan structures display by STI-001 and Erbitux were assessed. Sialic acid was detected in the major form of N-glycolylneuraminic acid (NGNA) for Erbitux and N-acetyl-neuraminic acid (NANA) for STI-001 (Table 22). The predominant sialic acid made by human is NANA. NGNA has been shown to have potential contribution to immunogenicity/hypersensitivity in human. STI-001 has human sialic acid form NANA. Erbitux has non-human type sialic acid NGNA.
TABLE-US-00025 TABLE 21 Total sialic acid comparison between STI-001 and Erbitux RMPs Source Lot NGNA % NANA% Erbitux (US) IMD246 100% 0% IMF411 100% 0% IMF 417 100% 0% Erbitux (EU) 210683 100% 0% 212461 100% 0% 214376 100% 0% STI-001 20160201 0% 100% aDS 20160711 0% 100% Glycan species G2F- Gal1/G2 G2- G2F- Source Lot NO G0F G0FB G1F G1F' G2F F-Gal2 NGNA NGNA US IMD246 27.1% 0.4% 17.8% 5.3% 4.5% 16.6% 0.4% 7.8% IMF411 28.8% 0.2% 18.9% 5.8% 4.7% 13.8% 0 7.6% IMF417 25.8% 0.5% 18.6% 5.5% 4.9% 16.5% 0 6.7% EU 214376 23.8% 0.2% 16.8% 5.0% 4.3% 18.8% 0.8% 8.8% 212461 25.6% 0 18.3% 5.5% 4.7% 17.6% 0.4% 8.5% 210683 26.0% 0 18.2% 5.4% 4.7% 17.1% 0 8.8% aDS 20160702 0% 100% aDS 20160623 0% 100% T20100601 0% 100% T20100602 0% 100% T20100701 0% 100%
[0097] In conclusion, the foregoing analytical comparisons show that the STI-001 and Erbitux® (US and EU) antibodies possess the same amino acid sequence, primary structure, secondary and tertiary structure and thermal stability, very comparable purity, impurity, biochemical, and functional properties. But STI-001 has different charge variants and glycosyulation patterns with Erbitux (US and EU). STI-001 has over 99% human sialic acid form NANA. Erbitux has majority non-human type sialic acid NGNA, which is believed to induce immunogenicity/hypersensitivity in humans.