APPLICATIONS OF SERUM S100A8/A9 COMPLEX LEVEL IN PROGNOSIS ASSESSMENT OF ACUTE MYOCARDIAL INFARCTION
20220308067 · 2022-09-29
Assignee
Inventors
Cpc classification
G01N2800/56
PHYSICS
International classification
Abstract
Applications of a serum S100A8/A9 complex level in the prognosis assessment of acute myocardial infarction (AMI) are disclosed. The prognosis assessment refers to predicting short-term and long-term prognosis of an AMI patient undergoing percutaneous coronary intervention (PCI) and determining whether the patient falls into a high-risk group of postoperative adverse events (AEs) or a low-risk group of the postoperative AEs. The AEs include but are not limited to death, cardiogenic shock (CS), and acute heart failure (AHF). The S100A8/A9 complex is a heterodimer complex formed by S100A8 protein (Calgranulin A, MRP8) and S100A9 protein (Calgranulin B, MRP14) in a calcium ion-dependent manner. The S100A8/A9 complex refers to the S100A8/A9 complex in serum of the patient within 24 h after the PCI. An antibody pair for detecting the serum S100A8/A9 complex is also disclosed.
Claims
1. A method of preparing a test kit for predicting a short-term prognosis and a long-term prognosis of an acute myocardial infarction (AMI) patient undergoing percutaneous coronary intervention (PCI), comprising applying an S100A8/A9 complex in preparing the test kit; wherein, the predicting the short-term prognosis and the long-term prognosis of the AMI patient undergoing the PCI refers to determining whether the AMI patient falls into a high-risk group of a postoperative adverse event (AE) or a low-risk group of the postoperative AE; the postoperative AE comprises death, cardiogenic shock (CS), and acute heart failure (AHF); and the S100A8/A9 complex is a heterodimer complex formed by S100A8 protein (Calgranulin A, MRP8) and S100A9 protein (Calgranulin B, MRP14) in a calcium ion-dependent manner.
2. The method according to claim 1, wherein, the S100A8/A9 complex refers to the S100A8/A9 complex in serum of the AMI patient within 24 h after the PCI.
3. The method according to claim 2, wherein, the short-term prognosis and the long-term prognosis refer to a prognosis during an intra-hospital period after the PCI and a prognosis 6 months or longer after the PCI, respectively.
4. The method according to claim 1, wherein, (1) the high-risk group of the postoperative AE for the short-term prognosis has an AE incidence of 68% after the PCI, and the low-risk group of the postoperative AE for the short-term prognosis has an AE incidence of 21% after the PCI; and (2) the high-risk group of the postoperative AE for the long-term prognosis has an AE incidence of 23% after the PCI, and the low-risk group of the postoperative AE for the long-term prognosis has an AE incidence of 6% after the PCI.
5. The method according to claim 1, wherein, the high-risk group of the postoperative AE is determined when a serum S100A8/A9 complex expression level in the AMI patient 24 h after the PCI is greater than or equal to 4,540 ng/ml; and the low-risk group of the postoperative AE is determined when the serum S100A8/A9 complex expression level in the AMI patient 24 h after the PCI is less than 4,540 ng/ml.
6. The method according to claim 1, wherein the test kit comprises a detection reagent for detecting a serum S100A8/A9 complex expression level, and the detection reagent comprises: (1) an antibody specifically binding to the S100A8/A9 complex, wherein the antibody comprises a polyclonal antibody (pAb), a monoclonal antibody (mAb), a single-chain variable fragment (scFv), a functional antibody fragment, an antibody Fab region, a nanobody, a chimeric antibody, and a multispecific antibody; (2) a ligandin or polypeptides specifically binding to the S100A8/A9 complex; and (3) a non-protein compound specifically recognizing the S100A8/A9 complex.
7. The method according to claim 6, wherein the test kit is one selected from the group consisting of (1) an enzyme-linked immunosorbent assay (ELISA) kit; (2) a colloidal gold test strip assay kit; (3) a chemiluminescent assay kit; and (4) a flow cytometry (FCM) assay kit.
8. (canceled)
9. A method of a prediction of a short-term prognosis and a long-term prognosis of an AMI patient undergoing PCI, comprising applying an S100A8/A9 complex in the prediction: wherein, the prediction of the short-term prognosis and the long-term prognosis of the AMI patient undergoing the PCI refers to determining whether the AMI patient falls into a high-risk group of a postoperative AE (short-term and long-term) or a low-risk group of the postoperative AE (short-term and long-term); the postoperative AE comprises death, CS, and AHF; the S100A8/A9 complex refers to the S100A8/A9 complex in serum of the AMI patient within 24 h after the PCI; and the S100A8/A9 complex is a heterodimer complex formed by S100A8 protein (Calgranulin A, MRP8) and S100A9 protein (Calgranulin B, MRP14) in a calcium ion-dependent manner.
10. The method according to claim 9, wherein, the short-term prognosis and the long-term prognosis refer to a prognosis during an intra-hospital period after the PCI and a prognosis 6 months or longer after the PCI, respectively; the high-risk group of the postoperative AE for the short-term prognosis has an AE incidence of 68% after the PCI; the low-risk group of the short-term prognosis has an AE incidence of 21% after the PCI; the high-risk group of the postoperative AE for the long-term prognosis has an AE incidence of 23% after the PCI; the low-risk group of the postoperative AE for the long-term prognosis has an AE incidence of 6% after the PCI; the high-risk group of the postoperative AE (short-term and long-term) is determined when a serum S100A8/A9 complex expression level in the AMI patient 24 h after the PCI is greater than or equal to 4,540 ng/ml; and the low-risk group of the postoperative AE (short-term and long-term) is determined when the serum S100A8/A9 complex expression level in the AMI patient 24 h after the PCI is less than 4,540 ng/ml.
11. The method according to claim 2, wherein, (1) the high-risk group of the postoperative AE for the short-term prognosis has an AE incidence of 68% after the PCI, and the low-risk group of the postoperative AE for the short-term prognosis has an AE incidence of 21% after the PCI; and (2) the high-risk group of the postoperative AE for the long-term prognosis has an AE incidence of 23% after the PCI, and the low-risk group of the postoperative AE for the long-term prognosis has an AE incidence of 6% after the PCI.
12. The method according to claim 3, wherein, (1) the high-risk group of the postoperative AE for the short-term prognosis has an AE incidence of 68% after the PCI, and the low-risk group of the postoperative AE for the short-term prognosis has an AE incidence of 21% after the PCI; and (2) the high-risk group of the postoperative AE for the long-term prognosis has an AE incidence of 23% after the PCI, and the low-risk group of the postoperative AE for the long-term prognosis has an AE incidence of 6% after the PCI.
13. The method according to claim 2, wherein, the high-risk group of the postoperative AE is determined when a serum S100A8/A9 complex expression level in the AMI patient 24 h after the PCI is greater than or equal to 4,540 ng/ml; and the low-risk group of the postoperative AE is determined when the serum S100A8/A9 complex expression level in the AMI patient 24 h after the PCI is less than 4,540 ng/ml.
14. The method according to claim 3, wherein, the high-risk group of the postoperative AE is determined when a serum S100A8/A9 complex expression level in the AMI patient 24 h after the PCI is greater than or equal to 4,540 ng/ml; and the low-risk group of the postoperative AE is determined when the serum S100A8/A9 complex expression level in the AMI patient 24 h after the PCI is less than 4,540 ng/ml.
15. The method according to claim 2, wherein the test kit comprises a detection reagent for detecting a serum S100A8/A9 complex expression level, and the detection reagent comprises: (1) an antibody specifically binding to the S100A8/A9 complex, wherein the antibody comprises a polyclonal antibody (pAb), a monoclonal antibody (mAb), a single-chain variable fragment (scFv), a functional antibody fragment, an antibody Fab region, a nanobody, a chimeric antibody, and a multispecific antibody; (2) a ligandin or polypeptides specifically binding to the S100A8/A9 complex; and (3) a non-protein compound specifically recognizing the S100A8/A9 complex.
16. The method according to claim 3, wherein the test kit comprises a detection reagent for detecting a serum S100A8/A9 complex expression level, and the detection reagent comprises: (1) an antibody specifically binding to the S100A8/A9 complex, wherein the antibody comprises a polyclonal antibody (pAb), a monoclonal antibody (mAb), a single-chain variable fragment (scFv), a functional antibody fragment, an antibody Fab region, a nanobody, a chimeric antibody, and a multispecific antibody; (2) a ligandin or polypeptides specifically binding to the S100A8/A9 complex; and (3) a non-protein compound specifically recognizing the S100A8/A9 complex.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
DETAILED DESCRIPTION OF THE EMBODIMENTS
Example 1: Difference in the S100A8/A9 Expression Levels Between AMI Patients and Healthy People
[0070] According to the principle of gender and age matching, serum samples of 207 healthy people and 208 AMI patients were selected, and an S100A8/A9 expression levels were detected by ELISA. An S100A8/A9 expression level in AMI patients was 1.91 times higher than that in healthy people (P<0.001).
[0071] I. Experimental Steps:
[0072] Kit: R&D Systems, Inc, Human S100A8/S100A9, Heterodimer Immunoassay
[0073] (1) Preparation of Reagents:
[0074] 1. All reagents were equilibrated to room temperature before use.
[0075] 2. Wash buffer: If crystals were formed in a concentrate, the concentrate should be equilibrated to room temperature and shaken gently until the crystals were completely dissolved, and ionized water or distilled water was added to dilute a wash buffer from 20 ml to 500 ml.
[0076] 3. Substrate solution: Chromogenic reagents A and B should be mixed in equal volumes 15 min before use and stored in the dark. Each well required 200 ul of a mixture of chromogenic reagents A and B in equal volumes.
[0077] 4. S100A8/A9 standard: An S100A8/A9 standard was re-prepared using calibrator diluent RD5-10. A re-prepared product was a 40 ng/ml stock solution. The standard was gently stirred for at least 15 min before diluted.
[0078] 5. 250 ul of appropriate calibrator diluent RD5-10 was pipetted into each tube. The stock solution was used to prepare a series of dilutions (20 ng/ml, 10 ng/ml, 5 ng/ml, 2.5 ng/ml, 1.25 ng/ml, and 0.625 ng/ml). An undiluted standard (40 ng/ml) was adopted as a high standard, and a calibrator diluent was adopted as a 0 standard (0 pg/ml).
[0079] (2) Determination Steps:
[0080] Before use, all reagents and samples were equilibrated to room temperature, and all samples, standards and controls were determined in duplicate.
[0081] 1. All reagents and working standards were prepared, and serum samples were diluted by 150 times.
[0082] 2. Excess microplates were removed and put back into a tin foil bag with desiccant, which was resealed.
[0083] 3. 50 ul of assay diluent RD1-34 was added to each hole.
[0084] 4. 50 ul of each of standards, samples, and controls was added to each well. The plates were sealed with rubber strips and incubated at room temperature for 2 h, and then distributions of determined standards and samples were recorded.
[0085] 5. Liquid in each well was pipetted away, and then each well was fully washed with 400 ul of wash buffer to completely remove the liquid and patted dry on clean paper. The washing was conducted 4 times.
[0086] 6. 200 ul of S100A8/A9 conjugate was added to each well, and then plates were sealed with new rubber strips and warmed at room temperature for 2 h.
[0087] 7. The step 5 was repeated.
[0088] 8. 200 ul of the substrate solution was added to each well, and a resulting mixture was incubated for 30 min at room temperature in the dark.
[0089] 9. 50 ul of a stop solution was added to each well, and a color in the well should change from blue to yellow. If the color in the well is green or if the color changes unevenly, the plate should be patted gently to ensure thorough mixing.
[0090] 10. A microplate reader was used to determine the absorbance of each well at 450 nm within 30 min. If wavelength calibration is effective, 540 nm or 570 nm is set. If wavelength calibration is unavailable, a reading at 540 nm or 570 nm is subtracted from a reading at 450 nm. This method can correct optical defects of a plate. Reading directly at 450 nm without correction can be either slightly-high or slightly-low.
[0091] (3) Calculation Results:
[0092] 1. An OD value of the zero standard was subtracted from an OD value of each of the standards, controls, and samples, and an average was taken for two replicate wells.
[0093] 2. With a 4-parameter curve, a standard curve was established by computer software.
[0094] 3. If a sample has been diluted, a concentration obtained from the standard curve must be multiplied by a dilution factor.
[0095] II. Experimental Results:
[0096] Results were shown in
TABLE-US-00001 TABLE 1 Serum S100A8/A9 complex levels in healthy people and AMI patients Healthy control (HC) AMI patients Detection index (n = 207) (n = 208) S100A8/A9, ng/ml 1,723 ± 193.7 3,295 ± 200.4 (mean ± SEM)
Example 2: Expression of S100A8/A9 in 210 AMI Patients at Two Consecutive Time Points (Before and 1 Day after PCI) in Hospital
[0097] Samples were collected from 210 AMI patients at two consecutive time points (before PCI (day 0) and 1 day after PCI (day 1)), and S100A8/A9 complex expression level in serum of patients were determined by the same ELISA experiment as in Example 1.
[0098] 1. Detection results of S100A8/A9 expression levels before and after PCI were shown in
TABLE-US-00002 TABLE 2 Serum S100A8/A9 complex levels in AMI patients before and after PCI Before PCI 1 day after PCI Detection index (n = 210) (n = 210) S100A8/A9, ng/ml 3,270 ± 134.2 4,151 ± 156.9 (mean ± SEM)
Example 3: Prognosis Assessment Value of S100A8/A9 for Intra-Hospital MACEs
[0099] According to the occurrence of intra-hospital MACEs (death and AHF), 210 AMI patients were divided into an MACE group (35 patients) and a non-MACE group (175 patients). S100A8/A9 complex expression levels in serum of patients were determined by the same ELISA experiment as in Example 1.
[0100] Statistical Results:
[0101] (1) S100A8/A9 complex expression difference between the MACE group and the non-MACE group before PCI (day 0) and 1 day after PCI (day 1): 1 day after PCI, there was a statistically significant difference between the two groups, and the MACE group was 1.57 times higher than the non-MACE group (P<0.001), as shown in
TABLE-US-00003 TABLE 3 Serum S100A8/A9 complex levels of patients in the MACE group and the non-MACE group before and after PCI Before PCI 1 day after PCI MACE Non-MACE MACE Non-MACE Detection index (n = 35) (n = 175) (n = 35) (n = 175) S100A8/A9, ng/ml 3,633 ± 3,197 ± 5,960 ± 3,789 ± (mean ± SEM) 375.9 142.4 437.8 153.3
[0102] (2) A logistic regression model was established to illustrate a relationship between marker levels and intra-hospital MACEs. In order to reflect the fluctuation of S100A8/A9 levels, according to marker levels at two time points (before PCI (day 0) and 1 day after PCI (day 1)), the following marker level combinations were obtained: Δ 1d (a difference between a marker level 1 day after PCI and a marker level before PCI), Δ 1d+1d (a sum of Δ 1d with a marker level 1 day after PCI), Δ 1d/0d (a ratio of Δ 1d to a marker level before PCI), and SD (a standard deviation for marker levels at the two time points). A logistic regression model was established to correct the eight factors of age, gender, time to open blood vessels, hypertension history, diabetes history, hyperlipemia history, smoking history, and infarction location. The 6 kinds of marker levels (before PCI, 1 day after PCI, Δ 1d, Δ 1d+1d, Δ 1d/0d, and SD) all have independent prediction value for intra-hospital MACEs and are superior to high-sensitivity cardiac troponin I (hs-cTnI).
TABLE-US-00004 TABLE 4 A relationship between marker levels and intra-hospital MACEs according to a logistic regression model Unadjusted OR (95% CI) Adjusted OR (95% CI) Before PCI (day 0) 1.642 (1.048-2.573) 1.800 (1.097-2.952) P = 0.031 P = 0.020 1 day after PCI (day 1) 3.009 (1.898-4.770) 3.988 (2.301-6.912) P < 0.001 P < 0.001 Δ 1 d 2.422 (1.536-3.820) 2.624 (1.597-4.310) P < 0.001 P < 0.001 Δ 1 d + 1 d 3.420 (2.114-5.532) 4.098 (2.375-7.071) P < 0,001 P < 0.001 Δ 1 d/0 d 1.830 (1.171-2.858) 1.878 (1.176-2.999) P < 0.001 P = 0.008 SD 2.165 (1.431-3.276) 2.450 (1.540-3.895) P < 0.001 P < 0.001 Baseline hs-cTnI 0.866 (0.477-1.571) 0.703 (0.372-1.329) P = 0.635 P = 0.279 Peak hs-cTnI 1.524 (1.085-2.141) 1.557 (1.077-2.252) P = 0.015 P = 0.019 (Unadjusted OR refers to inputting only a marker level into the logistic regression model. Adjusted OR refers to inputting a marker level and an aforementioned correction factor into the logistic regression model. As there are 8 markers, correction needs to be conducted 8 times)
Example 4: Prognosis Assessment Value of S100A8/A9 for Long-Term MACEs
[0103] Among the 210 AMI patients, 4 died in the hospital, so the remaining 206 patients were followed up for a long term. A median follow-up time was 21.7 (IQR: 13.7 to 29.6) months. 15 people underwent MACEs (who were subjected to all-cause death or re-admitted to hospital due to heart failure).
[0104] Experimental Statistical Results:
[0105] (1) In the intra-hospital MACE analysis, it was found that the Δ 1d S100A8/A9 level exhibited the best prognosis assessment value. The ROC curve analysis was used to determine a cut-off value for S100A8/A9 Δ 1d intra-hospital AE prediction. A specific ROC curve was shown in
TABLE-US-00005 TABLE 5 AUC = 0.732 (0.640-0.825) P < 0.001 cut-off: ≥2,248.13 ng/ml Sensitivity: 57.14% (39.4-73.7) Specificity: 84.57% (78.4-89.6)
[0106] (2) The Kaplan-Meier survival curve was used to evaluate a prediction value of the cut-off value for S100A8/A9 Δ 1d intra-hospital MACE prediction on long-term AEs. Patients with a marker level <2,248.13 ng/ml had better long-term prognosis than those with a higher marker level (P<0.001) (survival curves for the two groups of patients were shown in
Example 5: Expression of S100A8/A9 in 210 AMI Patients at 5 Consecutive Time Points in the Hospital (Before PCI, 1 Day after PCI, 2 Days after PCI, 3 Days after PCI, and 4 Days after PCI), and in 425 Healthy People (HCs)
[0107] Serum samples were collected from 210 AMI patients at 5 consecutive time points (before PCI (day 0), 1 day after PCI (day 1), 2 days after PCI (day 2), 3 days after PCI (day 3), and 4 days after PCI (day 4)) and from 425 healthy people (healthy controls, HCs), and S100A8/A9 expression levels were determined by ELISA. An S100A8/A9 expression level in AMI patients was higher than that in healthy people (P<0.001). An S100A8/A9 expression level 1 day after PCI was 1.27 times higher than that before PCI (P<0.001) and then gradually decreased.
[0108] Experimental results were shown in Table 6 and
TABLE-US-00006 TABLE 6 S1000A8/A9 complex levels in serum Group S100A8/A9, ng/ml (mean ± SEM) HCs 820.8 ± 58.54 Before PCI 3,270 ± 134.2 1 day after PCI 4,151 ± 156.9 2 days after PCI 3,500 ± 128.8 3 days after PCI 3,488 ± 127.9 4 days after PCI 3,331 ± 138.9 Notes: After a sample set of healthy people is added and the detection method is corrected, a serum S100A8/A9 complex level in healthy people is slightly different from data in Example 1.
After repeated verification, the data in Table 6 are very close to real data.
Example 6: Prognosis Assessment Value of S100A8/A9 for Long-Term MACEs
[0109] Further long-term follow-up was conducted on the aforementioned 210 patients, and a median follow-up time was increased to 789 (IQR: 460 to 1,034) days. The long-term MACEs in the Example 4 were re-examined and distinguished, and incidental suspected MACEs in short-term follow-up were excluded. 24 people were confirmed to have cardiovascular AEs (MACE, who were subjected to all-cause death or CS, or re-admitted to hospital due to heart failure).
[0110] Given the comprehensiveness of MACEs, CS was also counted as MACE when it was counted again.
[0111] Experimental Results:
[0112] (1) S100A8/A9 expression difference between the MACE group and the non-MACE group before PCI (day 0), 1 day after PCI (day 1), 2 days after PCI (day 2), 3 days after PCI (day 3), and 4 days after PCI (day 4). Only 1 day after PCI, there was a statistically significant difference between S100A8/A9 levels in serum samples of patients in the two groups, and the MACE group was 1.45 times higher than the non-MACE group (P=0.002). Comparative data of S100A8/A9 levels in serum samples obtained according to the grouping situation were shown in Table 7 and
TABLE-US-00007 TABLE 7 Correlation between serum S100A8/A9 complex levels and long-tern MACEs Non-MACE (n = 186) MACE (n = 24) S100A8/A9, ng/ml S100A8/A9, ng/ml Group (mean ± SEM) (mean ± SEM) Before PCI 3,218 ± 140.7 3,673 ± 435.4 1 day after PCI 3,946 ± 154.5 5,740 ± 588.3 2 days after PCI 3,408 ± 134.6 4,207 ± 407.9 3 days after PCI 3,439 ± 135.1 3,864 ± 395.2 4 days after PCI 3,277 ± 153.8 3,750 ± 225.2
[0113] (2) A COX regression model was established to illustrate a relationship between marker levels and long-term MACEs. According to marker levels at five time points (before PCI (day 0), 1 day after PCI (day 1), 2 days after PCI (day 2), 3 days after PCI (day 3), and 4 days after PCI (day 4), a COX regression model was established to correct TIMI risk scores. Results showed that an S100A8/A9 level 1 day after PCI exhibited the best prediction value for long-term MACEs.
TABLE-US-00008 TABLE 8 Corrected S100A8/A9 value 1 day after PCI has the best prediction value for long-term MACEs Unadjusted HR Adjusted HR Group (95% CI) (95% CI) Before PCI (day 0) 1.283 (0.789-2.086) 0.959 (0.529-1.739) P = 0.315 P = 0.891 1 day after PCI (day 1) 2.067 (1.317-3.243) 2.039 (1.149-3.618) P = 0.002 P = 0.015 2 days after PCI (day 2) 1.515 (1.000-2.297) 1.165 (0.681-1.993) P = 0.050 P = 0.578 3 days after PCI (day 3) 1.360 (0.886-2.089) 0.960 (0.576-1.603) P = 0.159 P = 0.877 4 days after PCI (day 4) 1.392 (0.899-2.155) 0.833 (0.441-1.574) P = 0.138 P = 0.574
[0114] In the long-term MACE analysis, it was found that the S100A8/A9 level 1 day after PCI exhibited the best prognosis assessment value. Therefore, in order to achieve the purpose of clinical use, a cut-off value was found to accurately achieve risk stratification for patients.
[0115] Experimental Results:
[0116] (1) The ROC curve analysis was used to determine a cut-off value for long-term AE prediction using S100A8/A9 1 day after PCI.
[0117] Results were shown in
[0118] AUC=0.70 (0.58-0.81), P=0.002
[0119] cut-off ≥4,540 ng/ml
[0120] Sensitivity: 66.7%
[0121] Specificity: 69.4%
[0122] (2) The Kaplan-Meier survival curve was used to evaluate the prediction value of the S100A8/A9 expression level 1 day after PCI for long-term MACEs. Patients with a marker level <4,540 ng/ml had better long-term prognosis than those with a higher marker level (
Example 7: Prognosis Re-Assessment of S100A8/A9 on Intra-Hospital Cardiovascular AEs
[0123] The occurrence of intra-hospital (the intra-hospital refers to a period from the end of PCI to discharge from hospital) cardiovascular AEs (MACE: all-cause death, CS, AHF) in 210 AMI patients was observed and counted again. A total of 32 patients underwent MACEs.
[0124] Given the comprehensiveness of MACEs, CS was also counted as MACE when it was counted again.
[0125] Experimental Results:
[0126] (1) S100A8/A9 expression difference between the MACE group and the non-MACE group before PCI (day 0), 1 day after PCI (day 1), 2 days after PCI (day 2), 3 days after PCI (day 3), and 4 days after PCI (day 4). There was a statistically significant difference between the two groups at each time point, and there was the most significant difference 1 day after PCI (as shown in Table 7 and
TABLE-US-00009 TABLE 7 Comparison of S100A8/A9 complex levels in serum of patients in the MACE group/non-MACE groups in the hospital S100A8/A9, ng/ml Non-MACE MACE (mean ± SEM) (n = 178) (n = 32) Before PCI 3,102 ± 156.5 3,907 ± 444.1 1 day after PCI 3,601 ± 153.7 6,075 ± 451.4 2 days after PCI 3,262 ± 136.3 4,946 ± 430.2 3 days after PCI 3,247 ± 137.5 5,033 ± 405 4 days after PCI 3,206 ± 240.6 4,611 ± 557.4
[0127] (2) According to marker levels at five time points (before PCI (day 0), 1 day after PCI (day 1), 2 days after PCI (day 2), 3 days after PCI (day 3), and 4 days after PCI (day 4), a COX regression model was established to correct TIMI risk scores. An S100A8/A9 level 1 day after PCI exhibited the best prediction value for intra-hospital MACEs (as shown in Table 8 below).
TABLE-US-00010 TABLE 8 Corrected and uncorrected prediction values Unadjusted HR Adjusted HR (95% CI) (95% CI) Before PCI (day 0) 1.693 (1.098-2.613) 1.722 (1.121-2.644) P = 0.017 P = 0.013 1 day after PCI (day 1) 3.142 (1.977-4.994) 2.932 (1.871-4.595) P < 0.001 P< 0.001 2 days after PCI (day 2) 2.007 (1.349-2.986) 1.946 (1.303-2.908) P = 0.001 P = 0.001 3 days after PCI (day 3) 2.115 (1.388-3.223) 2.165 (1.401-3.345) P < 0.001 P = 0.001 4 days after PCI (day 4) 1.770 (1.055-2.969) 1.785 (1.040-3.063) P = 0.031 P = 0.036
[0128] The occurrence of intra-hospital cardiovascular AEs (MACE: all-cause death, CS, and AHF) in 349 AMI patients (not the aforementioned 210 patients, here 349 were newly enrolled patients) was observed, and a total of 47 patients underwent MACEs.
[0129] Experimental Results:
[0130] (1) S100A8/A9 expression difference between the MACE group and the non-MACE group before PCI (day 0) and 1 day after PCI (day 1) (as shown in Table 9 and
TABLE-US-00011 TABLE 9 Comparison of S100A8/A9 complex levels in serum of patients in the MACE group/non-MACE group in the hospital S100A8/A9, ng/ml Non-MACE MACE (mean ± SEM) (n = 302) (n = 47) Before PCI 3,476 ± 134.3 4,681 ± 339.1 1 day after PCI 4,107 ± 123.5 6,358 ± 361.6
[0131] (2) According to marker levels at two time points (before PCI (day 0) and 1 day after PCI (day 1)), a COX regression model was established to correct TIMI risk scores (Table 10). Results showed that an S100A8/A9 level 1 day after PCI still exhibited independent prediction value for intra-hospital MACEs.
TABLE-US-00012 TABLE 10 Corrected and uncorrected prediction values Unadjusted HR Adjusted HR (95% CI) (95% CI) Before PCI (day 0) 1.639 (1.190-2.258) 1.573 (1.155-2.142) P = 0.002 P = 0.004 1 day after PCI (day 1) 2.422 (1.717-3.416) 2.222 (1.569-3.147) P < 0.001 P < 0.001
[0132] (3) With the cut-off value determined in Example 6 as a determination basis, a prediction value of the serum S100A8/A9 complex expression level 1 day after PCI to risk stratification for the occurrence of intra-hospital MACEs in AMI patients was verified. Data of a total of 559 patients enrolled in the two times were combined. Patients with an S100A8/A9 expression level 1 day after PCI <4,540 ng/ml were classified into a low-risk group, and patients with a level ≥4,540 ng/ml were classified into a high-risk group. The Kaplan-Meier survival curve was used for analysis, and results were shown in
Example 8: Preparation of Mouse Anti-S100A8, S100A9, and S100A8/A9 mAbs and Double-Antibody Sandwich ELISA
[0133] 1. General mAb Preparation Method
[0134] 1) Establishment of Hybridoma Cell Lines and Identification of mAb Subtypes
[0135] a. An immune procedure adopted 4 basic immunizations and 1 booster immunization. 2 healthy female BALB/c mice who were about 6 to 8 weeks old were selected and subjected to adaptive feeding for 1 week, and negative blood was collected as a control.
[0136] b. A medium-range immunization program (0.3 mL/mouse, 2 weeks/time) was adopted. For the first immunization (50 μg/mouse), an immunogen was mixed with a Freund's complete adjuvant (FCA) in equal volumes, and a resulting mixture was stirred and emulsified and then injected subcutaneously at multiple sites on the back. Thereafter, an immunogen was mixed with an FCA in equal volumes, and a resulting mixture was stirred and emulsified for routine immunization.
[0137] c. In the third immunization, usually, 50 μg of an antigen was mixed with TiterMax in equal amounts, and a resulting mixture was emulsified and then injected at multiple sites on the back. Titer was measured 7 days later. An injection without an adjuvant was prepared for booster immunization, which was injected at a dosage of 50 μg. 3 days after booster immunization, eyeballs were taken off for blood sampling, and serum was isolated and stored. Moreover, a spleen was collected for fusion.
[0138] d. During cell fusion, spleen cells and myeloma cells were mixed at a ratio of about 4:1 and then subjected to fusion under the pro-fusion action of polyethylene glycol (PEG, with a molecular weight of 1,450). Fused cells were cultivated in an HAT selective medium for 10 days, then positive hybridoma cells capable of reacting with a target protein were screened out by the indirect ELISA method, and the positive hybridoma cells obtained from preliminary screening were further cultivated for expansion. Two days later, His-tag hybridoma cells were excluded to re-screen out hybridoma cells targeting the target protein rather than the tag.
[0139] e. The limiting dilution method was used to consecutively subclone obtained positive hybridoma cells at least two times. Subclones obtained each time were cultivated with an HT selective medium. 8 to 10 days after subcloning, ELISA screening was conducted until monoclonal cells had a positive rate of 100% to obtain a monoclonal cell line capable of stably secreting an anti-target protein antibody.
[0140] f. A mouse mAb subtype identification chip kit (purchased from Raybiotech, USA) was used to identify an mAb subtype.
[0141] 2) Preparation and Purification of Antibodies
[0142] a) Female healthy BALB/c mice who were 8 to 12 weeks old were selected and intraperitoneally injected with pristane at a dosage of 0.5 mL/mouse; and 7 to 10 days later, 1*10.sup.6 to 5*10.sup.6 monoclonal hybridoma cells were intraperitoneally injected into each mouse. It should be noted that PBS or serum-free medium needs to be used to make cells fall off or dilute cells.
[0143] b) An ascitic fluid was centrifuged at 10,000 r/min for 15 min, cell components and other precipitates, fat, oil layers, and so on were removed, and the intermediate layer was collected for determining antibody titer, dispensed, and stored at −70° C. for later use.
[0144] c) Precipitation using saturated ammonium sulfate (SAS): 5 mL of a treated ascitic fluid was pipetted to a small beaker, and 5.0 mL of PBS was filtered through a 0.22 μm filter membrane and then added dropwise to the beak under stirring; after a resulting solution was thoroughly mixed, 10 mL of an SAS solution (pH 7.4) was added, and a resulting mixture was further stirred slowly for 30 min, then stood for 2 h, and centrifuged at 10,000 r/min for 15 min; a resulting supernatant was removed, and a resulting precipitate was resuspended in PBS filtered through a 0.22 μm filter membrane; and a resulting suspension was filtered through a 0.22 μm filter membrane.
[0145] d) According to different antibody subtypes, different purification columns of GE Healthcare were selected to purify the antibodies, and obtained antibodies were dispensed and stored.
[0146] 2. ELISA
[0147] In this example, S100A8, S100A9, and S100A8/A9 dimer were used as antigens and the antibody pairs prepared for the antigens in the previous example were used as recognition antibodies in the double-antibody sandwich to establish double-antibody sandwich ELISA for detecting target antigens.
[0148] 1) Coating of ELISA Plate
[0149] An antibody 1 was diluted with a coating buffer (1 L in total: 1.5 g of Na.sub.2CO.sub.3, 2.9 g of NaHCO.sub.3, 1.2 g of Na.sub.2N.sub.3, and the balance of ddH.sub.2O; pH 9.6) to 1 μg/mL, a resulting solution was thoroughly mixed and added to a 96-well ELISA plate at 100 μL/well, and then the plate was sealed and placed overnight at 4° C.
[0150] 2) Addition of to-be-Tested Antigens
[0151] To-be-tested antigens and negative control samples were added, separately; and then the plate was fully incubated, washed 6 times with a plate washer, patted dry, and stored at 4° C. for use or stored at −20° C. for a long time.
[0152] 3) Detection antibodies were added at 100 μL/well, and the plate was incubated at 37° C., washed 6 times with a plate washer, and patted dry; then biotin-labeled goat anti-mouse IgG antibody (purchased from Raybiotech) with a specified concentration was added at 100 L/well, and the plate was incubated at 37° C. for 1 h and then washed; streptomycin-labeled horseradish peroxidase (HRP) was added at 100 μL/well, and the plate was incubated at 37° C. for 1 h and then washed; TMB substrate was added for chromogenic reaction; and after the chromogenic reaction was completed, 2 M concentrated sulfuric acid was added to stop the chromogenic reaction, and OD450 was measured with a microplate reader.
[0153] 3. Sequence and Antibody Pairing Result for Each Antigen
[0154] 1) The S100A8 antigen had a sequence shown in SEQ ID NO. 1:
TABLE-US-00013 LIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQE FLILVIKMGVAAHKKSHEESHKE;
[0155] Antibody titer test results were shown in
[0156] 2) The S100A9 antigen had a sequence shown in SEQ ID NO. 2:
TABLE-US-00014 QYSVKLGHPDTLNQGEFKELNVRKDLQNFLKKENKNEKVIEHIMEDLDTN ADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHKPGLGEGTP;
[0157] Antibody titer test results were shown in
[0158] 3) The S100A8/A9 dimer antigen had a sequence shown in SEQ ID NO. 3:
TABLE-US-00015 LIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQE FLILVIKMGVAAHKKSHEESHKEGGGGQYSVKLGHPDTLNQGEFKELVRK DLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEK MHEGDEGPGHHHKPGLGEGTP;
[0159] An antibody pairing curve was shown in
[0160] Finally, it should be noted that the above examples are merely provided to help those skilled in the art to understand the essence of the present invention, and do not limit the protection scope of the present invention.