PAR1 and PAR2 c-tail peptides and peptide mimetics
09745347 · 2017-08-29
Assignee
Inventors
Cpc classification
C07K14/705
CHEMISTRY; METALLURGY
C07K14/723
CHEMISTRY; METALLURGY
A61K38/177
HUMAN NECESSITIES
International classification
C07K14/705
CHEMISTRY; METALLURGY
Abstract
The present invention concerns isolated PAR1 cytoplasmic tail (c-tail) peptides and isolated PAR2 cytoplasmic tail (c-tail) peptides, as well as compositions comprising these peptides, uses thereof and methods of treating various diseases, in particular cancer.
Claims
1. A method of inhibiting protease-activated receptor 2 (PAR2) mediated signal transduction comprising administering a peptide of 8 to 25 amino acids in length comprising the amino acid sequence SHDFRDHA (SEQ ID NO: 2) that is capable of selectively inhibiting the binding of PAR2 and a PH-domain containing protein.
2. A method of treating cancer comprising administering a therapeutically effective amount of a peptide of 8 to 25 amino acids in length comprising the amino acid sequence SHDFRDHA (SEQ ID NO: 2) that is capable of selectively inhibiting the binding of protease-activated receptor 2 (PAR2) and a PH-domain containing protein, or a pharmaceutical composition comprising said peptide to a patient in need thereof.
3. A method according to claim 2 further comprising administering an additional therapeutic agent.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) In order to understand the invention and to see how it may be carried out in practice, embodiments will now be described, by way of non-limiting example only, with reference to the accompanying drawings, in which:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
DETAILED DESCRIPTION OF EMBODIMENTS
(24) The present invention concerns isolated PAR1 cytoplasmic tail (c-tail) peptides and isolated PAR2 cytoplasmic tail (c-tail) peptides, as well as compositions comprising these peptides, uses thereof and methods of treating various diseases, in particular cancer.
(25) The inventors of the present invention identified regions in the cytoplasmic portion of PAR1 and PAR2 that are responsible for signal transduction, specifically, regions which are responsible for the interaction with PH-domain containing proteins. The inventors also demonstrated that abrogation of the association between the cytoplasmic portion of PAR1 and PH-domain containing proteins (e.g. Etk) resulted in a reduction in PAR1 induced oncogenic activity, and that peptides of the invention effectively penetrate cells and interfere in the association between PAR1 and Etk.
(26) Accordingly, the present invention includes peptides, pharmaceutical compositions and methods for alleviating pathological conditions which are mediated by or associated with PAR1 or PAR2 cellular pathways. In one embodiment the invention concerns peptides, pharmaceutical compositions and methods for treating cancer. Accordingly, a human or animal with cancer is administered with a pharmaceutical composition comprising an isolated peptide comprising an amino acid sequence of the PAR1 or PAR2 cytoplasmic tail, or a fragment or modification thereof, wherein the isolated peptide interferes with the binding reaction between PAR1 or PAR2 and a PH domain containing protein. The peptides may be administered alone or in combination with other therapeutic agents for the amelioration and/or treatment of cancer. The other therapeutic agents can be anti-angiogenic agents, anti-proliferative agents, growth inhibitory agents (e.g. chemotherapeutic agents).
(27) As used herein, “isolated” or “purified” when used in reference to a peptide means that the peptide has been removed from its normal physiological environment (e.g. the peptide is present as such and not in the context of the complete protein, and not in its natural compartment, namely the peptide is isolated from the cell), or is synthesized in a non-natural environment (e.g. artificially synthesized in a heterologous system).
(28) As used herein the term “PAR1” refers to protease-activated receptor 1. As used herein the term “PAR2” refers to protease-activated receptor 2. PAR1 and PAR2 have an amino-terminal exodomain and a carboxy-terminal cytoplasmic or endodomain.
(29) The terms “PAR1 cytoplasmic tail” or “PAR2 cytoplasmic tail” (also referred to as “c-tail”, “cytoplasmic portion” or “cytoplasmic domain”) refer to the C-terminus (carboxy-terminus) of the PAR1 or PAR2 protein which is present within the cell cytoplasm and contains the signal binding region for downstream cellular signaling, as represented for example by SEQ ID NO:33.
(30) As used herein the terms “PAR1 cytoplasmic tail (c-tail) peptide” or “PAR2 cytoplasmic tail (c-tail) peptide” refer to peptides having amino acid sequence that corresponds to portions of the cytoplasmic tail of PAR1 or PAR2, respectively.
(31) As used herein the term “fragment or modification” with respect to the peptides of the invention refers to any variants or derivatives of these peptides.
(32) The term “PH-domain containing protein” refers to proteins which include the pleckstrin homology (PH) domain. Proteins which are involved in signal transduction consist of several modular domains. These modules can confer catalytic or structural functions or mediate protein-protein interactions. One of these module domains is the pleckstrin homology (PH) domain which is identified as a 100 to 120 amino acid stretch in more than 250 human proteins (Rebecchi, M. J. and Scarlata, S. Annu Rev Biophys Biomol Struct, 1998. 27: p. 503-28). Although the amino acid sequence of PH domains is not universally conserved, the tertiary structure is remarkably conserved. PH-domain containing proteins can be identified using various available proteomic databases, e.g. the ExPASy proteomics server. Non-limiting examples of PH-domain containing proteins are Etk/Bmx, Akt/PKB, Vav, SOS 1 and GAB 1.
(33) The epithelial tyrosine kinase (Etk), also known as Bmx, is a non-receptor tyrosine kinase that is unique by virtue of being able to interact with both tyrosine kinase receptors and GPCRs. This type of interaction is mainly attributed to the pleckstrin homology (PH) which is followed by the Src homology SH3 and SH2 domains and a tyrosine kinase site.
(34) Akt, also known as PKB, is a serine/threonine protein kinase that plays a pivotal role in multiple cellular processes and ubiquitously expressed in a wide spectrum of cell types.
(35) The Vav.sub.3 oncogene, a guanine nucleotide exchange factor (GEF) for the Rho family GTPases, belongs to the Vav family proteins. The three mammalian proteins (Vav.sub.1, Vav.sub.2 and Vav.sub.3) exhibit different tissue distribution. While Vav.sub.1 is primarily expressed in hematopoeitic cells, Vav.sub.2 and Vav.sub.3 are more ubiquitously expressed. Vav.sub.3 has been shown to be over-expressed in human prostate cancer as well as breast cancer.
(36) The term “interfere in the binding reaction between PAR1 and a PH-domain containing protein” (e.g. with Etk/Bmx) refers to a reduction or elimination of the association between PAR1 and a downstream signaling PH-domain containing protein. Such an association is usually induced upon activation of PAR1. Similarly, the term “interfere in the binding reaction between PAR2 and a PH-domain containing protein” (e.g. with Etk/Bmx) refers to a reduction or elimination of the association between PAR2 and a downstream signaling PH-domain containing protein. Such an association is usually induced upon activation of PAR2. The ability of an agent to interfere in these binding reactions can be determined by methods known in the art. Some of these methods are exemplified in the Examples provided below.
(37) The terms “pathological condition” or “disease” are commonly recognized in the art and designate the presence of at least one sign and/or symptom in a subject or a patient that are generally recognized as abnormal. Pathological conditions or diseases may be diagnosed and categorized based on pathological changes. Signs may include any objective evidence of a disease such as changes that are evident by physical examination of a patient or the results of diagnostic tests that may include, among others, laboratory tests. Symptoms are subjective evidence of disease or a patient condition, e.g. the patient's perception of an abnormal condition that differs from normal function, sensation, or appearance, which may include, without limitations, physical disabilities, morbidity, pain and other changes from the normal condition experienced by a subject.
(38) Pathological conditions or diseases which are mediated by or associated with PAR1 or PAR2 cellular pathways include but are not limited to, cancer, acute and chronic inflammatory diseases, for example inflammatory diseases of the joints (e.g. arthritis), lungs (e.g. respiratory tract disorders such as pulmonary fibrosis, asthma and chronic obstructive pulmonary disease), brain, gastrointestinal tract (e.g. inflammatory bowel disease, such as colitis) and vascular systems (including cardiovascular diseases, e.g. thrombosis and restenosis), as well as inflammation associated with tissue response to injury. Also included are wound healing and pain, as well as allergies such as allergic contact dermatitis, atopic dermatitis and pruritus.
(39) As used herein the term “Cancer” refers to any type of malignant proliferative disease and is used as commonly known in the art. In particular, the present invention concerns cancer types which are associated with PAR1 and/or PAR2 signal transduction and which can benefit from interfering with PAR1 and/or PAR2 signal transduction. Non limiting examples include breast cancer, ovary cancer, lung cancer, colon cancer, prostate cancer and melanoma.
(40) The term “treating” refers to a reduction or elimination of at least one sign and/or symptom of a specific disease or condition. The term also encompasses prevention or attenuation of disease progression.
(41) The term “agent” or “therapeutic agent” as used herein refers to a chemical entity or a biological product, or combination of chemical entities or biological products, which are used to treat, prevent or control a disease or a pathological condition.
(42) As used herein, the term “therapeutically effective” includes both pharmacological effectiveness and physiological safety. Pharmacological effectiveness refers to the ability of the treatment to result in a desired biological effect in the patient. Physiological safety refers to the level of toxicity, or other adverse physiological effects at the cellular, organ and/or organism level (often referred to as side-effects) resulting from administration of the treatment.
(43) Thus, in connection with the administration of an agent or a pharmaceutical composition, an agent or a pharmaceutical composition which are “effective against” a disease or pathological condition indicates that administration in a clinically appropriate manner results in a beneficial effect for at least a statistically significant fraction of patients, such as an improvement of symptoms, a cure, a reduction in disease signs or symptoms, extension of life, improvement in quality of life, or other effect generally recognized as positive by medical doctors familiar with treating the particular type of disease or condition.
(44) The term “therapeutically effective amount” refers to a dosage or amount that is sufficient to reduce, halt, or slow disease progression to result in alleviation, lessening or amelioration of symptoms in a patient or to achieve a desired biological outcome, e.g. slow or stop tumor growth or reduction or disappearance of a tumor.
(45) As used herein the term “patient” relates to a subject suffering from or suspected of suffering from a specific disease or pathological condition or presents with at least one sign of a specific disease or pathological condition. Preferably, the subject is a human subject.
(46) “Pharmaceutically acceptable carriers or diluents” also referred to as pharmaceutically acceptable excipients or vehicles refer to a pharmaceutically acceptable material, composition or vehicle, suitable for administering compounds of the present invention to mammals, specifically to humans. These include for example, water, saline, glycerol, ethanol etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, buffers, preservatives, anti-oxidants, surfactants, and the like, may be present in such carriers or diluents.
(47) Examples of suitable “buffers” include Tris, Hepes, triethanolamine, histidine, or any others known in the art.
(48) “Preservatives” can act to prevent bacteria, viruses, and fungi from proliferating in the pharmaceutical composition or formulation, and anti-oxidants can function to preserve the stability. Examples include octadecyldimethylbenzyl, ammonium chloride, hexamethonium chloride, benzalkonium chloride, and benzethonium chloride. Other types of compounds include aromatic alcohols such as phenol and benzyl alcohol, alkyl parabens such as methyl or propyl paraben, and m-cresol.
(49) A “surfactant” can act to decrease turbidity or denaturation of a protein or a peptide in a pharmaceutical composition or formulation. Examples of surfactants include non-ionic surfactant such as a polysorbate, e.g. polysorbates 20, 60, or 80, a poloxamer, e.g. poloxamer 184 or 188, Pluronic polyols, ethylene/propylene block polymers or any others known in the art.
(50) The peptides of the invention or the pharmaceutical compositions of the invention may be used in combination with other therapeutic agents. “Use in combination” as used herein refers to the administration with at least one other therapeutic agent, either at the same time, in the same composition, at alternating times (prior to or subsequent to), in separate compositions, or combinations thereof.
(51) The inventors have identified PAR1 and PAR2 C-tail as a scaffold site for the interaction with signaling partners. In addition to identifying key partners, the hierarchy of binding was determined and a specific region in PAR1 C-tail was identified as critical for breast cancer signaling. Specifically, Etk/Bmx and Shc were found to form a physical complex with PAR1 C-tail. Etk/Bmx was shown to bind to PAR1-C-tail via its PH domain enabling the subsequent association of Shc. The physiological significance of PAR1-Etk/Bmx binding is emphasized by inhibition of Matrigel invasion and appearance of nearly intact acini morphogenesis of cell architecture when this site is mutated to abrogate the binding of Etk/Bmx. The use of consecutive A residues inserted into the proposed Etk/Bmx binding region of PAR1 C-tail (e.g., hPar1-7A) abolished PAR1-induced pro-oncogenic properties. Thus, by preventing the binding of a key signaling partner to PAR1 C-tail, efficient inhibition of PAR1-induced tumor-associated functions, including loss of epithelial cell polarity, migration and invasion through basement membranes, is obtained.
(52) The inventors also identified an amino acid sequence at the C-tail of PAR2 which is responsible for the interaction with Etk/Bmx as well as additional PH-domain containing proteins.
(53) In one of its aspects, the present invention thus provides isolated peptides corresponding to the PAR1 cytoplasmic tail or any fragment thereof, more specifically peptides corresponding to the “signal-binding” region in the cytoplasmic tail. The PAR1-Etk/Bmx binding motif sequence was found to be: NH2-CQRYVYS-COOH. Therefore, in one embodiment the present invention provides a peptide comprising the amino acid sequence CQRYVYS (SEQ ID NO: 1) or any fragment or modification thereof that maintains the ability to interfere in the binding reaction between PAR1 and Etk/Bmx.
(54) In one embodiment, the present invention provides a peptide having 7 or more, 8 or more, 9 or more, 10 or more, 11 or more, 12 or more, 13 or more, 14 or more, 15 or more, 16 or more, 17 or more, 18 or more, 19 or more, 20 or more, 21 or more, 22 or more, 23 or more, 24 or more, and 25 or more amino acids comprising the amino acid sequence CQRYVYS or any fragment or modification thereof.
(55) In one embodiment, the present invention provides a peptide having between about 7 and about 25 amino acids comprising the amino acid sequence CQRYVYS or any fragment or modification thereof.
(56) In one embodiment said peptide is 12 amino acids long. In a specific embodiment said peptide consists of the sequence NH2-SSECQRYVYSIL-COOH (SEQ ID NO: 3), or any fragment or modification thereof that maintains the ability to interfere in the binding reaction between PAR1 and Etk/Bmx. In another embodiment said peptide is 15 amino acids long. In a specific embodiment said peptide consists of the sequence NH2-SSECQRYVYSILCCK-COOH (SEQ ID NO: 4) or any fragment or modification thereof that maintains the ability to interfere in the binding reaction between PAR1 and Etk/Bmx.
(57) Without wishing to be bound by theory, longer peptides (i.e. peptides longer than 7 amino acids, or longer than 8 amino acids, or longer than 9 amino acids, or longer than 10 amino acids, or longer than 11 amino acids) may have preferable characteristics such as better solubility or stability as compared with shorter peptides (e.g. peptides having 7 amino acids or 8 amino acids).
(58) In another of its aspects, the present invention provides isolated peptides corresponding to the PAR2 cytoplasmic-tail, or any fragment thereof, more specifically peptides corresponding to the “signal-binding” region in the cytoplasmic tail. The PAR2-Etk/Bmx binding motif sequence was found to be: NH2-SHDFRDHA-COOH. In one embodiment the present invention provides a peptide having 8 or more, 9 or more, 10 or more, 11 or more, 12 or more, 13 or more, 14 or more, 15 or more, 16 or more, 17 or more, 18 or more, 19 or more, 20 or more, 21 or more, 22 or more, 23 or more, 24 or more, and 25 or more amino acids comprising the amino acid sequence SHDFRDHA or any fragment or modification thereof that maintains the ability to interfere in the binding reaction between PAR2 and Etk/Bmx.
(59) In one embodiment, the present invention provides a peptide having between about 8 and about 25 amino acids comprising the amino acid sequence SHDFRDHA (SEQ ID NO: 2) or any fragment or modification thereof.
(60) In one embodiment said peptide is 15 amino acids long.
(61) Preferably, the peptides of the invention are designed so as to penetrate cell membranes. In certain embodiments, cell penetrating moieties or membrane tethering moieties may be attached to the peptides of the invention in order to allow cell membrane penetration. Cell penetrating moiety is a compound which mediates transfer of a substance from an extracellular space to an intracellular compartment of a cell. Cell penetrating moieties shuttle a linked substance into the cytoplasm or the cytoplasmic space of the cell membrane. Membrane tethering moieties are compounds which associate or bind to a cell membrane. Thus the membrane tethering moiety brings the substance to which the membrane-tethering moiety is attached in close proximity to the membrane of a target cell. For example, cell penetrating moieties or membrane tethering moieties may be hydrophobic moieties. A cell penetrating moiety and a membrane tethering moiety includes, but is not limited to, a lipid, cholesterol, phospholipids, steroid, or a fatty acid moiety. Cell penetrating moieties may also be Cell Penetrating Peptides (CPP) such as Tat (trans-activating transcriptional activator from HIV-1) or Penetratin™ (Penetratin™ 1 is a 16-amino acid peptide corresponding to the third helix of the homeodomain of Antennapedia protein), or small molecule synthetic analogues of CPP. The cell penetrating moiety or membrane tethering moiety is attached to the C-terminal amino acid, the N-terminal amino acid, or to an amino acid between the N-terminal and C-terminal amino acid of the peptide of the invention.
(62) The peptides of the invention may also be modified in manners which increase their solubility, stability or half-life in the body (e.g. modifications which reduce proteolytic degradation of the peptide upon administration to the patient, or reduce the clearance from the blood). These modifications include, but are not limited to association with stabilizing molecules, e.g. pegylation, encapsulation (for example in lyposomes) using methods well known in the art.
(63) The present invention also encompasses peptidomimetics, i.e. any peptides or other types of agents which mimic the activity of the peptides of the invention. The present invention is therefore contemplated to include any variants, derivatives, fragments or modifications of the peptides of the invention. These variants, derivatives, fragments or modifications maintain the activity of the original peptide. In certain embodiments, the variants, derivatives, fragments or modifications of the peptides of the invention are active in vivo or in vitro in interfering in the binding reaction between PAR1 or PAR2 and a PH-domain containing protein, e.g. Etk/Bmx.
(64) In certain embodiments the variants, derivatives, fragments or modifications are biologically active and have at least about 80% amino acid sequence identity, more preferably at least about 90% sequence identity, and even more preferably, at least 95%, 96%, 97%, 98%, or 99% sequence identity with any one of the above recited PAR1 or PAR2 c-tail peptides.
(65) “Percent (%) amino acid sequence identity” with respect to the sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the PAR1 or PAR2 c-tail peptides sequences, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for the purposes of determining percent amino acid sequence identity can be achieved in various ways that are well known in the art.
(66) Accordingly, various modifications may be made in the peptides of the invention. Mutations may be inserted in the identified binding region by site-directed mutagenesis e.g. by using QuickChange kit (Stratagene, La Jolla, Calif.). The binding capabilities of naïve wt protein can then be compared with proteins comprising the mutated domain.
(67) For example, an alanine scan can be used to identify the residues that are critical for PAR1 “signal binding”. Different peptides are produced each having an alanine residue in a different position, for example as follows:
(68) TABLE-US-00001 (SEQ ID NO: 5) NH2-SSECQRYVYSILCCA-COOH (SEQ ID NO: 6) NH2-SSECQRYVYSILCAK-COOH (SEQ ID NO: 7) NH2-SSECQRYVYSILACK-COOH (SEQ ID NO: 8) NH2-SSECQRYVYSIACCK-COOH (SEQ ID NO: 9) NH2-SSECQRYVYSALCCK-COOH (SEQ ID NO: 10) NH2-SSECQRYVYAILCCK-COOH (SEQ ID NO: 11) NH2-SSECQRYVASILCCK-COOH (SEQ ID NO: 12) NH2-SSECQRYAYSILCCK-COOH (SEQ ID NO: 13) NH2-SSECQRAVYSILCCK-COOH (SEQ ID NO: 14) NH2-SSECQAYVYSILCCK-COOH (SEQ ID NO: 15) NH2-SSECARYVYSILCCK-COOH (SEQ ID NO: 16) NH2-SSEAQRYVYSILCCK-COOH (SEQ ID NO: 17) NH2-SSACQRYVYSILCCK-COOH (SEQ ID NO: 18) NH2-SAECQRYVYSILCCK-COOH (SEQ ID NO: 19) NH2-ASECQRYVYSILCCK-COOH
(69) Next, in order to improve the peptide inhibitory activity the non-essential residues identified in the ala scan can be replaced with other amino acid residues, optionally by non-natural amino acids.
(70) The following are non-limiting examples of mutations that may be inserted in PAR2: wt C-tail-SHDFRDHAZ (SEQ ID NO:20); mutated forms of PAR2 C-tail-SAAARDHAZ (SEQ ID NO:21); or SHDFAAAAZ (SEQ ID NO:22). For these exemplary mutations the following primers may be used:
(71) TABLE-US-00002 Primer1: (SEQ ID NO: 23) F-cccctttgtctattactttgtttcagctgctgccagggatcatg; (SEQ ID NO: 24) R-gcatgatccctggc agcagctgaa acaaagtaa tagacaaagggg; Primer2: (SEQ ID NO: 25) F-cacatgatttcgcggctgc tgcaaagaacgctc tcctttgccg; (SEQ ID NO: 26) R-cggcaaag gagagcgttctttgcagca gccgcgaaatcatgtg;
(72) Chemical modifications can also be made in the peptides. For example, relevant amino acids (e.g., leucine, isoleucine) may be modified to include alternative side chains, non-limiting examples of such side chains include: ethyl, n-butyl, —CH.sub.2CH.sub.2OH, —CH.sub.2CH.sub.2CH.sub.2OH, —CH.sub.2CHOHCH.sub.3 and —CH.sub.2SCH.sub.3. Tyrosine amino acid can be modified by having substituted benzyl or phenyl side chains. Preferred substituents include one or more of the following: halogen, methyl, ethyl, nitro, methoxy, ethoxy and —CN.
(73) Glutamic acid may be modified to substituted or unsubstituted aliphatic, aromatic or benzylic ester of glutamic acid (e.g., methyl, ethyl, n-propyl iso-propyl, cyclohexyl, benzyl or substituted benzyl), glutamine, CO—NH-alkylated glutamine or asparagine (e.g., methyl, ethyl, n-propyl and iso-propyl) and modified amino acids having the side chain —(CH.sub.2).sub.3COOH, an ester thereof (substituted or unsubstituted aliphatic, aromatic or benzylic ester), an amide thereof and a substituted or unsubstituted N-alkylated amide thereof.
(74) For lysine or arginine amino acids modification will be carried out by 1 to about 3 additional methylene units in the side chain.
(75) The amino acids serine and cysteine may be modified having C.sub.1-C.sub.5 straight or branched alkyl side chains substituted with —OH or —SH.
(76) The term “chemical modification” as used herein includes modification at the side chain of the amino acid residue, as well as modification of the peptidic bond. Accordingly, a functional group may be added to the side chain, deleted from the side chain or exchanged with another functional group. Typically, the modifications are conservative modifications resulting in conservative substitution. Examples of conservative modifications of this type include adding an amine or hydroxyl, carboxylic acid to the aliphatic side chain of valine, leucine or isoleucine, exchanging the carboxylic acid in the side chain of aspartic acid or glutamic acid with an amine or deleting the amine group in the side chain of lysine or ornithine. Other chemical modifications known in the art include arboxymethylation, acylation, phosphorylation, glycosylation or fatty acylation, and others.
(77) The “chemical modification” also includes alteration of a bond within the peptidic backbone, i.e. that the bond between the N— of one amino acid residue to the C— of the next has been altered to non-naturally occurring bonds by reduction (to —CH.sub.2—NH), alkylation (methylation) on the nitrogen atom, or the bonds have been replaced by amidic bond, urea bonds, or sulfonamide bond, etheric bond (—CH.sub.2—O—), thioetheric bond (—CH.sub.2—S—), or to —C—S—NH—; The side chain of the residue may be shifted to the backbone nitrogen to obtain N-alkylated-Gly (a peptidoid). Modification also includes cyclization of the amino acid molecule, e.g. by forming S—S bonds. S—S bonds may be formed via the inclusion of sulphor-containing amino acid residues, such as cysteine at each terminus of the amino acid molecule. Cyclic peptides have been shown to be more stable and with higher biological activity than the corresponding linear molecule (Jining L. et al. Eur. J. Biochem 271:2873-2886 (2004)).
(78) The peptides of the invention may be provided in a soluble or a lyophilized (dry) form.
(79) The peptides of the invention can be prepared by automated peptide synthesis methodologies well known in the art.
(80) Alternatively the PAR1 or PAR2 c-tail peptides of the invention may be isolated from the complete PAR1 or PAR2 protein, respectively, preferably, the human PAR1 or PAR2 protein. Isolation from the complete PAR1 or PAR2 protein can be effected, for example, by proteolysis of PAR1 or PAR2 by proteases such as thrombin, plasmin, activated protein C, or metalloprotease-1.
(81) Alternatively, the PAR1 or PAR2 c-tail peptides of the invention may be produced recombinantly using methods well known in the art.
(82) In another aspect, the present invention provides a method of inhibiting PAR1 mediated signal transduction comprising administering an agent capable of selectively inhibiting the binding of PAR1 and a PH-domain containing protein, e.g. Etk/Bmx, vav3 or Akt.
(83) In another aspect, the present invention provides a method of treating a disease comprising administering a therapeutically effective amount of an agent capable of selectively inhibiting the binding of PAR1 and a PH-domain containing protein, or a pharmaceutical composition comprising said agent.
(84) In a specific embodiment the PH-domain containing protein is Etk/Bmx.
(85) In other embodiments the PH-domain containing protein is vav3 or Akt.
(86) The invention is not limiting with respect to the type of agent that inhibits or interferes with the binding between PAR1 and the PH-domain containing protein. The agent may be, but is not limited to, a peptide, a peptidomimetic molecule, a polypeptide, or a small molecule (e.g. a chemical compound). In a specific embodiment the agent is a peptide.
(87) The invention further provides a method of treating a disease comprising administering a therapeutically effective amount of a peptide, or a pharmaceutical composition comprising the peptide, to a patient in need thereof, wherein the peptide is selected from the group consisting of: (a) An isolated PAR1 c-tail peptide comprising the amino acid sequence CQRYVYS (SEQ ID NO: 1); (b) an isolated PAR1 c-tail peptide consisting of the sequence SSECQRYVYSIL (SEQ ID NO: 3); (c) An isolated PAR1 c-tail peptide consisting of the amino acid sequence SSECQRYVYSILCCK (SEQ ID NO: 4); and any fragment or modification of the peptides of (a) (b) or (c).
(88) PAR1 has been shown to play a central role in the invasive and metastatic cancers of breast, ovaries, lung, colon, prostate and melanoma. Therefore, in a specific embodiment the invention is directed to a method of treating cancer.
(89) In certain embodiments the cancer is selected from the group consisting of breast cancer, ovary cancer, lung cancer, colon cancer, prostate cancer and melanoma.
(90) In another aspect, the present invention provides a method of inhibiting PAR2 mediated signal transduction comprising administering an agent capable of selectively inhibiting the binding of PAR2 and a PH-domain containing protein, e.g. Etk/Bmx, vav3 or Akt.
(91) In another aspect, the present invention provides a method of treating a disease comprising administering a therapeutically effective amount of an agent capable of selectively inhibiting the binding of PAR2 and a PH-domain containing protein, or a pharmaceutical composition comprising said agent.
(92) In a specific embodiment the PH-domain containing protein is Etk/Bmx.
(93) In other embodiments the PH-domain containing protein is vav3 or Akt.
(94) The invention is not limiting with respect to the type of agent that inhibits or interferes with the binding between PAR2 and the PH-domain containing protein. The agent may be, but is not limited to, a peptide, a peptidomimetic molecule, a polypeptide, or a small molecule (e.g. a chemical compound). In a specific embodiment the agent is a peptide.
(95) The invention further provides a method of treating a disease comprising administering a therapeutically effective amount of a peptide, or a pharmaceutical composition comprising the peptide to a patient in need thereof, wherein the peptide is selected from the group consisting of: (a) An isolated PAR2 c-tail peptide comprising the amino acid sequence SHDFRDHA (SEQ ID NO: 2); and (b) any fragment or modification of the peptide of (a).
(96) In a specific embodiment the invention is directed to a method of treating cancer.
(97) In certain embodiments the cancer is selected from the group consisting of breast cancer, ovary cancer, lung cancer, colon cancer, prostate cancer and melanoma.
(98) In another embodiment, the present invention provides a pharmaceutical composition comprising a peptide of the invention together with a pharmaceutically acceptable carrier or diluents.
(99) In another embodiment, the present invention provides use of a peptide of the invention in the preparation of a pharmaceutical composition.
(100) In certain embodiments said pharmaceutical composition is for the treatment of cancer.
(101) In one embodiment the present invention provides a combination of PAR1 c-tail peptides and PAR2 c-tail peptides of the invention. This combination of peptides may be used as a therapeutic agent for the treatment of cancer.
(102) Any of the peptides, pharmaceutical compositions or methods of the invention may used in combination with additional therapeutic agents, e.g. for the treatment of cancer.
Example 1
(103) Materials and Methods
(104) Cell Culture:
(105) MCF7 and MDA-MB-435 human breast carcinoma, CT-26 mouse colon carcinoma, HEK-293 cells and the African green monkey kidney fibroblast cell line COS1 (obtained from the ATCC, VA, USA) were maintained in DMEM with 10% fetal calf serum. Stable clonal cell lines over-expressing wt hPar1, Y397Z hPar1, truncated hPar1 and Y/A mutants; Y.sub.381A&.sub.383A hPar1 or the wt-Etk and Etk-KQ were selected for G418 resistance (800 μg/ml).
(106) Plasmids and Transfection:
(107) MCF7 cells were transfected with 1-2 μg of either wt human hPar1 or truncated hPar1 or Y397Z hPar1 cDNA, or with a control pcDNA3 vector (Invitrogen, Carlsbad, Calif.) using FuGene transfection reagent (Roche Molecular Biochemicals, Indianapolis, Ind.). Transfected cells were selected with G418 (800 μg/ml) to obtain stable populations of cells expressing hPar1 and the variants. Etk/Bmx plasmids (e.g., wt, kinase-dead, KQ and GST-PH-Etk/Bmx) (Tsai Y T, et al. (2000) Mol Cell Biol. 20:2043-2054.) were transfected into HEK-293 cells using the same protocol as previously described.
(108) RNA Isolation and RT-PCR.
(109) RNA was isolated with Tri-Reagent (MRC, Cincinnati, Ohio) according to the manufacturer's instructions. After reverse transcription of 1 μg total RNA by oligo (dT) priming, cDNA was amplified using Taq DNA polymerase (Promega, Madison, Wis.). Comparative semi-quantitative PCR was performed using the following primers: GAPDH sense: 5′-CCA CCC ATG GCA AAT TCC ATG GC-3′ (SEQ ID NO: 27) and antisense: 5′-TCT AGA CGG CAG GTC AGG TCC ACC-3′ (SEQ ID NO: 28) primers. PAR.sub.1 N-terminus primers were as follows: hPar1-sense: 5′-CTCGTCCTCAAGGAGCAAAC-3′ (SEQ ID NO: 29), antisense orientation: 5′-TGGGATCGGAACTTTCTTTG-3′ (SEQ ID NO: 30) (resulting in a 564-bp PCR product). PAR.sub.1 C-tail primers-sense: 5′-TAC TAT TAC GCT GGA TCC TCT GAG-3′ (SEQ ID NO: 31) and antisense: 5′-CTT GAA TTC CTA AGT TAA CAGCTT-3′ (SEQ ID NO: 32). These primers give rise to a 181-bp product corresponding to the entire PAR.sub.1 C-tail site, as follows:
(110) TABLE-US-00003 (SEQ ID NO: 33) YYYASSECQRYVYSILCCKESSDPSYNSSGQLMASKMDTCSSNLNNSI YKKLLT.
(111) Animal Studies: Mammary Gland Model.
(112) Female athymic nude mice at 6-8 weeks of age were pre-implanted subcutaneously with pellets containing 1.7 mg β-estradiol (60-day release, Innovative Research of America, Sarasota, Fla.). Mouse mammary fat pads were then injected with 1×10.sup.7 MCF-7 cells stably transfected with hPar1 wt and mutant constructs (e.g., Y397Z and truncated) or pcDNA3 control plasmid. Mice were monitored for tumor size by external caliber measurements (length and width) on days 10, 22, 25, 29, 33, 36 and 45. Tumor volume (V) was calculated by V=L×W2×0.5, where L is length and W is width. On day 45, mice were sacrificed and tumors were removed, weighed and fixed in formalin for histology. All animal experiments were approved by the animal committee of the Hebrew University, Jerusalem, Israel (MD-107.05-4).
(113) Liver Metastasis Model:
(114) CT-26 mouse colon carcinoma cells were stably transfected with either wt hPar1 or hPar1-Y.sub.381A constructs. The activation of PAR.sub.1 (using the peptide SFLLRN) was performed prior to injection into the mice. CB6F1 mice were anesthetized (75 mg/kg ketamine+3 mg/kg xylazine, i.p.), and the spleen was exteriorized through an incision (1.0 cm) on the left side of the mouse. CT-26 cells (10.sup.4 cells/mouse) transfected with the different constructs (e.g., hPar1, hPar1 Y381A, mock-transfected vector) were injected into the spleen using a 30-gauge needle. The cell suspension was allowed to enter the portal circulation over a short period (5 minutes), after which the spleen was removed, as previously described (Kuruppu D, et al (2002) J Surg Res. 103:47-54.). The wound was sutured and the animal was allowed to recover. MRI images were monitored every 2-3 days on a 4.7T Bruker Biospec spectrometer using a bird-cage coil. Tumor assessment was made by serial coronal and axial T.sub.2W fast SE images (TR/TE=2000/40 ms). All experiments were performed in accordance with the guidelines of the Animal Care and Use Committee of the Hebrew University, Jerusalem, Israel (MD-107.05-4).
(115) PAR.sub.1 Activation:
(116) PAR.sub.1 was activated by the SFLLRN(H-Ser-Phe-Leu-Leu-Arg-Asn-NH.sub.2) peptide (SEQ ID NO: 34), the TFLLRNPNDK peptide (SEQ ID NO: 35), a selective PAR.sub.1 agonist, or thrombin (1 U/ml).
(117) Histology:
(118) Tissue samples derived from the primary tumors were fixed with 4% formaldehyde in PBS, embedded in paraffin and sectioned (5-μm sections). After de-paraffinization and re hydration, sections were stained with hematoxylin and eosin (H&E) or subjected to immunohistochemistry using specific antibodies.
(119) Histological Evaluation and Scoring:
(120) The combined histological results were assessed and scored as previously described (Groeger A M, et al. (2004) Histopathology 44:54-63). The measurements per slide section were carried out using anatomical compartments, using an ocular micrometer (WHIOX2, Olympus, N.J., USA). Slides review was independently performed by two investigators (BM and RB). Discrepancies were resolved by simultaneous re-examination of the slides by both investigators using a double-headed microscope. The microscope was calibrated with a micrometer slide before each measurement. All measurements were performed on the monitor screen using a ×40 objective. On examining the sections for selection of fields tumor cells from the most cellular area at the center of the tumor were selected. Necrotic and inflammatory area were avoided. Eight microscopic fields were screened, 10 cells/field were selected and no less than 50 cells/tumor case were assessed. The positive rate of staining is expressed as a mean±SD per tumor histological subtype from selected cases.
(121) Immunohistochemistry.
(122) Sections were subjected to inactivation of endogenous peroxidase (3% H.sub.2O.sub.2 in DDW), antigen retrieval by microwave oven (3 min) in citrate buffer (0.01 M, pH 6.0), and blocking with 10% goat serum in PBS. Sections were then incubated with antibodies directed against Von-Willebrand factor (anti-factor VIII, DAKO, Carpinteria, Calif.), Ki-67 (Clone SP6, Lab Vision-NeoMarkers, Fremont, Calif.), or an endothelial cell-specific lectin (Bandeiraea simplicifolia BS-1 isolation), followed by incubation with horseradish peroxidase-conjugated anti-rabbit antibody (DAKO, Carpinteria, Calif.). Color was developed by incubation (10 min) with the Zymed AEC substrate kit (Zymed Laboratories, South San Francisco, Calif.), and counterstained with Mayer's hematoxylin.
(123) Preparation of hPar1 Constructs: Truncated hPar1, Y397Z hPar1, Y.sub.381A hPar1 and Y383A hPar1.
(124) Detection of hPar1 was carried out using primers: sense orientation: 5′-CTCGTCCTCAAGGAGCAAAC-3′ (SEQ ID NO: 29), antisense orientation: 5′-TGGGATCGGAACTTTCTTTG-3′ (SEQ ID NO: 30). For the PAR.sub.1-C-tail primers: sense orientation: 5′-TACTATTACGCTGGATCCTCTGAG-3′ (SEQ ID NO: 31), antisense: 5′-(SEQ ID NO: 33).
(125) Using polymerase chain reaction, a PAR-1 mutant protein truncated in its cytoplasmic tail after amino acid leucine 369 or at tyrosine 397 was constructed. Y397Z construct: PAR-1 cDNA served as a template for amplifying the fragment containing STOP codon using the followed primers: sense: 5′-ATA AGC ATT GAC CGG TTT CTG-3′ (SEQ ID NO: 36) and antisense: 5′-GCT CTA GAT TTT AAC TGC TGG GAT CGG AAC-3′ (SEQ ID NO: 37). Replacement of tyrosine residues at PAR.sub.1 cytoplasmic tail was achieved using specific primers containing the point mutation. Primer sequences were as follows: 381-sense: 5′-TGC CAG AGG GCT GTC TAC AGT ATC TTA TGC-3′ (SEQ ID NO: 38), 381-antisense: 5′-GAT ACT GTA GAC AGC CCT CTG GCA CTC AGA-3′ (SEQ ID NO: 39), 383-sense: 5′-GCC AGA GGT ACG TCG CAA GTA TCT TAT GCT GCA AA-3′ (SEQ ID NO: 40), 383-antisense: 5′-AAG ATA CTT GCG ACG TAC CTC TGG CAC TCA G-3′ (SEQ ID NO: 41). The amplified DNA fragment was digested with XbaI and HindIII from PAR.sub.1 cDNA and cloned into a pcDNA3 plasmid, followed by DNA sequencing. To confirm the functional integrity of the DNA constructs, wt and mutant cDNAs were transiently expressed in COS-1 cells that were subsequently subjected to FACS analysis with a PAR-1-specific antibody (WEDE15-PE, Immunotech, Cedex, France).
(126) HA-tag wt hPar1 and HA-mutant hPar1-7A C-tail Constructs.
(127) The mutants were designed for insertion of A at the carboxy terminus of PAR.sub.1 residues 378-384: SSECQRYVYSILCC (SEQ ID NO: 42) to SSEAAAAAAAILCC (named hPar1-7A mutant) (SEQ ID NO: 43). For HA-tag wt hPar1 construct PCR primers were designed and added downstream to the ATG start codon. Primers for the HA-tag are as follows: sense: 5′-TAC CCA TAC GAT GTT CCA GAT TAC GCT-3′ (SEQ ID NO: 44) and anti-sense: 5′-AGC GTA ATC TGG AAC ATC TA TGG GTA-3′ (SEQ ID NO: 45). Replacement of seven residues with Ala (A) at positions 378-384 was made by synthesis of oligos containing the mutation. Primer sequences were as follows: hPar1 7A mutant: sense: 5′-TCT GAG GCT GCT GCT GCT GCT GCA GCT ATC TTA-3′ (SEQ ID NO: 46) and anti-sense: 5′-TAA GAT AGC TGC AGC AGC AGC AGC AGC CTC AGA-3′ (SEQ ID NO: 47). PCR products were then used as primers on an hPar1 cDNA template to create an extended product of introduced mutations into the full-length sequence. The amplified DNA fragment was digested with PinAI and XbaI from PAR.sub.1 cDNA and cloned into pcDNA3-hPar1 plasmid followed by DNA sequencing.
(128) GST-C-tail Cloning.
(129) GST-C-tail of PAR.sub.1 fragment, containing 54 amino acids from serine 369 to residue 425, was prepared using RT-PCR (5′-TAC TAT TAC GCT GGA TCC TCT GAG-3′ (SEQ ID NO: 48) and 5′-CTG AAT TCC TAA GTT AAC AGC TT-3′ (SEQ ID NO: 49)). The resulting DNA fragment was further cut with the appropriate restriction enzymes (BamHI and EcoR1) and ligated into pGEX2T vector. The GST-C-tail was separated by SDS-PAGE, which indicated that the fusion protein of the C-tail was adequately prepared. The molecular weight of GST protein is 27 kD and the GST-C tail fusion protein is 32 kD. GST-Shc-SH2 and tandem SH2 were kindly provided by S. Katzav, Hubert H. Humphrey Center for Experimental Medicine and Cancer Research, Hebrew University-Hadassah Medical School, Jerusalem.
(130) GST Fusion Protein Columns.
(131) Fusion proteins were purified from transformed Escherichia coli bacteria that had been stimulated with isopropyl-β-D-thio-galactopyranoside (IPTG) at a concentration of 0.3 μM. Bacteria were lysed according to published procedures, and then immobilized on glutathione Sepharose beads (Pharmacia). Briefly, MDA-MB-435 cell lysates were applied to GST-PAR1 C-tail or GST control columns. After 2 h binding periods to the designated protein/s cell lysates to the columns, a washing step was performed. The washes (×3) were carried out using a “wash buffer” including: 100 mM NaCL, 20 mM EDTA, 10 mM Tris, pH 8.0 and 1% Triton ×100. This step was performed in order to wash out all non-specific proteins, leaving the GST-PAR.sub.1-C-tail column firmly bound to targeted cell lysate proteins. Next, elution of bound proteins was performed via the addition of gel “sample buffer” and appropriate boiling. The samples were run electrophoretically on SDS-PAGE gels, followed by immunoblotting with the indicated antibodies and ECL detection.
(132) GST-PH-Etk/Bmx.
(133) The PH domain in Etk/Bmx was bound to GST column as previously described (Chen R, et al. (2001) Nat Cell Biol. 3: 439-444).
(134) Purification of PAR.sub.1 C-tail Fragments.
(135) PAR.sub.1 C-tail fragments were generated using a “thrombin cleavage capture kit” (Novagen, Madison, Wis.; Cat no. 69022-3). The enzyme used for the cleavage was biotinylated human thrombin. Briefly, the cleavage was performed according to the manufacturer instructions. Biotinylated thrombin was removed from the cleavage reaction using streptavidin agarose beads, and the cleaved peptides (e.g., wt PAR.sub.1-C-tail and Y381A C-tail) were isolated and loaded on a GST-Etk-PH column. After incubation for 4 h the purified fragments were applied onto the GST-PH-Etk/Bmx column and detected following gel separation and western blotting analysis using anti-PAR.sub.1 antibodies (ATAP, Santa Cruz, Calif.).
(136) Flow Cytometry Analysis.
(137) To activate PAR.sub.1, thrombin (1 U/ml was added for 5 min. The cells were detached from the plates with 0.5 mM EDTA in 0.1 M sodium phosphate at pH 7.4 (Biological Industries), washed and re-suspended in PBS. The cells were analyzed by FACS after incubation for 60 min at 4° C. with 10 μg/ml anti-PAR.sub.1-wede-PE antibodies.
(138) Western Blot and Immunoprecipitation Analysis:
(139) Cells were activated with agonist peptide TFLLRNPNDK (SEQ ID NO: 35) for the indicated periods of time and solubilized in lysis buffer containing 10 mM Tris-HCl, pH 7.4, 150 mM NaCl, 1 mM EDTA, 1% TritonX-100, and protease inhibitors (5 mg/ml aprotinin, 1 mM phenylmethylsulfonylfluoride, and 10 mg/ml leupeptin) at 4° C. for 30 min. The cell lysates were subjected to centrifugation at 12,000 rpm at 4° C. for 20 min. We used 400 μg of the supernatants with anti-PAR.sub.1 (ATAP, Santa Cruz, Calif. 1 μg), anti-HA (anti-HA sc-7392; Santa Cruz, Calif.), anti-Shc or Etk/Bmx antibodies (10 μg/ml). After overnight incubation, Protein A-Sepharose beads (Amersham Pharmacia Biotech, Buckinghamshire, UK) were added to the suspension (50 μl), which was rotated at 4° C. for 1 h. The immunocomplexes were eluted and run electrophoretically on a 10% SDS-PAGE gel, followed by transfer to an Immobilon-P membrane (Millipore). Membranes were blocked and probed with 1 μg/ml amounts of the appropriate antibodies as follows: anti-PAR.sub.1 thrombin receptor mAb, (ATAP, from Santa Cruz, 1:1000); anti-Shc (BD, 1:2000); anti-Bmx (Transduction Laboratories, 1:1000) or anti-PY (Upstate 4G10, 1:2500), suspended in 3% BSA in 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, and 0.5% Tween-20. After washes the blots were incubated with secondary antibodies conjugated to horseradish-peroxidase. Immunoreactive bands were detected by enhanced chemiluminescence (ECL). Membranes were stripped and incubated with anti-IP antibodies to ensure equal protein load.
(140) Anti-PAR.sub.1 polyclonal antibodies were generated using two regions of the N-terminus portion R/SFFLRN by the synthetic peptides NH.sub.2-CLLRNPNDKYEPFWED-COOH (SEQ ID NO: 50) and NH.sub.2-KSSPLQKQLFAFISC-COOH (SEQ ID NO: 51).
(141) Antibody Array:
(142) A custom-made antibody array (hypromatrix) containing thirty antibodies against various proteins was prepared (
(143) Matrigel Invasion Assay:
(144) Blind-well chemotaxis chambers with 13-mm diameter filters were used for this assay. Polyvinylpyrrolidone-free polycarbonate filters, 8 mm pore size (Costar Scientific Co., Cambridge, Mass.), were coated with basement membrane Matrigel (25 μg/filter). Briefly, the Matrigel was diluted to the desired final concentration with cold distilled water, applied to the filters, and dried under a hood. Cells (2×10.sup.5) suspended in DMEM containing 0.1% bovine serum albumin were added to the upper chamber. Conditioned medium of 3T3 fibroblasts was applied as a chemo-attractant and placed in the lower compartment of the Boyden chamber. Cells were incubated for 18 h on filters at 37° C. in 5% CO.sub.2. At the end of the incubation, cells on the upper surface of the filter were removed by wiping with a cotton swab. The filters were fixed and stained with DifQuick System (Dade Behring Inc., Newark, N.J.). Ten fields were chosen from the lower surface of the filter and cells within each field were counted. The mean+/−SD of the ten fields was calculated for each filter. Each assay was performed in triplicate.
(145) MCF10A Morphogenesis Assay:
(146) MCF10A cells were maintained in DMEM/F12 medium with 20% donor horse serum. The cells for spheroid assay (DMEM/F12 supplemented with 2% donor horse serum, 10 μg/ml insulin, 1 ng/ml cholera-toxin, 100 lag/ml hydrocortisone, 50 U/ml penicillin and 50 μg/ml streptomycin) were resuspended at a concentration of 10.sup.5 cells per 4.0 ml. Eight-chambered RS glass slides (Nalgene) were coated with 35 μl Matrigel per well and left to solidify for 15 min. The cells were mixed 1:1 with assay medium containing 4% Matrigel and 10 ng/ml EGF, and 400 μl were added to each chamber of the Matrigel-coated eight-chambered slide. Assay medium containing SFLLRNPNDK PAR.sub.1 activation peptide (SEQ ID NO: 52) and 5 ng/ml EGF was replaced every 4 days. The images were taken between days 8-12. In the representative experiment shown images were taken on day 10. The media and supplements were replaced every 4 days and thus, the activating peptide was added fresh to the medium every 4 days.
Example 2
The Cytoplasmic Tail of PAR1 is Involved in Tumor Promotion Via Binding of Etk/Bmx
(147) PAR.sub.1-Enhanced Tumor Growth and Angiogenesis In Vivo is Abrogated in the Presence of a Truncated PAR.sub.1 Form.
(148) To investigate the role of PAR.sub.1 signaling in breast tumor growth and vascularization in vivo, wt hPar1 and deletion constructs [e.g., L369Z, which lacks the entire cytoplasmic tail, and Y397Z, which exhibits persistent signaling due to impaired internalization (Shapiro M J, et al (1996) J. Biol. Chem. 271: 32874-32880; Hammes S R, and Coughlin S R (1999) Biochemistry 38: 2486-2493)] (
(149) Proliferation levels were evaluated by immunostaining with Ki-67 and were 3 times higher in Y397Z hPar1 or wt hPar1 tumors (
(150) PAR.sub.1 C-Tail Binds the she Adaptor Protein.
(151) To identify proteins that associate with the PAR.sub.1 C-terminus and participate in the tumor signaling pathway, the cytoplasmic tail of hPar1 was fused to a GST protein and used as “bait” to specifically detect associated proteins. Lysates obtained from a highly metastatic breast carcinoma line (e.g., MDA-MB-435 cells) were assessed for binding to the GST-PAR.sub.1 C-tail column. After an adequate binding period of the designated cell lysates to the columns, a washing step was performed. This step was performed in order to wash out all non-specific proteins, leaving the GST-PAR.sub.1-C-tail column firmly bound to targeted cell lysate proteins. Next, specifically-bound proteins were eluted via the addition of gel “sample buffer” and detected by Western blot analysis using anti-Shc antibodies. Amino acid sequence analysis of proteins bound to the column repeatedly indicated the presence of the Shc adapter protein. Indeed, application of MDA-MB-435 cell lysates onto a GST PAR.sub.1 C-tail column or a GST control column showed the three Shc isoforms specifically bound to the GST-PAR.sub.1-C-tail column, but not to the GST control column (
(152) Y.sub.381A-hPar1 Exhibits High Metastatic Potential.
(153) The functionality of the Y.sub.381A hPar1 mutant was further demonstrated in vivo using a colorectal-liver metastasis model (Qiu Y, et al (1998) Proc Natl Acad Sci USA 95: 3644-3649), which provides a rapid metastatic model of liver foci formation. Mouse CT-26 colon carcinoma cells (that do not express endogenous hPar1) were genetically engineered to over-express wt hPar1, Y.sub.381A hPar1 or empty vector constructs. These over-expressing cells were injected intra-splenically into CB6F1 mice (either PAR.sub.1-activated or not) to generate liver metastases. Tumor growth kinetics and liver metastatic foci appearance were monitored twice a week by MRI. Both wt hPar1 and Y.sub.381A hPar1 enhanced liver metastatic foci formation, compared to control CT-26 cells. Furthermore, mice inoculated with cells expressing Y.sub.381A hPar1 showed especially extensive and rapid appearance of liver metastasis as compared to mice inoculated with cells over-expressing wt hPar1 (
(154) Antibody-Array for Protein-Protein Interactions Reveals Signaling Candidates.
(155) To detect the putative mediator(s) linking PAR1 to potential signaling proteins, custom-made antibody-array membranes were examined. Aggressive breast carcinoma MDA-MB-435 cells (with high hPar1 levels) were incubated with the antibody-array membranes before and after PAR.sub.1 activation (15 minutes). Several activation-dependent proteins which interact with PAR.sub.1 were identified, including ICAM, c-Yes, Shc and Etk/Bmx (
(156) Etk/Bmx-PAR1 interactions were characterized by binding lysates exhibiting various hPar1 forms to GST-Etk/Bmx. While Y397Z hPar1 and wt hPar1 showed specific association with Etk/Bmx, lysates of truncated hPar1 or JAR cells (lacking PAR.sub.1) exhibited no binding (
(157) Differential Expression of Etk/Bmx in Breast Biopsies
(158) PAR.sub.1 is known to be highly expressed in breast carcinoma specimens, but not in normal breast tissue. Immunohistochemical staining of PAR.sub.1 tissue sections confirms the earlier described RNA riboprobe analysis for hPar1. Invasive carcinoma specimens were selected from infiltrating ductal carcinoma (IDC) of high nuclear grade and with evidence of vascular invasion and lymph node metastases. Immunohistological analyses of both PAR.sub.1 and Etk/Bmx showed little staining in comedo DCIS and ductal carcinoma in situ, but high levels of staining in IDC and lobular carcinoma (
(159) The combined histological results are shown in Table 1. The results were assessed and scored as outlined in the Materials & Method section. The measurements per slide section were carried out using anatomical compartments, using an ocular micrometer (WHIOX2, Olympus, N.J., USA).
(160) The microscope was calibrated with a micrometer slide before each measurement. On examining the sections for selection of fields tumor cells from the most cellular area at the center of the tumor were selected. Necrotic and inflammatory areas were avoided. Eight microscopic fields were screened. Ten cells per each field were selected and no less than 50 cells/tumor case were assessed. The positive rate of staining is expressed as a mean±SD per tumor histological subtype from selected cases. Specific staining is observed in both PAR.sub.1 and Etk/Bmx, with particularly strong staining seen in IDC and lobular carcinoma. No staining is seen in the normal breast tissue.
(161) This staining represents a total of 36 cases as outlined for each histological subtype in Table 1, performed three times per category.
(162) TABLE-US-00004 TABLE 1 Expression of PAR.sub.1 and Etk/Bmx in breast cancer biopsy specimens Positive cells Histological Cases Mean ± SD +1 +2 +3 subtype (N = 36) PAR.sub.1 Etk/Bmx PAR.sub.1 Etk/Bmx PAR.sub.1 Etk/Bmx PAR.sub.1 Etk/Bmx Normal 12 0.8 ± 0.2 1.2 ± 0.2 0 1 0 0 0 0 DCIS 8 12.5 ± 3.7 14 ± 3.0 2(25%) 1(12.5%) 6(75%) 7(87.5%) — — IDC 9 40 ± 10.5 42 ± 12.3 2(22%) 1(11%) 1(11%) 0 5(55%) 6(66%) Lobular 7 45 ± 7.3 43 ± 11.6 1(14%) 0 1(14%) 1(14%) 6(85%) 5(71.4%) carcinoma Histological scoring of (N) cases: +1 less than 25% positive cells (weak positive); +2 between 25-75% positive cells (moderate); +3 more than 75% of positive cells (strong). All controls were negative (0-5% positive cells). Extent of expression classified by score (1-3), number of positive cells/field (x = 8).
(163) These results further suggest a direct correlation between PAR.sub.1 and Etk/Bmx expression in malignant breast cancer progression.
(164) Hierarchy of Binding
(165) Next, the chain of events mediating the signaling of PAR.sub.1 C-tail-Shc and Etk/Bmx was determined. MCF7 cells that express little or no hPar1 were ectopically forced to over-express hPar1. When co-immunoprecipitation with anti-PAR.sub.1 antibodies following PAR.sub.1 activation was performed, surprisingly, no Shc was detected in the PAR.sub.1 immunocomplex (
(166) Identification of PAR.sub.1-Etk/Bmx Binding Region: Functional Consequences.
(167) Peptides (representing various regions in PAR.sub.1 C-tail) were used in a competition analysis assay for the binding of PAR.sub.1 cell lysates to GST-PH-Etk/Bmx. An 18-amino-acid peptide encompassing residues 375-392 of PAR.sub.1 C-tail (termed peptide 4) yielded a dose-dependent inhibition within the range of 1-1000 nM applied peptide (
(168) Based on the competition assay mutated hPar1 constructs with successive replacement of seven residues (378-384; CQRYVYS) were prepared. MCF7 clones expressing either HA-hPar1-7A or HA-wt hPar1 were prepared. As shown in
(169) MCF7 cells stably expressing HA-wt-hPar1 and Etk/Bmx, or HA-hPar1-7A mutant and Etk/Bmx were examined in a Matrigel invasion assay. Invading cells were counted and the mean±SD of ten fields per filter was determined. Stable HA wt hPar1 clone or HA-hPar1-7A mutant clone were co-transfected with Etk/Bmx construct and TFLLRNPNDK-activated. Marked Matrigel invasion is seen in the wt hPar1 and Etk/Bmx clones (
(170) In a parallel experiment, a wound assay for determining the rate of cell migration, showing the ability of the cells to fill in gaps in an MDA-MB-435 cell monolayer, was performed. MDA-MB-435 cell monolayer expressing endogenous Etk/Bmx was scratched to introduce an equal gap-area under the following conditions: control untreated cells, TFLLRNPNDK-activated or SiRNA-Etk/Bmx and TFLLRNPNDK-activated. Rapid closure of the wound was obtained 24 hours under PAR.sub.1 activation as compared to control untreated cells. In contrast, no migration and closure of the wound was seen when the endogenous Etk/Bmx level of the cells was knocked down using an siRNA-Etk/Bmx construct (
(171)
(172) The highly ordered tissue organization of normal epithelia is aggressively disrupted in pathological conditions. This is well recapitulated in the MCF10A cell-growth model, mimicking epithelia apico-basal polarity (Desgrosellier J S, et al. (2009) Nat Med 15: 1163-1169). The morphogenesis of MCF10A mammary acini in three-dimensional (3-D) basement membrane cultures was examined. Normal-appearing intact spheroids are formed in the presence of control Etk/Bmx-expressing MCF10A cells and activation by SFLLRNPNDK, a PAR.sub.1 agonist peptide (
(173) Analyses of hPAR1 7A Mutants in the Xenograft Animal Model
(174) In vivo experiments were performed with hPAR1 7A mutants in the mammary gland xenograft model describe above. Stable MCF-7 clones were generated. These clones expressed: wt hPar1 or hPar1 7A mutant in the presence or absence of Etk/Bmx. As described above, these clones were further analyzed in vivo in the xenograft animal model. The mice were pre implanted prior to injection with 17-β-estradiol pellets. Next the clones were orthotopically injected to the mice mammary glands. Enormously large tumors were generated in mice injected with cells expressing hPar1-Etk/Bmx. The experiment was stopped at an early stage (e.g., 20 days post injection) due to heavy tumor burden. In-contrast, very small tumors, similar to the empty vector injected cells were generated in the presence of hPar1-7A mutant, incapable of binding Etk/Bmx. Thus, as shown above for the MCF7/Y397Z hPar1 cells, it is demonstrated that when hPar1 is unable to bind Etk/Bmx, very small to no tumors are generated (
(175) Immunohistological Evaluation of the Tumor Sections
(176) The tumors generated by the different clones were sectioned and histologically examined. Cell proliferation levels in the tumor sections were evaluated by immunostaining with anti Proliferating Cell Nuclear Antigen (PCNA) antibodies. A high nuclear staining level was demonstrated in wt hPar1+ Etk/Bmx tumors (p<0.0001,
Example 3
The PAR2 C-Tail Minimal Binding Site for Etk/Bmx
(177) HEK-293T cells were transiently transfected with both hPar2 and T7-tagged Etk/Bmx. Immunoprecipitation analyses were performed before and after PAR.sub.2 activation with SLIGKV (a peptide known to activate PAR.sub.2). The results showed a firm association between PAR.sub.2 and Etk/Bmx, occurring between 10-20 min of activation which declined immediately thereafter (
(178) The physical association between Etk/Bmx and PAR.sub.2 was confirmed in assay examining the binding between Etk/Bmx expressing cell lysates and GST-PAR.sub.2 C-tails. A truncated form of hPar2 showed no physical interaction between PAR.sub.2 and Etk/Bmx as compared with wt hPar2 (
Example 4
Inhibition of PAR2 Signaling In Vivo
(179) The physiological significance of a prime signaling partner that interacts with PAR.sub.2 C-tail is assessed in vivo, in an orthotopic mammary fat pad model for tumor development. As shown above in example 2, stable MCF7 clones expressing various constructs of hPar2 are generated and injected orthotopically into mice, mammary glands. These clones include wt hPar2, truncated hPar2 (devoid of the cytoplasmic tail) and the various deleted hPar2-C-tail constructs (e.g., K390Z hPar2; K378Z hPar2, K368Z hPar2 and K356Z hPar2). In parallel, a silenced siRNA-hPar2 lentiviral construct is evaluated for the ability to halt tumor growth, in vivo. For the cloning of siRNA-hPar2 into a lentiviral vector the following primers are used
(180) P-TG GGAAGAAGCCTTATTGGTA TTCAAGAGATACCAATAA GGC TTCTTCCCTTTTTTC (SEQ ID NO: 53)
(181) 5′-P-TCGAGAAAAAAG GGAA GAAGCC TTATTGGTATC TCTTGAATACCAATA AGGCTTCTTCCCA (SEQ ID NO: 54). Stable clones expressing both wt hPar2 and the mutated hPar2 C-tail (incapable of binding a prime signaling partner; e.g. Etk/Bmx) are generated. These clones are analyzed in vivo to evaluate the physiological significance for preventing a prime signaling partner association with PAR.sub.2.
Example 5
Selective Association of Additional PH-Domain Containing Signal Proteins with PAR1 and PAR2
(182) The association between Etk/Bmx and PAR.sub.1-C-tail occurs via Etk/Bmx's PH-domain. Next, the association of additional PH-domain containing proteins, e.g. Akt and Vav3 with PAR.sub.1 or PAR.sub.2 was examined.
(183) First, the endogenous level of Akt and Etk/Bmx was analyzed in various tumor cell lines (i.e. HEK-293T, CL1, HCT116, MDA-MB-231, and MDA-MB-435). While Akt is abundantly expressed in all lines tested, Etk/Bmx appeared endogenously only in CL1, a prostate cancer cell line (
(184) Next, a panel of cell-lines was transfected with HA-tag-hPar1. Cell lysates were prepared and applied onto GST-PH-Akt or GST-PH-Vav.sub.3. HEK-293T cells were used as naïve parental cells (e.g., lacking Etk/Bmx) as also following enforced expression of Etk/Bmx. As shown in
(185) The PH-Domain Binding Region in PAR.sub.1-C-Tail
(186) The following example demonstrates that the association of PAR.sub.1-C-tail with PH-domain containing proteins, e.g. PH-domain-Akt or PH-domain-Vav.sub.3 occurs via the same region that is associated with Etk/Bmx. Namely, without wishing to be bound by theory the PAR.sub.1-C-tail appears to be an anchor region for association with PH-domain containing proteins. For this purpose, the association between Akt (which is ubiquitously expressed in the cells) and PAR.sub.1 was analyzed, following activation. As shown in
(187) The PH-Domain Binding Region in PAR.sub.2-C-Tail
(188) Cells that do not express endogenous Etk/Bmx effectively associated with either PH-Akt or PH-Vav.sub.3 as demonstrated upon application on GST immobilized PH-domain columns. HEK-293 cells effectively bind PH-Akt or PH-Vav.sub.3. In-contrast, when these cells were transfected with increased concentrations of Etk/Bmx (e.g., 0.5-2 μg) they completely failed to associate with either of the PH-domain proteins analyzed (e.g., Akt and Vav.sub.3). These data strongly indicate that activation of PAR.sub.2 behaves in a similar manner as activated PAR.sub.1 and primarily associates with the PH-domain of Etk/Bmx (
(189) In order to determine the minimal binding region within PAR.sub.2-C-tail sequence, deleted hPar2-C-tail constructs were prepared. HEK-293T cells were transfected to overexpress either wt hPar2 or the shortest hPar2 deleted construct (e.g., hPar2 K356Z) or mutants inserted into the shortest Etk/Bmx, Akt or Vav.sub.3. Slightly weaker binding is observed in the presence of the shortest region K356A. When mutants were applied to this region (e.g., K352A, K349A) both mutants failed to bind either Etk/Bmx (
Example 6
PAR1 Peptide Penetration into MCF7 Cells
(190) A PAR.sub.1 peptide corresponding to the region which associates with the PH-domain (i.e. FITC-SSECQRYVYSIL-COOH (SEQ ID NO: 3) was synthesized and tagged with GFP (green fluorescence protein). MCF7 cells were preincubated for various time periods with the FITC-labeled peptide (e.g., 2 h, 4 h, 8 h and 16 h). After 2 h, some of the cells showed uptake of GFP. Maximal uptake was visualized after 8 h and 16 h. The levels of the penetration of the GFP-PH-domain PAR.sub.1 peptide into MCF7 cells are shown in
(191) Next, a competition experiment was performed. Stable clones of MCF7 cells expressing either HA-PAR.sub.1 T7-tagged Etk/Bmx, and incubated in the presence or absence of the PAR.sub.1 PH-domain peptide (i.e. SSECQRYVYSIL). The cells were activated either by thrombin or using the PAR.sub.1 activating peptide TFLLRN, and cell lyzates were prepared at various time points after activation. Immuno-precipitation analyses were performed with anti HA antibodies (thereby immunoprecipitating HA-FARO, followed by Western blot analysis using anti T7 antibodies (detecting T7-tagged Etk/Bmx). As demonstrated in