Anti-Clusterin Antibodies and Antigen Binding Fragments and their Use to Reduce Tumor Volume
20170233487 · 2017-08-17
Inventors
Cpc classification
A61K45/06
HUMAN NECESSITIES
C07K16/3069
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K49/0004
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
International classification
Abstract
Novel antibodies and antigen binding fragments that specifically bind to clusterin are described. In some embodiments, the antibodies block the biological activity of clusterin and are useful in composition in certain cancers, more particularly in cancers, such as endometrial carcinoma, breast carcinoma, hepatocellular carcinoma, prostate carcinoma, a renal cell carcinoma, ovarian carcinoma, pancreatic carcinoma, and colorectal carcinoma. The invention also relates to cells expressing the humanized or hybrid antibodies. Additionally, methods of detecting and treating cancer using the antibodies and fragments are also disclosed.
Claims
1-76. (canceled)
77. An isolated nucleic acid encoding light chain variable region and/or heavy chain variable region of an antibody or antigen binding fragment thereof that specifically binds to clusterin, wherein the antibody or antigen binding fragment thereof comprises: a. a light chain variable region as set forth in SEQ ID NO.:8 and a heavy chain variable region as set forth in SEQ ID NO.:7; b. a light chain variable region as set forth in SEQ ID NO.:8 and a heavy chain variable region as set forth in SEQ ID NO.:29 or; c. a light chain variable region as set forth in SEQ ID NO.:25 and a heavy chain variable region as set forth in SEQ ID NO.:7.
78. A vector or vectors comprising the isolated nucleic acid of claim 77.
79. The vector or vectors of claim 78, wherein said vector or vectors is a mammalian expression vector or vectors.
80. An isolated cell comprising the isolated nucleic acid of claim 77.
81. The isolated cell of claim 80, wherein said cell is a mammalian cell
82-103. (canceled)
104. A kit comprising a vial or vials comprising the isolated nucleic acid of claim 77.
105-111. (canceled)
112. An isolated cell comprising the vector or vectors of claim 78.
113. A kit comprising a vial or vials comprising the vector or vectors of claim 78.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
DETAILED DESCRIPTION OF THE INVENTION
[0039] The present invention relates in one aspect thereof to antibodies which are capable of specific binding to clusterin and which comprise a humanized light chain variable region and/or a humanized heavy chain variable region.
[0040] The sequence of human clusterin may be found at RefSeq accession number; NM_001831.2 (protein id.=NP_001822) whereas the sequence of murine clusterin may be found at RefSeq accession number; NM_013492.2 (protein id.=NP_038520).
[0041] The antibodies or antigen binding fragment of the present invention may be able to bind to the murine and/or the human form of clusterin. The antibodies or antigen binding fragment of the present invention may also be able to bind naturally occurring variant as well as synthetic variants of clusterin having for example at least 75% (e.g., 80%, 85%, 90%, 95%, 99%) amino acid identity with human or murine clusterin.
[0042] The present invention therefore provides a humanized antibody of a non-human parent antibody that is capable of specific binding to clusterin or an antigen binding fragment thereof as well as hybrid antibodies and antigen binding fragments thereof.
[0043] In accordance with an embodiment of the invention, the humanized or hybrid antibody may inhibit (lower) the growth of a tumor cell expressing or secreting clusterin.
[0044] In accordance with a further embodiment of the invention, the humanized or hybrid antibody may reduce the volume of a tumor comprising cells expressing or secreting clusterin.
[0045] In accordance with another embodiment of the invention, the humanized or hybrid antibody may inhibit (lower) migration or invasion of a tumor cell expressing or secreting clusterin.
[0046] Therefore in accordance with yet another embodiment of the invention, the humanized or hybrid antibody may inhibit (lower) metastasis occurring from a tumor cell expressing or secreting clusterin.
[0047] In another aspect, the present invention relates to a method for reducing the volume of a tumor comprising clusterin-expressing cells which may comprise administering an anti-clusterin antibody (a polyclonal antibody, a monoclonal antibody, a chimeric antibody, a humanized antibody, an isolated human antibody, a hybrid antibody or a fragment thereof) to a mammal in need. The method more particularly contemplates administering a chimeric, humanized or hybrid antibody.
[0048] In one embodiment, the hybrid antibody or fragment thereof may comprise, for example, a light chain variable region of a non-human antibody and a heavy chain variable region of a humanized antibody.
[0049] In another embodiment, the hybrid antibody or fragment thereof may comprise, for example, a light chain variable region of a non-human antibody and a heavy chain variable region of a humanized antibody.
[0050] The term “antibody” refers to intact antibody, monoclonal, (fully or partially) humanized, hybrid, chimeric or polyclonal antibodies as well as isolated human antibodies. The term “antibody” also encompasses multispecific antibodies such as bispecific antibodies. Human antibodies are usually made of two light chains and two heavy chains each comprising variable regions and constant regions. The light chain variable region comprises 3 CDRs, identified herein as CDRL1, CDRL2 and CDRL3 flanked by framework regions. The heavy chain variable region comprises 3 CDRs, identified herein as CDRH1, CDRH2 and CDRH3 flanked by framework regions.
[0051] The term “humanized antibody” refers to an antibody comprising from one to six CDR(s) comprising non-human CDR amino acid residues and substantial portion of its heavy chain and/or light chain framework region that is from the human antibody repertoire. In some instance, the totality of the heavy chain and/or light chain framework region of the humanized antibody may be identical to those of an antibody that is encoded (encodable) by the human antibody repertoire (a natural human antibody). In other instances, the heavy chain and/or light chain framework region of the humanized antibody may comprises from one to thirty amino acids from the non-human antibody which is sought to be humanized and the remaining portion being of from a natural human antibody. In additional instances, the humanized antibody may comprise from 1 to 6 fully non-human CDRs and often the six CDRs are fully non-human. In yet other instances, a “humanized antibody” may comprise a constant region that is or human or other origin (from a mammal).
[0052] The term “hybrid antibody” refers to an antibody comprising one of its heavy or light chain variable region (its heavy or light chain) that is humanized or from a natural human antibody (having affinity for clusterin) while the other of the heavy or light chain variable region (the heavy or light chain) remains non-human.
[0053] The term “chimeric antibody” refers to an antibody having non-human variable region(s) and human constant region.
[0054] The term “natural human antibody” refers to an antibody that is encoded (encodable) by the human antibody repertoire, i.e., germline sequence.
[0055] As used herein, an isolated human antibody is “derived from” a particular germline sequence if the antibody is obtained from a system using human immunoglobulin sequences, e.g., by immunizing a transgenic mouse carrying human immunoglobulin genes or by screening a human immunoglobulin gene library. An isolated human antibody that is “derived from” a human germline immunoglobulin sequence can be identified as such by comparing the amino acid sequence of the human antibody to the amino acid sequence of human germline immunoglobulins. A selected human antibody typically is at least 90% identical in amino acids sequence to an amino acid sequence encoded by a human germline immunoglobulin gene and contains amino acid residues that identify the human antibody as being human when compared to the germline immunoglobulin amino acid sequences of other species (e.g., murine germline sequences). In certain cases, a human antibody may be at least 95%, or even at least 96%, 97%, 98%, or 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene. Typically, a human antibody derived from a particular human germline sequence will display no more than 10 amino acid differences from the amino acid sequence encoded by the human germline immunoglobulin gene. In certain cases, the human antibody may display no more than 5, or even no more than 4, 3, 2, or 1 amino acid difference from the amino acid sequence encoded by the germline immunoglobulin gene.
[0056] The term “antigen-binding fragment”, as used herein, refers to one or more fragments of an antibody that retain the ability to bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by fragments of an intact antibody.
[0057] Examples of binding fragments encompassed within the term “antigen-binding fragment” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V.sub.L, V.sub.H, C.sub.L and C.sub.HI domains; (ii) a F(ab′).sub.2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V.sub.H and C.sub.HI domains; (iv) a Fv fragment consisting of the V.sub.L and V.sub.H domains of a single arm of an antibody, and (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a V.sub.H domain. Furthermore, although the two domains of the Fv fragment, V.sub.L and V.sub.H, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single polypeptide chain in which the V.sub.L and V.sub.H regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). Such single chain antibodies are also intended to be encompassed within the term “antigen-binding fragment” of an antibody. Furthermore, the antigen-binding fragments include binding-domain immunoglobulin fusion proteins comprising (i) a binding domain polypeptide (such as a heavy chain variable region, a light chain variable region, or a heavy chain variable region fused to a light chain variable region via a linker peptide) that is fused to an immunoglobulin hinge region polypeptide, (ii) an immunoglobulin heavy chain CH2 constant region fused to the hinge region, and (iii) an immunoglobulin heavy chain CH3 constant region fused to the CH2 constant region. The hinge region may be modified by replacing one or more cysteine residues with serine residues so as to prevent dimerization. Such binding-domain immunoglobulin fusion proteins are further disclosed in US 2003/0118592 and US 2003/0133939. These antibody fragments are obtained using conventional techniques known to those with skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
[0058] A typical antigen binding site is comprised of the variable regions formed by the pairing of a light chain immunoglobulin and a heavy chain immunoglobulin. The structure of the antibody variable regions is very consistent and exhibits very similar structures. These variable regions are typically comprised of relatively homologous framework regions (FR) interspaced with three hypervariable regions termed Complementarity Determining Regions (CDRs). The overall binding activity of the antigen binding fragment is often dictated by the sequence of the CDRs. However, the FRs often play a role in the proper positioning and alignment in three dimensions of the CDRs for optimal antigen binding.
[0059] A humanized or hybrid antibody of the present invention may comprise a heavy chain variable region which may include non-human complementarity determining region amino acid residues and human framework region amino acid residues of a natural human antibody and a complementary light chain.
[0060] A humanized or hybrid antibody of the present invention may comprise a light chain variable region which may include non-human complementarity determining region amino acid residues and human framework region amino acid residues of a natural human antibody and a complementary heavy chain.
[0061] A humanized or hybrid antibody of the present invention may inhibit metastasis, tumor cell migration or invasion or may inhibit the growth of clusterin-expressing cells including, for example, carcinoma cells. In fact, the Applicant came to the unexpected discovery that anti-clusterin antibodies including the humanized or hybrid antibodies of the present invention reduce tumor volume in vivo. Alternatively, the humanized or hybrid antibody of the present invention may be used to detect clusterin-expressing cells.
[0062] The natural human antibody that is selected for humanization of the non-human parent antibody may comprise a variable region having a three-dimensional structure similar to that of (superimposable to) a (modeled) variable region of the non-human parent antibody. As such, the humanized or hybrid antibody has a greater chance of having a three-dimensional structure similar to that of the non-human parent antibody.
[0063] The humanized antibody of the present invention has a high affinity for clusterin. In fact, it has been shown herein that the humanized antibody binds to recombinant monomeric clusterin with an affinity of 4.49×10.sup.−9 M±8.5×10.sup.−10 or better.
[0064] In accordance with the present invention, the human framework region amino acid residues of the humanized or hybrid antibody light chain are from a natural human antibody light chain framework region. The light chain framework region of the natural human antibody selected for humanization purposes, may have, for example, at least 70% identity with a light chain framework region of the non-human parent antibody. Preferably, the natural human antibody selected for humanization purposes may have the same or substantially the same number of amino acids in its light chain complementarity determining region to that of a light chain complementarity determining region of the non-human parent antibody.
[0065] In other embodiments of the invention, the human framework region amino acid residues of the humanized or hybrid antibody light chain are from a natural human antibody light chain framework region having at least 75, 80, 83% identity (or more) with the light chain framework region of the non-human parent antibody.
[0066] Also in accordance with the present invention, the human framework region amino acid residues of the humanized or hybrid antibody heavy chain are from a natural human antibody heavy chain framework region having at least 70% identity with a heavy chain framework region of the non-human parent antibody. Preferably, the natural human antibody selected for humanization purposes may have the same or substantially the same number of amino acids in its heavy chain complementarity determining region to that of a heavy chain complementarity determining region of the non-human parent antibody.
[0067] In other embodiments of the invention, the human framework region amino acid residues of the humanized or hybrid antibody heavy chain are from a natural human antibody heavy chain framework region having at least 73, 75, 80% identity with the heavy chain framework region of the non-human parent antibody.
[0068] In an embodiment of the invention, the heavy chain variable region of the humanized or hybrid antibody may thus comprise at least one non-human complementarity determining region.
[0069] Alternatively, in other embodiments of the invention, the heavy chain variable region of the humanized or hybrid antibody may comprise at least two non-human complementarity determining regions or even three non-human complementarity determining regions.
[0070] In an additional embodiment of the invention, the light chain variable region may comprise at least one non-human complementarity determining region.
[0071] Alternatively, in yet additional embodiments of the invention, the light chain variable region comprise at least two non-human complementarity determining regions or even three non-human complementarity determining regions.
[0072] The humanized antibody may thus advantageously comprise all six CDRs of the non-human antibody. In the case of a divalent humanized antibody, all twelve CDRs may be from the non-human antibody.
[0073] Clusterin-expressing cells which may be detected by a humanized or hybrid antibody comprises carcinoma cells. The humanized or hybrid antibody may also be used to inhibit the growth of clusterin-expressing carcinoma cells and especially, human carcinoma cells.
[0074] Several types of human carcinoma cells have been shown to express or secrete clusterin, amongst which, cells of endometrial carcinoma, of breast carcinoma, of hepatocellular carcinoma, of prostate carcinoma, of renal cell carcinoma, of ovarian carcinoma, of colorectal cancer, of pancreatic carcinoma, etc.
[0075] An exemplary embodiment of the invention includes, for example, the humanized or hybrid antibody comprising human framework region amino acid residues of the natural human antibody heavy chain as described herein and heavy chain CDR selected from the group consisting of a CDRH1 having an amino acid sequence of SEQ ID NO.:1, a CDRH2 having an amino acid sequence of SEQ ID NO.:2 and a CDRH3 having an amino acid sequence of SEQ ID NO.:3 and combination thereof or heavy chain CDR selected from the group consisting of a CDRH1 having an amino acid sequence of SEQ ID NO.:11, a CDRH2 having an amino acid sequence of SEQ ID NO.:12 and a CDRH3 having an amino acid sequence of SEQ ID NO.:13 and combination thereof.
[0076] In another exemplary embodiment, the humanized or hybrid antibody may comprise human framework region amino acid residues of the natural human antibody heavy chain as described herein and at least two heavy chain CDRs selected from the group consisting of a CDRH1 having an amino acid sequence of SEQ ID NO.:1, a CDRH2 having an amino acid sequence of SEQ ID NO.:2 and a CDRH3 having an amino acid sequence of SEQ ID NO.:3 or at least two heavy chain CDRs selected from the group consisting of a CDRH1 having an amino acid sequence of SEQ ID NO.:11, a CDRH2 having an amino acid sequence of SEQ ID NO.:12 and a CDRH3 having an amino acid sequence of SEQ ID NO.:13 and combination thereof.
[0077] Alternatively, in another exemplary embodiment, the humanized or hybrid antibody of the present invention may comprise human framework region amino acid residues of the natural human antibody heavy chain as described herein and a CDRH1 having an amino acid sequence of SEQ ID NO.:1, a CDRH2 having an amino acid sequence of SEQ ID NO.:2 and a CDRH3 having an amino acid sequence of SEQ ID NO.:3 or a CDRH1 having an amino acid sequence of SEQ ID NO.:11, a CDRH2 having an amino acid sequence of SEQ ID NO.:12 and a CDRH3 having an amino acid sequence of SEQ ID NO.:13.
[0078] In a more specific embodiment of the invention, the humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a light chain variable region comprising SEQ ID NO.:26 (h16B5 VL consensus1): DIVMXQSPXSLAVSXGEXXTXXCKSSQSLLNSRTRKNYLAWYQQKPGQXPKLLIYWASTRESGVPDRFXGSGSGTDFTLTISSXQAEDXAVYYCKQSYNLWTFGXGTKLEXK; wherein at least one of the amino acid identified by X is an amino acid substitution in comparison with a corresponding amino acid in the polypeptide set forth in SEQ ID NO.:25 (the murine 16B5 VL). The amino acid substitution may be, for example conservative or non-conservative. In accordance with the invention, the amino acid substitution may be conservative.
[0079] The humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a light chain variable region comprising SEQ ID NO.:27 (16B5 VL consensus2): DIVMX.sub.a1QSPX.sub.a2SLAVSX.sub.a3GEX.sub.a4X.sub.a5TX.sub.a6X.sub.a7CKSSQSLLNSRTRKNYLAWYQQKPGQX.sub.a8PKLLIYWASTRESGVPDRFX.sub.a9GSGSGTDFTLTISSX.sub.a10QAEDX.sub.a11AVYYCKQSYNLWTFGX.sub.a12GTKLEX.sub.a13K;
[0080] Wherein X.sub.a1 may be a neutral hydrophilic amino acid such as for example, T or S;
[0081] Wherein X.sub.a2 may be for example D or S;
[0082] Wherein X.sub.a3 may be an hydrophobic amino acid such as for example, L or A;
[0083] Wherein X.sub.a4 may be a basic amino acid such as for example R or K;
[0084] Wherein X.sub.a5 may be an hydrophobic amino acid such as for example A or V;
[0085] Wherein X.sub.a6 may be an hydrophobic amino acid as for example I or M;
[0086] Wherein X.sub.a7 may be for example N or S;
[0087] Wherein X.sub.a8 may be for example P or S;
[0088] Wherein X.sub.a9 may be a neutral hydrophilic amino acid such as for example S or T;
[0089] Wherein X.sub.a10 may be an hydrophobic amino acid such as for example L or V;
[0090] Wherein X.sub.a11 may be an hydrophobic amino acid such as for example V or L;
[0091] Wherein X.sub.a12 may be for example Q or G;
[0092] Wherein X.sub.a13 may be for example I or F and;
[0093] wherein the light chain variable region may comprise at least one of the above amino acid substitution in comparison with SEQ ID NO.:25.
[0094] The humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a light chain variable region comprising SEQ ID NO.:28 (16B5 VL consensus3): DIVMX.sub.a1QSPX.sub.a2SLAVSX.sub.a3GEX.sub.a4X.sub.a5TX.sub.a6X.sub.a7CKSSQSLLNSRTRKNYLAWYQQKPGQX.sub.a8PKLLIYWASTRESGVPDRFX.sub.a9GSGSGTDFTLTISSX.sub.a10QAEDX.sub.a11AVYYCKQSYNLWTFGX.sub.a12GTKLEX.sub.a13K;
[0095] Wherein X.sub.a1 may be for example, T or S;
[0096] Wherein X.sub.a2 may be for example D or S;
[0097] Wherein X.sub.a3 may be for example, L or A;
[0098] Wherein X.sub.a4 may be for example R or K;
[0099] Wherein X.sub.a5 may be for example A or V;
[0100] Wherein X.sub.a6 may be for example I or M;
[0101] Wherein X.sub.a7 may be for example N or S;
[0102] Wherein X.sub.a8 may be for example P or S;
[0103] Wherein X.sub.a9 may be for example S or T;
[0104] Wherein X.sub.a10 may be for example L or V;
[0105] Wherein X.sub.a11 may be for example V or L;
[0106] Wherein X.sub.a12 may be for example Q or G;
[0107] Wherein X.sub.a13 may be for example I or F and;
[0108] wherein the light chain variable region may comprise at least one of the above amino acid substitution in comparison with SEQ ID NO.:25.
[0109] In another more specific embodiment of the invention, the humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a heavy chain variable region comprising SEQ ID NO.:30 (16B5 VH consensus1); XVQLXQSGAEXXKPGAXVXXSCXXSGFNIKDIYMIIWVXQXPXXGLEWXGRIDPAYGNTKYDPKFQGXXTITADTSXXTAYXXLSSLXSEDTAVYYCARRYDTAMDYWGQGTXVTVSS;
[0110] wherein at least one of the amino acid identified by X is an amino acid substitution in comparison with a corresponding amino acid in the polypeptide set forth in SEQ ID NO.:29 (the murine 16B5 VH). The amino acid substitution may be, for example conservative or non-conservative. In accordance with the invention, the amino acid substitution may be conservative.
[0111] The humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a heavy chain variable region comprising SEQ ID NO.:31 (16B5 VH consensus2): X.sub.b1VQLX.sub.b2QSGAEX.sub.b3X.sub.b4KPGAX.sub.b5VX.sub.b6X.sub.b7SCX.sub.b8X.sub.b9SGFNIKDIYMHWVX.sub.b10QX.sub.b11PX.sub.b12X.sub.b13GLEWX.sub.b14GRIDPAYGNTKYDPKFQGX.sub.b15X.sub.b16TITADTSX.sub.b17X.sub.b18TAYX.sub.b19X.sub.b20LSSLX.sub.b21SEDTAVYYCARRYDTAMDYWGQGTX.sub.b22VTVSS;
[0112] Wherein X.sub.b1 may be for example Q or E;
[0113] Wherein X.sub.b2 may be for example V or Q;
[0114] Wherein X.sub.b3 may be an hydrophobic amino acid such as for example V or L;
[0115] Wherein X.sub.b4 may be for example K or V;
[0116] Wherein X.sub.b5 may be a neutral hydrophilic amino acid such as for example T or S;
[0117] Wherein X.sub.b6 may be a basic amino acid such as for example K or R;
[0118] Wherein X.sub.b7 may be an hydrophobic amino acid such as for example I or L;
[0119] Wherein X.sub.b8 may be for example K or T;
[0120] Wherein X.sub.b9 may be for example V or T;
[0121] Wherein X.sub.b10 may be a basic amino acid such as for example Q or K;
[0122] Wherein X.sub.b11 may be for example A or R;
[0123] Wherein X.sub.b12 may be for example G or E;
[0124] Wherein X.sub.b13 may be a basic amino acid such as for example K or Q;
[0125] Wherein X.sub.b14 may be an hydrophobic amino acid such as for example M or I;
[0126] Wherein X.sub.b15 may be a basic amino acid such as for example R or K;
[0127] Wherein X.sub.b16 may be an hydrophobic amino acid such as for example V or A;
[0128] Wherein X.sub.b17 may be a neutral hydrophilic amino acid such as for example T or S;
[0129] Wherein X.sub.b18 may be for example D or N;
[0130] Wherein X.sub.b19 may be an hydrophobic amino acid such as for example M or L;
[0131] Wherein X.sub.b20 may be for example E or Q;
[0132] Wherein X.sub.b21 may be for example R or T;
[0133] Wherein X.sub.b22 may be as for example L or S and;
[0134] wherein the heavy chain variable region may comprise at least one of the above amino acid substitution in comparison with SEQ ID NO.:29.
[0135] The humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a heavy chain variable region comprising SEQ ID NO.:32 (16B5 VH consensus3): X.sub.b1VQLX.sub.b2QSGAEX.sub.b3X.sub.b4KPGAX.sub.b5VX.sub.b6X.sub.b7SCX.sub.b8X.sub.b9SGFNIKDIYMHWVX.sub.b10QX.sub.b11PX.sub.b12X.sub.b13GLEWX.sub.b14GRIDPAYGNTKYDPKFQGX.sub.b15X.sub.b16TITADTSX.sub.b17X.sub.b18TAYX.sub.b19X.sub.b20LSSLX.sub.b21SEDTAVYYCARRYDTAMDYWGQGTX.sub.b22VTVSS;
[0136] Wherein X.sub.b1 may be for example Q or E;
[0137] Wherein X.sub.b2 may be for example V or Q;
[0138] Wherein X.sub.b3 may be for example V or L;
[0139] Wherein X.sub.b4 may be for example K or V;
[0140] Wherein X.sub.b5 may be for example T or S;
[0141] Wherein X.sub.b6 may be for example K or R;
[0142] Wherein X.sub.b7 may be for example I or L;
[0143] Wherein X.sub.b8 may be for example K or T;
[0144] Wherein X.sub.b9 may be for example V or T;
[0145] Wherein X.sub.b10 may be for example Q or K;
[0146] Wherein X.sub.b11 may be for example A or R;
[0147] Wherein X.sub.b12 may be for example G or E;
[0148] Wherein X.sub.b13 may be for example K or Q;
[0149] Wherein X.sub.b14 may be for example M or I;
[0150] Wherein X.sub.b15 may be for example R or K;
[0151] Wherein X.sub.b16 may be for example V or A;
[0152] Wherein X.sub.b17 may be for example T or S;
[0153] Wherein X.sub.b18 may be for example D or N;
[0154] Wherein X.sub.b19 may be for example M or L;
[0155] Wherein X.sub.b20 may be for example E or Q;
[0156] Wherein X.sub.b21 may be for example R or T;
[0157] Wherein X.sub.b22 may be for example L or S and;
[0158] wherein the heavy chain variable region may comprise at least one of the above amino acid substitution in comparison with SEQ ID NO.:29.
[0159] In an additional specific embodiment of the invention the humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a light chain variable region comprising SEQ ID NO.:34 (21B12 VL consensus1): DIVMX.sub.cQSPXSLAVSXGEXXTXXCKSSQSLLYSSNQKNYLAWYQQXPGQXPKLLIYWASTRESGVPDRFXGSGSGTDFTLTISSXXAEDXAVYYCQQYYIYPRTFGXGTKLEIK;
[0160] wherein at least one of the amino acid identified by X is an amino acid substitution in comparison with a corresponding amino acid in the polypeptide set forth in SEQ ID NO.:33 (the murine 21B12 VL). The amino acid substitution may be, for example conservative or non-conservative. In accordance with the invention, the amino acid substitution may be conservative.
[0161] The humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a light chain variable region comprising SEQ ID NO.:35 (21B12 VL consensus2): DIVMX.sub.c1QSPX.sub.c2SLAVSX.sub.c3GEX.sub.c4X.sub.c5TX.sub.c6X.sub.c7CKSSQSLLYSSNQKNYLAWYQQX.sub.c8PGQX.sub.c9PKLLIYWASTRESGVPDRFX.sub.c10GSGSGTDFTLTISSX.sub.c11X.sub.c12AEDX.sub.c13AVYYCQQYYIYPRTFGX.sub.c14GTKLEIK;
[0162] Wherein X.sub.c1 may be a neutral hydrophilic amino acid such as for example T or S;
[0163] Wherein X.sub.c2 may be for example D or S;
[0164] Wherein X.sub.c3 may be an hydrophobic amino acid such as for example L or V;
[0165] Wherein X.sub.c4 may be a basic amino acid such as for example R or K;
[0166] Wherein X.sub.c5 may be an hydrophobic amino acid such as for example A or V;
[0167] Wherein X.sub.c6 may be an hydrophobic amino acid such as for example I or M;
[0168] Wherein X.sub.c7 may be for example N or S;
[0169] Wherein X.sub.c8 may be a basic amino acid such as for example K or R;
[0170] Wherein X.sub.c9 may be for example P or S;
[0171] Wherein X.sub.c10 may be a neutral hydrophilic amino acid such as for example S or T;
[0172] Wherein X.sub.c11 may be an hydrophobic amino acid such as for example L or V;
[0173] Wherein X.sub.c12 may be a basic amino acid such as for example Q or K;
[0174] Wherein X.sub.c13 may be an hydrophobic amino acid such as for example V or L;
[0175] Wherein X.sub.c14 may be for example Q or G and;
[0176] wherein the light chain variable region may comprise at least one of the above amino acid substitution in comparison with SEQ ID NO.:33.
[0177] The humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a light chain variable region comprising SEQ ID NO.:36 (21B12 VL consensus3): DIVMX.sub.c1QSPX.sub.c2SLAVSX.sub.c3GEX.sub.c4X.sub.c5TX.sub.c6X.sub.c7CKSSQSLLYSSNQKNYLAWYQQX.sub.c8PGQX.sub.c9PKLLIYWASTRESGVPDRFX.sub.c10GSGSGTDFTLTISSX.sub.c11X.sub.c12AEDX.sub.c13AVYYCQQYYIYPRTFGX.sub.c14GTKLEIK;
[0178] Wherein X.sub.c1 may be T or S;
[0179] Wherein X.sub.c2 may be for example D or S;
[0180] Wherein X.sub.c3 may be L or V;
[0181] Wherein X.sub.c4 may be R or K;
[0182] Wherein X.sub.c5 may be for example A or V;
[0183] Wherein X.sub.c6 may be for example I or M;
[0184] Wherein X.sub.c7 may be for example N or S;
[0185] Wherein X.sub.c8 may be for example K or R;
[0186] Wherein X.sub.c9 may be for example P or S;
[0187] Wherein X.sub.c10 may be for example S or T;
[0188] Wherein X.sub.c11 may be for example L or V;
[0189] Wherein X.sub.c12 may be for example Q or K;
[0190] Wherein X.sub.c13 may be for example V or L;
[0191] Wherein X.sub.c14 may be for example Q or G and;
[0192] wherein the light chain variable region may comprise at least one of the above amino acid substitution in comparison with SEQ ID NO.:33.
[0193] In a further exemplary embodiment of the invention, the humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a heavy chain variable region comprising SEQ ID NO.:38 (21B12 VH consensus1): QXQLVQSGXELKKPGXXVKXSCKASGYTFTNYGMHWVXQAPGXGLXWMGWINTYTGEPTYADDFKGRFXFSLXTSXSTAYLQIXXLKXEDTAXYXCARDGFLYFFDYWGQGTXXTVSS;
[0194] wherein at least one of the amino acid identified by X is an amino acid substitution in comparison with a corresponding amino acid in the polypeptide set forth in SEQ ID NO.:37 (the murine 21B12 VH). The amino acid substitution may be, for example conservative or non-conservative. In accordance with the invention, the amino acid substitution may be conservative.
[0195] The humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a heavy chain variable region comprising SEQ ID NO.:39 (21B12 VH consensus2): QX.sub.d1QLVQSGX.sub.d2ELKKPGX.sub.d3X.sub.d4VKX.sub.d5SCKASGYTFTNYGMHWVX.sub.d6QAPGX.sub.d7GLX.sub.d8WMGWINTYTGEPTYADDFKGRFX.sub.d9FSLX.sub.d10TSX.sub.d11STAYLQIX.sub.d12X.sub.d13LKX.sub.d14EDTAX.sub.d15YX.sub.d16CARDGFLYFFDYWGQGTX.sub.d17X.sub.d18TVSS;
[0196] Wherein X.sub.d1 may be an hydrophobic amino acid such as for example V or I;
[0197] Wherein X.sub.d2 may be for example S or P;
[0198] Wherein X.sub.d3 may be for example A or E;
[0199] Wherein X.sub.d4 may be a neutral hydrophilic amino acid such as for example S or T;
[0200] Wherein X.sub.d5 may be an hydrophobic amino acid such as for example V or I;
[0201] Wherein X.sub.d6 may be a basic amino acid such as for example R or K;
[0202] Wherein X.sub.d7 may be a basic amino acid such as for example Q or K;
[0203] Wherein X.sub.d8 may be for example E or K;
[0204] Wherein X.sub.d9 may be an hydrophobic amino acid such as for example V or A;
[0205] Wherein X.sub.d10 may be an acidic amino acid such as for example D or E;
[0206] Wherein X.sub.d11 may be an hydrophobic amino acid such as for example V or A;
[0207] Wherein X.sub.d12 may be for example S or N;
[0208] Wherein X.sub.d13 may be for example S or N;
[0209] Wherein X.sub.d14 may be for example A or N;
[0210] Wherein X.sub.d15 may be for example V or T;
[0211] Wherein X.sub.d16 may be an aromatic amino acid such as for example Y or F;
[0212] Wherein X.sub.d17 may be for example L or T;
[0213] Wherein X.sub.d18 may an hydrophobic amino acid such as for example V or L and;
[0214] wherein the heavy chain variable region may comprise at least one of the above amino acid substitution in comparison with SEQ ID NO.:37.
[0215] The humanized or hybrid antibody (or any antigen binding fragment derived therefrom) may comprise a heavy chain variable region comprising SEQ ID NO.:40 (21B12 VH consensus3): QX.sub.d1QLVQSGX.sub.d2ELKKPGX.sub.d3X.sub.d4VKX.sub.d5SCKASGYTFTNYGMHWVX.sub.d6QAPGX.sub.d7GLX.sub.d8WMGWINTYTGEPTYADDFKGRFX.sub.d9FSLX.sub.d10TSX.sub.d11STAYLQIX.sub.d12X.sub.d13LKX.sub.d14EDTAX.sub.d15YX.sub.d16CARDGFLYFFDYWGQGTX.sub.d17X.sub.d18TVSS;
[0216] Wherein X.sub.d1 may be for example V or I;
[0217] Wherein X.sub.d2 may be for example S or P;
[0218] Wherein X.sub.d3 may be for example A or E;
[0219] Wherein X.sub.d4 may be for example S or T;
[0220] Wherein X.sub.d5 may be for example V or I;
[0221] Wherein X.sub.d6 may be for example R or K;
[0222] Wherein X.sub.d7 may be for example Q or K;
[0223] Wherein X.sub.d8 may be for example E or K;
[0224] Wherein X.sub.d9 may be for example V or A;
[0225] Wherein X.sub.d10 may be for example D or E;
[0226] Wherein X.sub.d11 may be for example V or A;
[0227] Wherein X.sub.d12 may be for example S or N;
[0228] Wherein X.sub.d13 may be for example S or N;
[0229] Wherein X.sub.d14 may be for example A or N;
[0230] Wherein X.sub.d15 may be for example V or T;
[0231] Wherein X.sub.d16 may be for example Y or F;
[0232] Wherein X.sub.d17 may be for example L or T;
[0233] Wherein X.sub.d18 may be for example V or L and;
[0234] wherein the heavy chain variable region may comprise at least one of the above amino acid substitution in comparison with SEQ ID NO.:37.
[0235] In a more specific embodiment, the humanized or hybrid antibody may comprise a heavy chain variable region having an amino acid sequence of SEQ ID NO.:7 or SEQ ID NO.:17.
[0236] Yet a more specific embodiment of the invention includes a humanized or hybrid antibody which may comprise a heavy chain having an amino acid sequence of SEQ ID NO.:9 or SEQ ID NO.:19.
[0237] The humanized or hybrid antibody of the present invention may have a heavy chain or heavy chain variable region as specified herein and a complementary light chain or light chain variable region.
[0238] On the other hand, the humanized or hybrid antibody of the present invention may have a light chain or light chain variable region as specified herein and a complementary heavy chain or heavy chain variable region.
[0239] The humanized or hybrid antibody of the present invention may thus comprise human framework region amino acid residues of the natural human antibody light chain as described herein and a light chain CDR selected, for example, from the group consisting of a CDRL1 having an amino acid sequence of SEQ ID NO.:4, a CDRL2 having an amino acid sequence of SEQ ID NO.:5 and a CDRL3 having an amino acid sequence of SEQ ID NO.:6 or heavy chain CDR selected from the group consisting of a CDRL1 having an amino acid sequence of SEQ ID NO.:14, a CDRL2 having an amino acid sequence of SEQ ID NO.:15 and a CDRL3 having an amino acid sequence of SEQ ID NO.:16 and combination thereof.
[0240] In a further embodiment, the humanized or hybrid antibody may comprise human framework region amino acid residues of the natural human antibody light chain as described herein and at least two light chain CDRs selected from the group consisting of a CDRL1 having an amino acid sequence of SEQ ID NO.:4, a CDRL2 having an amino acid sequence of SEQ ID NO.:5 and a CDRL3 having an amino acid sequence of SEQ ID NO.:6 or at least two heavy chain CDRs selected from the group consisting of a CDRL1 having an amino acid sequence of SEQ ID NO.:14, a CDRL2 having an amino acid sequence of SEQ ID NO.:15 and a CDRL3 having an amino acid sequence of SEQ ID NO.:16 and combination thereof.
[0241] In yet a further embodiment, the humanized or hybrid antibody may comprise human framework region amino acid residues of the natural human antibody light chain as described herein and a CDRL1 having an amino acid sequence of SEQ ID NO.:4, a CDRL2 having an amino acid sequence of SEQ ID NO.:5 and a CDRL3 having an amino acid sequence of SEQ ID NO.:6 or a CDRL1 having an amino acid sequence of SEQ ID NO.:14, a CDRL2 having an amino acid sequence of SEQ ID NO.:15 and a CDRL3 having an amino acid sequence of SEQ ID NO.:16 and combination thereof.
[0242] In a more particular embodiment, the humanized or hybrid antibody may comprise a light chain variable region having an amino acid sequence of SEQ ID NO.:8 or SEQ ID NO.:18.
[0243] In an even more particular embodiment, the humanized or hybrid antibody of the present invention may comprise a light chain having an amino acid sequence of SEQ ID NO.:10 or SEQ ID NO.:20.
[0244] Other specific embodiments of the invention encompass a humanized antibody having a heavy chain variable region having an amino acid sequence of SEQ ID NO.:7 or SEQ ID NO.:17 and a light chain variable region having an amino acid sequence of SEQ ID NO.:8 or SEQ ID NO.:18.
[0245] An additional specific embodiment of the invention encompass a humanized antibody having a heavy chain having an amino acid sequence of SEQ ID NO.:9 and a light chain having an amino acid sequence of SEQ ID NO.:10.
[0246] Yet, an additional specific embodiment of the invention encompass a humanized antibody having a heavy chain having an amino acid sequence of SEQ ID NO.:19 and a light chain having an amino acid sequence of SEQ ID NO.:20.
[0247] The present invention relates in a further aspect to an antibody or antigen binding fragment thereof which may be capable of specific binding to clusterin and which may be selected from the group consisting of: [0248] an antibody or antigen binding fragment thereof which may have a light chain variable region at least 80% identical (e.g., 85%, 90%, 95%, 99%) to SEQ ID NO.:25 and/or a heavy chain variable region at least 80% identical (e.g., 85%, 90%, 95%, 99%) to SEQ ID NO.:29 wherein the antibody or antigen binding fragment thereof may comprise, for example, at least one amino acid substitution in comparison with SEQ ID NO.:25 or SEQ ID NO.:29 and wherein the amino acid substitution may be, for example, outside of a complementarity determining region (CDR) and; [0249] an antibody or antigen binding fragment thereof which may have a light chain variable region at least 80% identical (e.g., 85%, 90%, 95%, 99%) to SEQ ID NO.:33 and/or a heavy chain variable region at least 80% identical (e.g., 85%, 90%, 95%, 99%) to SEQ ID NO.:37 wherein the antibody or antigen binding fragment thereof may comprise at least one amino acid substitution in comparison with SEQ ID NO.:33 or SEQ ID NO.:37 and wherein the amino acid substitution may be, for example, outside of a complementarity determining region (CDR).
[0250] In accordance with the present invention, the at least one amino acid substitution may be, for example, in the light chain variable region.
[0251] In accordance with the present invention, the at least one amino acid substitution may be, for example, in the heavy chain variable region.
[0252] The amino acid substitution may be conservative or non-conservative. In a more specific embodiment, the amino acid substitution may be conservative.
[0253] In accordance with an embodiment of the invention, the antibodies and antigen binding fragments of the present invention bind human clusterin. In accordance with another embodiment of the invention, the antibodies and antigen binding fragments of the present invention bind murine clusterin. The antibodies and antigen binding fragment of the present invention may also bind a naturally occurring or synthetic variant of murine of human clusterin. Such variant may have, for example, at least 75% amino acid sequence identity with human clusterin or with murine clusterin.
[0254] The CDRs of SEQ ID NO.:29 (identical to those of SEQ ID NOs. 30, 31, 32 and 7) were identified using the Kabat and Chothia definitions. The corresponding CDR sequences are identified herein as follow; the CDR1 of the heavy chain variable region corresponds to SEQ ID NO.:1, the CDR2 of the heavy chain variable region corresponds to SEQ ID NO.:2 and the CDR3 of the heavy chain variable region corresponds to SEQ ID NO.:3.
[0255] Shorter versions of SEQ ID NOs.:1, 2 and 3 were presented in international application No. PCT/CA2006/001505 filed on Sep. 13, 2006 (i.e., the 1505 appl.) and published under No. WO2007/030930. In this patent application, the CDRs of SEQ ID NO.:29 (corresponding to SEQ ID NO.:23 in the '1505 appl.) were identified with the IMGT/V quest software that implements the IMGT definition. The corresponding sequences are identified herein as follow; the CDR1 of the heavy chain variable region corresponds to SEQ ID NO.:44, the CDR2 of the heavy chain variable region corresponds to SEQ ID NO.:45 and the CDR3 of the heavy chain variable region corresponds to SEQ ID NO.:46.
[0256] As used herein the term “amino acid substitution . . . outside of a complementarity determining region (CDR)” with respect to SEQ ID NO.:29 generally refers to amino acids (outside of) surrounding SEQ ID NOs.:1, 2 and 3. In some embodiments this term may alternatively refer to amino acids (outside of) surrounding SEQ ID NOs.:44, 45 and 46.
[0257] The CDRs of SEQ ID NO.:25 (identical to those of SEQ ID NOs. 26, 27, 28 and 8) were identified using the Kabat and Chothia definitions. The corresponding CDR sequences are identified herein as follow; the CDR1 of the light chain variable region corresponds to SEQ ID NO.:4, the CDR2 of the light chain variable region corresponds to SEQ ID NO.:5 and the CDR3 of the light chain variable region corresponds to SEQ ID NO.:6.
[0258] Shorter versions of SEQ ID NOs. 4, 5 and 6 were presented in international application No. PCT/CA2006/001505 filed on Sep. 13, 2006 (i.e., the 1505 appl.) and published under No. WO2007/030930. In this patent application, the CDRs of SEQ ID NO.:25 (corresponding to SEQ ID NO.:12 in the '1505 appl.) were identified with the IMGT/V quest software that implements the IMGT definition. The corresponding sequences are identified herein as follow; the CDR1 of the light chain variable region corresponds to SEQ ID NO.:47, the CDR2 of the light chain variable region corresponds to amino acid sequence “WAS” and the CDR3 of the light chain variable region corresponds to SEQ ID NO.:49.
[0259] As used herein the term “amino acid substitution . . . outside of a complementarity determining region (CDR)” with respect to SEQ ID NO.:25 generally refers to amino acids (outside of) surrounding SEQ ID NOs.:4, 5 and 6. In some embodiments this term may alternatively refer to amino acids (outside of) surrounding SEQ ID NOs.:47, the CDR2 of the light chain variable region and 49.
[0260] The CDRs of SEQ ID NO.:37 (identical to those of SEQ ID NOs. 38, 39, 40 and 17) were identified using the Kabat and Chothia definitions. The corresponding CDR sequences are identified herein as follow; the CDR1 of the heavy chain variable region corresponds to SEQ ID NO.:11, the CDR2 of the heavy chain variable region corresponds to SEQ ID NO.:12 and the CDR3 of the heavy chain variable region corresponds to SEQ ID NO.:13.
[0261] Shorter versions of SEQ ID NOs.:11, 12 and 13 were presented in international application No. PCT/CA2006/001505 filed on Sep. 13, 2006 (i.e., the 1505 appl.) and published under No. WO2007/030930. In this patent application, the CDRs of SEQ ID NO.:37 (corresponding to SEQ ID NO.:22 in the '1505 appl.) were identified with the IMGT/V quest software that implements the IMGT definition. The corresponding sequences are identified herein as follow; the CDR1 of the heavy chain variable region corresponds to SEQ ID NO.:50, the CDR2 of the heavy chain variable region corresponds to SEQ ID NO.:51 and the CDR3 of the heavy chain variable region corresponds to SEQ ID NO.:52.
[0262] As used herein the term “amino acid substitution . . . outside of a complementarity determining region (CDR)” with respect to SEQ ID NO.:37 generally refers to amino acids (outside of) surrounding SEQ ID NOs.:11, 12 and 13. In some embodiments this term may alternatively refer to amino acids (outside of) surrounding SEQ ID NOs.:50, 51 and 52.
[0263] The CDRs of SEQ ID NO.:33 (identical to those of SEQ ID NOs. 34, 35, 36 and 18) were identified using the Kabat and Chothia definitions. The corresponding CDR sequences are identified herein as follow; the CDR1 of the light chain variable region corresponds to SEQ ID NO.:14, the CDR2 of the light chain variable region corresponds to SEQ ID NO.:15 and the CDR3 of the light chain variable region corresponds to SEQ ID NO.:16.
[0264] Shorter versions of SEQ ID NOs. 14, 15 and 16 were presented in international application No. PCT/CA2006/001505 filed on Sep. 13, 2006 (i.e., the 1505 appl.) and published under No. WO2007/030930. In this patent application, the CDRs of SEQ ID NO.:33 (corresponding to SEQ ID NO.:11 in the '1505 appl.) were identified with the IMGT/V quest software that implements the IMGT definition. The corresponding sequences are identified herein as follow; the CDR1 of the light chain variable region corresponds to SEQ ID NO.:53, the CDR2 of the light chain variable region corresponds to amino acid sequence “WAS” and the CDR3 of the light chain variable region corresponds to SEQ ID NO.:55.
[0265] As used herein the term “amino acid substitution . . . outside of a complementarity determining region (CDR)” with respect to SEQ ID NO.:33 generally refers to amino acids (outside of) surrounding SEQ ID NOs.:14, 15 and 16. In some embodiments this term may alternatively refer to amino acids (outside of) surrounding SEQ ID NOs.:53, the CDR2 of the light chain variable region and 55.
[0266] The humanized antibody of the present invention (or any antigen binding fragment derived therefrom) may comprise a light chain variable region selected from the group consisting of
[0267] SEQ ID NO.:7, SEQ ID NO.:26 or SEQ ID NO.:27 and a heavy chain variable region selected from the group consisting of SEQ ID NO.:8, SEQ ID NO.:29 or SEQ ID NO.:30.
[0268] The hybrid antibody of the present invention (or any antigen binding fragment derived therefrom) may comprise a light chain variable region selected from the group consisting of SEQ ID NO.:7, SEQ ID NO.:26 or SEQ ID NO.:27 and a heavy chain variable region comprising SEQ ID NO.:28.
[0269] Alternatively the hybrid antibody of the present invention (or any antigen binding fragment derived therefrom) may comprise a light chain variable region comprising SEQ ID NO.:25 and a heavy chain variable region selected from the group consisting of SEQ ID NO.:8, SEQ ID NO.:29 or SEQ ID NO.:30.
[0270] The humanized antibody of the present invention (or any antigen binding fragment derived therefrom) may comprise a light chain variable region selected from the group consisting of SEQ ID NO.:18, SEQ ID NO.:32 or SEQ ID NO.:33 and a heavy chain variable region selected from the group consisting of SEQ ID NO.:17, SEQ ID NO.:35 or SEQ ID NO.:36.
[0271] The hybrid antibody of the present invention (or any antigen binding fragment derived therefrom) may comprise a light chain variable region selected from the group consisting of SEQ ID NO.:18, SEQ ID NO.:32 or SEQ ID NO.:33 and a heavy chain variable region comprising SEQ ID NO.:34.
[0272] Alternatively the hybrid antibody of the present invention (or any antigen binding fragment derived therefrom) may comprise a light chain variable region comprising SEQ ID NO.:31 and a heavy chain variable region selected from the group consisting of SEQ ID NO.:17, SEQ ID NO.:35 or SEQ ID NO.:36.
[0273] Another exemplary embodiment of the humanized antibody or antigen binding fragment of the present invention includes for example, an antibody or antigen binding fragment having a light chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID NO.:26, SEQ ID NO.:27, SEQ ID NO.:28 or SEQ ID NO.:8.
[0274] As used herein the term “at least 90 consecutive amino acids of SEQ ID NO.:26” also includes the terms “at least 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111 or at least 112 consecutive amino acids”. The term “at least 90 consecutive amino acids of SEQ ID NO.:26” encompasses any possible sequence of at least 90 consecutive amino acids found in SEQ ID NO.:26 and especially those sequences which include the 3 CDRs of SEQ ID NO.:26, such as, for example a sequence comprising amino acids 6 to 108, 5 to 109, 13 to 103, 9 to 111 of SEQ ID NO.:26 and so on.
[0275] As used herein the term “at least 90 consecutive amino acids of SEQ ID NO.:27” also includes the terms “at least 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111 or at least 112 consecutive amino acids”. The term “at least 90 consecutive amino acids of SEQ ID NO.:27” encompasses any possible sequence of at least 90 consecutive amino acids found in SEQ ID NO.:27 and especially those sequences which include the 3 CDRs of SEQ ID NO.:27, such as, for example a sequence comprising amino acids 7 to 109, 12 to 104, 22 to 113, 18 to 112 of SEQ ID NO.:27 and so on.
[0276] The terms “at least 90 consecutive amino acids of SEQ ID NO.:28” or “at least 90 consecutive amino acids of SEQ ID NO.:8” has a similar meaning.
[0277] In accordance with the present invention, the antibody or antigen binding fragment of the present invention may have, for example, a light chain variable region as set forth in SEQ ID NO.:8.
[0278] Also in accordance with the present invention, the antibody or antigen binding fragment of the present invention may have, for example, a light chain as set forth in SEQ ID NO.:10.
[0279] The humanized antibody or antigen binding fragment of the invention includes (or further includes) for example, a heavy chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID NOs.:30, 31, 32 or 7.
[0280] As used herein the term “at least 90 consecutive amino acids of SEQ ID NO.:30” also includes the terms “at least 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116 or at least 117 consecutive amino acids”. The term “at least 90 consecutive amino acids of SEQ ID NO.:30” encompasses any possible sequence of at least 90 consecutive amino acids found in SEQ ID NO.:30 and especially those sequences which include the 3 CDRs of SEQ ID NO.:30, such as, for example a sequence comprising amino acids 1 to 108, 2 to 112, 11 to 113, 7 to 109 of SEQ ID NO.:30 and so on.
[0281] As used herein the term “at least 90 consecutive amino acids of SEQ ID NO.:31” also includes the terms “at least 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116 or at least 117 consecutive amino acids”. The term “at least 90 consecutive amino acids of SEQ ID NO.:31” encompasses any possible sequence of at least 90 consecutive amino acids found in SEQ ID NO.:31 and especially those sequences which include the 3 CDRs of SEQ ID NO.:31, for example a sequence comprising amino acids 6 to 109, 8 to 113, 1 to 108, 2 to 115 of SEQ ID NO.:31 and so on.
[0282] The terms “at least 90 consecutive amino acids of SEQ ID NO.:32” or “at least 90 consecutive amino acids of SEQ ID NO.:7” has a similar meaning.
[0283] In accordance with the present invention, the antibody or antigen binding fragment of the present invention may have, for example, a heavy chain variable region as set forth in SEQ ID NO.:7.
[0284] Also in accordance with the present invention, the antibody or antigen binding fragment of the present invention may have, for example, a heavy chain as set forth in SEQ ID NO.:9.
[0285] In accordance with the present invention the antibody or antigen binding fragment may comprise, for example, [0286] a) a light chain variable region which may comprise at least 90 consecutive amino acids of SEQ ID NO.:26 and a heavy chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID NO.:30, SEQ ID NO.:31, SEQ ID NO.:32 or SEQ ID NO.:7; [0287] b) a light chain variable region which may comprise at least 90 consecutive amino acids of SEQ ID NO.:27 and a heavy chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID NO.:30, SEQ ID NO.:31, SEQ ID NO.:32 or SEQ ID NO.:7; [0288] c) a light chain variable region which may comprise amino acids at least 90 consecutive amino acids of SEQ ID NO.:28 and a heavy chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID NO.:30, SEQ ID NO.:31, SEQ ID NO.:32 or SEQ ID NO.:7 or; [0289] d) a light chain variable region which may comprise at least 90 consecutive amino acids of SEQ ID NO.:8 and a heavy chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID NO.:30, SEQ ID NO.:31, SEQ ID NO.:32 or SEQ ID NO.:7.
[0290] In accordance with a more specific embodiment of the invention, the light chain variable region may comprise at least 90 consecutive amino acids of SEQ ID NO.:8 and the heavy chain variable region may comprise at least 90 consecutive amino acids of SEQ ID NO.:7.
[0291] In accordance with an even more specific embodiment of the invention, the light chain variable region may be as set forth in SEQ ID NO.:8 and the heavy chain variable region may be as set forth in SEQ ID NO.:7.
[0292] Other exemplary embodiments of the humanized antibodies or antigen binding fragments of the invention are those which may comprise a light chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID Nos. 34, 35, 36 or 18.
[0293] As used herein the term “at least 90 consecutive amino acids of SEQ ID NO.:34” also includes the terms “at least 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112 or at least 113, consecutive amino acids”. The term “at least 90 consecutive amino acids of SEQ ID NO.:34” encompasses any possible sequence of at least 90 consecutive amino acids found in SEQ ID NO.:34 and especially those sequences which include the 3 CDRs of SEQ ID NO.:34, for example a sequence comprising amino acids 6 to 103, 11 to 106, 1 to 106, 3 to 110, 5 to 107 of SEQ ID NO.:34 and so on.
[0294] As used herein the term “at least 90 consecutive amino acids of SEQ ID NO.:35” also includes the terms “at least 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112 or at least 113, consecutive amino acids”. The term “at least 90 consecutive amino acids of SEQ ID NO.:35” encompasses any possible sequence of at least 90 consecutive amino acids found in SEQ ID NO.:35 and especially those sequences which include the 3 CDRs of SEQ ID NO.:35, for example a sequence comprising amino acids 9 to 106, 10 to 113, 1 to 109, 20 to 110, 7 to 107 of SEQ ID NO.:35 and so on.
[0295] The terms “at least 90 consecutive amino acids of SEQ ID NO.:36” or “at least 90 consecutive amino acids of SEQ ID NO.:18” has a similar meaning.
[0296] In accordance with the present invention, the antibody or antigen binding fragment of the present invention may have, for example, a light chain variable region as set forth in SEQ ID NO.:18.
[0297] Also in accordance with the present invention, the antibody or antigen binding fragment of the present invention may have, for example, a light chain as set forth in SEQ ID NO.:20.
[0298] The humanized antibody or antigen binding fragment of the invention includes (or further includes) for example, a heavy chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID NOs.:38, 39, 40 or 17.
[0299] As used herein the term “at least 90 consecutive amino acids of SEQ ID NO.:38” also includes the terms “at least 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117 or at least 118 consecutive amino acids”. The term “at least 90 consecutive amino acids of SEQ ID NO.:38” encompasses any possible sequence of at least 90 consecutive amino acids found in SEQ ID NO.:38 and especially those sequences which include the 3 CDRs of SEQ ID NO.:38, such as, for example a sequence comprising amino acids 6 to 111, 1 to 114, 12 to 109, 5 to 113, 10 to 107 of SEQ ID NO.:38 and so on.
[0300] As used herein the term “at least 90 consecutive amino acids of SEQ ID NO.:39” also includes the terms “at least 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117 or at least 118 consecutive amino acids”. The term “at least 90 consecutive amino acids of SEQ ID NO.:39” encompasses any possible sequence of at least 90 consecutive amino acids found in SEQ ID NO.:39 and especially those sequences which include the 3 CDRs of SEQ ID NO.:39, such as, for example a sequence comprising amino acids 3 to 109, 1 to 115, 1 to 110, 22 to 116, 20 to 115 of SEQ ID NO.:39 and so on.
[0301] The terms “at least 90 consecutive amino acids of SEQ ID NO.:40” or “at least 90 consecutive amino acids of SEQ ID NO.:17” has a similar meaning.
[0302] In accordance with the present invention, the antibody or antigen binding fragment of the present invention may have, for example, a heavy chain variable region as set forth in SEQ ID NO.:17.
[0303] Also in accordance with the present invention, the antibody or antigen binding fragment of the present invention may have, for example, a heavy chain as set forth in SEQ ID NO.:19. In accordance with the present invention the antibody or antigen binding fragment may comprise, for example, [0304] a) a light chain variable region which may comprise at least 90 consecutive amino acids of SEQ ID NO.:34 and a heavy chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID NO.:38, SEQ ID NO.:39, SEQ ID NO.:40 or SEQ ID NO.:17; [0305] b) a light chain variable region which may comprise at least 90 consecutive amino acids of SEQ ID NO.:35 and a heavy chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID NO.:38, SEQ ID NO.:39, SEQ ID NO.:40 or SEQ ID NO.:17; [0306] c) a light chain variable region which may comprise amino acids at least 90 consecutive amino acids of SEQ ID NO.:36 and a heavy chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID NO.:38, SEQ ID NO.:39, SEQ ID NO.:40 or SEQ ID NO.:17 or; [0307] d) a light chain variable region which may comprise at least 90 consecutive amino acids of SEQ ID NO.:18 and a heavy chain variable region which may comprise at least 90 consecutive amino acids of any of SEQ ID NO.:38, SEQ ID NO.:39, SEQ ID NO.:40 or SEQ ID NO.:17.
[0308] In accordance with a more specific embodiment of the invention, the light chain variable region may have at least 90 consecutive amino acids of SEQ ID NO.:18 and the heavy chain variable region may have at least 90 consecutive amino acids of SEQ ID NO.:17.
[0309] In accordance with an even more specific embodiment of the invention, the light chain variable region may be as set forth in SEQ ID NO.:18 and the heavy chain variable region may be as set forth in SEQ ID NO.:17.
[0310] Of course, the light chain or heavy chain or their variable region described herein may also contain a signal peptide. Such signal peptide may be from an original sequence or may be designed to optimize a particular cellular localization of the polypeptide. Of course, desirable signal peptides are those which may allow secretion of the polypeptide (e.g., cleavable).
[0311] The humanized or hybrid antibody of the present invention may have a constant region, preferably a human constant region. Although other subtypes may be selected, the humanized or hybrid antibody may comprise amino acids residues of a constant region of an immunoglobulin of an IgG 1, IgG2 or IgG3 subtype.
[0312] The present invention also relates in another aspect, to an antigen binding fragment comprising a light chain variable region (or a fragment thereof) and a heavy chain variable region (or a fragment thereof), which may include non-human complementarity determining region amino acid residues and human framework region amino acid residues.
[0313] The antigen binding fragment of the present invention may bind to clusterin and may advantageously have a better affinity than an antigen binding fragment of a non-human parent antibody.
[0314] In fact, it has been shown herein that the antigen binding fragment binds to recombinant monomeric clusterin with an affinity of 1.7×10.sup.−8 M±2.97×10.sup.−9 or better.
[0315] In an exemplary embodiment, the antigen binding fragment may comprise human framework region amino acid residues of the natural human antibody heavy chain as described herein and a heavy chain CDR selected from the group consisting of a CDRH1 having an amino acid sequence of SEQ ID NO.:1, a CDRH2 having an amino acid sequence of SEQ ID NO.:2 and a CDRH3 having an amino acid sequence of SEQ ID NO.:3 or a heavy chain CDR selected from the group consisting of a CDRH1 having an amino acid sequence of SEQ ID NO.:11, a CDRH2 having an amino acid sequence of SEQ ID NO.:12 and a CDRH3 having an amino acid sequence of SEQ ID NO.:13.
[0316] In another exemplary embodiment, the antigen binding fragment may comprise human framework region amino acid residues of the natural human antibody heavy chain as described herein and at least two heavy chain CDRs selected from the group consisting of a CDRH1 having an amino acid sequence of SEQ ID NO.:1, a CDRH2 having an amino acid sequence of SEQ ID NO.:2 and a CDRH3 having an amino acid sequence of SEQ ID NO.:3 or at least two heavy chain CDR selected from the group consisting of a CDRH1 having an amino acid sequence of SEQ ID NO.:11, a CDRH2 having an amino acid sequence of SEQ ID NO.:12 and a CDRH3 having an amino acid sequence of SEQ ID NO.:13.
[0317] In yet another exemplary embodiment, the antigen binding fragment may comprise human framework region amino acid residues of the natural human antibody heavy chain as described herein and a CDRH1 having an amino acid sequence of SEQ ID NO.:1, a CDRH2 having an amino acid sequence of SEQ ID NO.:2 and a CDRH3 having an amino acid sequence of SEQ ID NO.:3 or a CDRH1 having an amino acid sequence of SEQ ID NO.:11, a CDRH2 having an amino acid sequence of SEQ ID NO.:12 and a CDRH3 having an amino acid sequence of SEQ ID NO.:13.
[0318] In a more particular embodiment, the antigen binding fragment may comprise a heavy chain variable region having an amino acid sequence of SEQ ID NO:7 or SEQ ID NO.:17 (or a fragment thereof).
[0319] In a further exemplary embodiment, the antigen binding fragment may comprise human framework region amino acid residues of the natural human antibody light chain as described herein and a light chain CDR selected from the group consisting of a CDRL1 having an amino acid sequence of SEQ ID NO.:4, a CDRL2 having an amino acid sequence of SEQ ID NO.:5 and a CDRL3 having an amino acid sequence of SEQ ID NO.:6 or a light chain CDR selected from the group consisting of a CDRL1 having an amino acid sequence of SEQ ID NO.:14, a CDRL2 having an amino acid sequence of SEQ ID NO.:15 and a CDRL3 having an amino acid sequence of SEQ ID NO.:16.
[0320] In yet a further exemplary embodiment, the antigen binding fragment may comprise human framework region amino acid residues of the natural human antibody light chain as described herein and at least two light chain CDRs selected from the group consisting of a CDRL1 having an amino acid sequence of SEQ ID NO.:4, a CDRL2 having an amino acid sequence of SEQ ID NO.:5 and a CDRL3 having an amino acid sequence of SEQ ID NO.:6 or at least two light chain CDR selected from the group consisting of a CDRL1 having an amino acid sequence of SEQ ID NO.:14, a CDRL2 having an amino acid sequence of SEQ ID NO.:15 and a CDRL3 having an amino acid sequence of SEQ ID NO.:16.
[0321] In still a further exemplary embodiment, the antigen binding fragment may comprise human framework region amino acid residues of the natural human antibody light chain as described herein and a CDRL1 having an amino acid sequence of SEQ ID NO.:4, a CDRL2 having an amino acid sequence of SEQ ID NO.:5 and a CDRL3 having an amino acid sequence of SEQ ID NO.:6 or a CDRL1 having an amino acid sequence of SEQ ID NO.:14, a CDRL2 having an amino acid sequence of SEQ ID NO.:15 and a CDRL3 having an amino acid sequence of SEQ ID NO.:16.
[0322] In a more specific embodiment, the antigen binding fragment may comprise a light chain variable region having an amino acid sequence of SEQ ID NO.:8 or SEQ ID NO.:18 or a fragment thereof.
[0323] In accordance with the present invention, the antigen binding fragment may be, for example, a Fab fragment, a F(ab′).sub.2 fragment, a Fd fragment, a Fv fragment or a dAb fragment.
[0324] Preferably, the antigen binding fragment may be, for example, a Fab fragment or a F(ab′).sub.2 fragment.
[0325] The present invention also encompasses an isolated antibody comprising the amino acid sequence of the antigen binding fragment described herein. The isolated antibody may also comprise a constant region.
[0326] Variant Antibody and Antigen Binding Fragments
[0327] Although, substituting CDRs from rodent antibodies for the human CDRs in human frameworks is sometimes sufficient to transfer high antigen binding affinity (Jones, P. T. et al., Nature 321:522-525 (1986); Verhoeyen, M. et al., Science 239:1534-1536 (1988)), in other cases it is necessary to additionally replace one (Riechmann, L. et al., Nature 332:323-327 (1988)) or several (Queen, C. et al., Proc. Natl. Acad. Sci. USA 86:10029-10033 (1989)) framework region residues. Substantial unpredictability in the art of antibody humanization still exists. For example, in U.S. Pat. No. 7,537,931, attempts at transferring the CDRs of a murine antibody into a human antibody resulted in lost of binding to the antigen.
[0328] If the humanization process does not result in a humanized or hybrid antibody having the desired characteristics (i.e., specificity, affinity, etc.), it is possible to substitute non-human amino acid framework residues for human amino acid framework residues.
[0329] The present invention therefore encompasses variants of the humanized or hybrid antibodies or antigen binding fragments described herein. Variant antibodies or antigen binding fragments included are those having a variation in the amino acid sequence of the humanized or hybrid antibody or antigen binding fragments described herein. For example, variant antibodies or antigen binding fragments encompassed by the present invention are those having a light chain variable region and a heavy chain variable region which may include non-human complementarity determining region amino acid residues and human framework region amino acid residues of a natural human antibody and further comprising at least one amino acid variation (preferably in the framework region).
[0330] Variant antibodies or antigen binding fragments included in the present invention are those having, for example, similar or improved characteristics in comparison with the humanized or hybrid antibody or antigen binding fragment but which carries at least one amino acid variation in comparison with the humanized or hybrid antibody described herein.
[0331] Variant antibodies or antigen binding fragments encompassed by the present invention are those which may comprise an insertion, a deletion or an amino acid substitution (conservative or non-conservative). Some variants may thus have at least one amino acid residue in its amino acid sequence removed and a different residue inserted in its place.
[0332] The sites of interest for substitutional mutagenesis may include the hypervariable regions (CDRs), the framework region or even the constant region. Conservative substitutions may be made by exchanging an amino from one of the groups listed below (group 1 to 6) for another amino acid of the same group.
[0333] Other exemplary embodiments of conservative substitutions are shown in Table 1A under the heading of “preferred substitutions”. If such substitutions result in a undesired property, then more substantial changes, denominated “exemplary substitutions” in Table 1A, or as further described below in reference to amino acid classes, may be introduced and the products screened.
[0334] Examples of substitutions identified as “conservative substitutions” are shown in Table 1A. If such substitutions result in a change not desired, then other type of substitutions, denominated “exemplary substitutions” in Table 1A, or as further described herein in reference to amino acid classes, are introduced and the products screened.
[0335] Substantial modifications in function or immunological identity may be accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation. (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Naturally occurring residues are divided into groups based on common side chain properties: [0336] (group 1) hydrophobic: norleucine, methionine (Met), Alanine (Ala), Valine (Val), Leucine (Leu), Isoleucine (Ile) [0337] (group 2) neutral hydrophilic: Cysteine (Cys), Serine (Ser), Threonine (Thr) [0338] (group 3) acidic: Aspartic acid (Asp), Glutamic acid (Glu) [0339] (group 4) basic: Asparagine (Asn), Glutamine (Gln), Histidine (His), Lysine (Lys), Arginine (Arg) [0340] (group 5) residues that influence chain orientation: Glycine (Gly), Proline (Pro); and [0341] (group 6) aromatic: Tryptophan (Trp), Tyrosine (Tyr), Phenylalanine (Phe)
[0342] Non-conservative substitutions will entail exchanging a member of one of these classes for another.
TABLE-US-00001 TABLE 1A Amino acid substitution Original residue Exemplary substitution Conservative substitution Ala (A) Val, Leu, Ile Val Arg (R) Lys, Gln, Asn Lys Asn (N) Gln, His, Lys, Arg, Asp Gln Asp (D) Glu, Asn Glu Cys (C) Ser, Ala Ser Gln (Q) Asn; Glu Asn Glu (E) Asp, Gln Asp Gly (G) Ala Ala His (H) Asn, Gln, Lys, Arg, Arg Ile (I) Leu, Val, Met, Ala, Phe, Leu norleucine Leu (L) Norleucine, Ile, Val, Met, Ile Ala, Phe Lys (K) Arg, Gln, Asn Arg Met (M) Leu, Phe, Ile Leu Phe (F) Leu, Val, Ile, Ala, Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr, Phe Tyr Tyr (Y) Trp, Phe, Thr, Ser Phe Val (V) Ile, Leu, Met, Phe, Ala, Leu norleucine
[0343] Variation in the amino acid sequence of the variant antibody or antigen binding fragment may include an amino acid addition, deletion, insertion, substitution etc., one or more modification in the backbone or side-chain of one or more amino acid, or an addition of a group or another molecule to one or more amino acids (side-chains or backbone).
[0344] Variant antibody or antigen binding fragment may have substantial sequence similarity and/or sequence identity in its amino acid sequence in comparison with that the original antibody or antigen binding fragment amino acid sequence. The degree of similarity between two sequences is based upon the percentage of identities (identical amino acids) and of conservative substitution.
[0345] When determining percent identity of a framework region in comparison with another framework region, the CDRs amino acid sequence should preferably not be taken into account. The percent identity of a framework region in comparison with another is preferably determined over the entire framework region and not framework by framework.
[0346] Generally, the degree of similarity and identity between variable chains has been determined herein using the Blast2 sequence program (Tatiana A. Tatusova, Thomas L. Madden (1999), “Blast 2 sequences—a new tool for comparing protein and nucleotide sequences”, FEMS Microbiol Lett. 174:247-250) using default settings, i.e., blastp program, BLOSUM62 matrix (open gap 11 and extension gap penalty 1; gapx dropoff 50, expect 10.0, word size 3) and activated filters.
[0347] Percent identity will therefore be indicative of amino acids which are identical in comparison with the original peptide and which may occupy the same or similar position.
[0348] Percent similarity will be indicative of amino acids which are identical and those which are replaced with conservative amino acid substitution in comparison with the original peptide at the same or similar position.
[0349] Variants of the present invention therefore comprise those which may have at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with an original sequence or a portion of an original sequence.
[0350] Exemplary embodiments of variants are those having at least 81% sequence identity to a sequence described herein and 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence similarity with an original sequence or a portion of an original sequence.
[0351] Other exemplary embodiments of variants are those having at least 82% sequence identity to a sequence described herein and 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence similarity with an original sequence or a portion of an original sequence.
[0352] Further exemplary embodiments of variants are those having at least 85% sequence identity to a sequence described herein and 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence similarity with an original sequence or a portion of an original sequence.
[0353] Other exemplary embodiments of variants are those having at least 90% sequence identity to a sequence described herein and 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence similarity with an original sequence or a portion of an original sequence.
[0354] Additional exemplary embodiments of variants are those having at least 95% sequence identity to a sequence described herein and 95%, 96%, 97%, 98%, 99% or 100% sequence similarity with an original sequence or a portion of an original sequence.
[0355] Yet additional exemplary embodiments of variants are those having at least 97% sequence identity to a sequence described herein and 97%, 98%, 99% or 100% sequence similarity with an original sequence or a portion of an original sequence.
[0356] For a purpose of concision the applicant provides herein a Table 1B illustrating exemplary embodiments of individual variants encompassed by the present invention and comprising the specified % sequence identity and % sequence similarity. Each “X” is to be construed as defining a given variant.
TABLE-US-00002 TABLE 1B Percent (%) sequence identity 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 Percent 80 X (%) 81 X X sequence 82 X X X similarity 83 X X X X 84 X X X X X 85 X X X X X X 86 X X X X X X X 87 X X X X X X X X 88 X X X X X X X X X 89 X X X X X X X X X X 90 X X X X X X X X X X X 91 X X X X X X X X X X X X 92 X X X X X X X X X X X X X 93 X X X X X X X X X X X X X X 94 X X X X X X X X X X X X X X X 95 X X X X X X X X X X X X X X X X 96 X X X X X X X X X X X X X X X X X 97 X X X X X X X X X X X X X X X X X X 98 X X X X X X X X X X X X X X X X X X X 99 X X X X X X X X X X X X X X X X X X X X 100 X X X X X X X X X X X X X X X X X X X X X
[0357] The present invention thus encompasses humanized or hybrid antibody in which non-human amino acid framework residues are reintroduced or where other types of amino acid modifications are made. Those amino acids that are particularly selected to optimize the characteristics of the antibody include those that are involved in antigen binding. Examples, of such amino acids are provided in
[0358] In an exemplary embodiment, the humanized or hybrid antibody of the present invention may thus comprise from one to twenty-one non-human framework region amino acid residues in the heavy chain variable region (back mutations).
[0359] In another exemplary embodiment, the humanized or hybrid antibody may comprise from one to twelve non-human framework region amino acid residues in the light chain variable region (back mutations).
[0360] As used herein the term “from one to twenty” includes every individual values and ranges such as for example, 1, 2, 3, and up to 20; 1 to 20; 1 to 19; 1 to 18; 1 to 17; 1 to 16; 1 to 15 and so on; 2 to 20; 2 to 19; 2 to 18; 2 to 17 and so on; 3 to 20; 3 to 19; 3 to 18 and so on; 4 to 20; 4 to 19; 4 to 18; 4 to 17; 4 to 16 and so on; 5 to 20; 5 to 19; 5 to 18; 5 to 17 and so on, etc.
[0361] Likewise, the term “from one to twelve” includes every individual values and ranges such as for example, 1, 2, 3, and up to 12; 1 to 12; 1 to 11; 1 to 10 and so on; 2 to 12; 2 to 11, 2 to 10; 2 to 9; 2 to 8 and so on; 3 to 12; 3 to 11; 3 to 10; 3 to 9 and so on; 4 to 12; 4 to 11 and so on; 5 to 12; 5 to 11; 5 to 10; 5 to 9; 5 to 8; 5 to 7; and so on, etc.
[0362] Similar terms are to be interpreted in a similar manner.
[0363] The invention encompasses or uses amino acid sequence having a desired % identity with another amino acid sequence, for example, “a natural human antibody light chain framework region having at least 70% identity with the light chain framework region of the non-human parent antibody” or “a natural human antibody heavy chain framework region having at least 70% identity with the heavy chain framework region of the non-human parent antibody”.
[0364] The term “a natural human antibody light chain framework region having at least 70% identity with the light chain framework region of the non-human parent antibody” encompasses a natural human antibody light chain framework region having 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with the light chain framework region of the non-human parent antibody. The % identity is preferably determined over the entire framework regions (i.e., excluding the CDRs).
[0365] As mentioned above for with respect to variants, the term “a light chain framework region having at least 70% identity with the light chain framework region of the non-human parent antibody” encompasses a light chain framework region having 70% identity with the light chain framework region of the non-human parent antibody and which may also have 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence similarity with the light chain framework region of the non-human parent antibody.
[0366] The term “a natural human antibody heavy chain framework region having at least 70% identity with the heavy chain framework region of the non-human parent antibody” encompasses a natural human antibody heavy chain framework region having 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with the heavy chain framework region of the non-human parent antibody.
[0367] As mentioned above for with respect to variants, the term “a heavy chain framework region having at least 70% identity with the heavy chain framework region of the non-human parent antibody” encompasses a heavy chain framework region having 70% identity with the heavy chain framework region of the non-human parent antibody and which may also have 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence similarity with the heavy chain framework region of the non-human parent antibody.
[0368] Production of the Antibodies in Cells
[0369] The antibodies that are disclosed herein can be made by a variety of methods familiar to those skilled in the art (recombinant DNA methods, chemical synthesis etc.).
[0370] In order to express the antibodies, nucleotide sequences able to encode any one of a light and heavy immunoglobulin chains described herein may be inserted into an expression vector, e.g., a vector that contains the elements for transcriptional and translational control of the inserted coding sequence in a particular host. These elements may include regulatory sequences, such as enhancers, constitutive and inducible promoters, and 5′ and 3′ un-translated regions. Methods that are well known to those skilled in the art may be used to construct such expression vectors. These methods include in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination.
[0371] A variety of expression vector/host cell systems known to those of skill in the art may be utilized to express a polypeptide or RNA derived from nucleotide sequences able to encode any one of a light and heavy immunoglobulin chains described herein. These include, but are not limited to, microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid, or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with baculovirus vectors; plant cell systems transformed with viral or bacterial expression vectors; or animal cell systems. For long-term production of recombinant proteins in mammalian systems, stable expression in cell lines may be effected. For example, nucleotide sequences able to encode any one of a light and heavy immunoglobulin chains described herein may be transformed into cell lines using expression vectors that may contain viral origins of replication and/or endogenous expression elements and a selectable or visible marker gene on the same or on a separate vector. The invention is not to be limited by the vector or host cell employed. In certain embodiments of the present invention, the nucleotide sequences able to encode any one of a light and heavy immunoglobulin chains described herein may each be ligated into a separate expression vector and each chain expressed separately. In another embodiment, both the light and heavy chains able to encode any one of a light and heavy immunoglobulin chains described herein may be ligated into a single expression vector and expressed simultaneously.
[0372] Alternatively, RNA and/or polypeptide may be expressed from a vector comprising nucleotide sequences able to encode any one of a light and heavy immunoglobulin chains described herein using an in vitro transcription system or a coupled in vitro transcription/translation system.
[0373] In general, host cells that contain nucleotide sequences able to encode any one of a light and heavy immunoglobulin chains described herein and/or that express a polypeptide encoded by the nucleotide sequences able to encode any one of a light and heavy immunoglobulin chains described herein, or a portion thereof, may be identified by a variety of procedures known to those of skill in the art. These procedures include, but are not limited to, DNA/DNA or DNA/RNA hybridizations, PCR amplification, and protein bioassay or immunoassay techniques that include membrane, solution, or chip based technologies for the detection and/or quantification of nucleic acid or amino acid sequences. Immunological methods for detecting and measuring the expression of polypeptides using either specific polyclonal or monoclonal antibodies are known in the art. Examples of such techniques include enzyme-linked immunosorbent assays (ELISAs), radioimmunoassays (RIAs), and fluorescence activated cell sorting (FACS). Those of skill in the art may readily adapt these methodologies to the present invention.
[0374] Host cells comprising nucleotide sequences able to encode any one of a light and heavy immunoglobulin chains described herein may thus be cultured under conditions for the transcription of the corresponding RNA and/or the expression of the polypeptide from cell culture. The polypeptide produced by a cell may be secreted or may be retained intracellularly depending on the sequence and/or the vector used. In an exemplary embodiment, expression vectors containing nucleotide sequences able to encode any one of a light and heavy immunoglobulin chains described herein may be designed to contain signal sequences that direct secretion of the polypeptide through a prokaryotic or eukaryotic cell membrane.
[0375] An exemplary embodiment of a nucleic acid encoding a heavy chain variable region is provided in SEQ ID NO.:21 and SEQ ID NO.:22.
[0376] An exemplary embodiment of a nucleic acid encoding a light chain variable region is provided in SEQ ID NO.:23 and SEQ ID NO.:24.
[0377] Due to the inherent degeneracy of the genetic code, other DNA sequences that encode the same, substantially the same or a functionally equivalent amino acid sequence may be produced and used, for example, to express a polypeptide encoded by nucleotide sequences able to encode any one of a light and heavy immunoglobulin chains described herein. The nucleotide sequences of the present invention may be engineered using methods generally known in the art in order to alter the nucleotide sequences for a variety of purposes including, but not limited to, modification of the cloning, processing, and/or expression of the gene product. DNA shuffling by random fragmentation and PCR reassembly of gene fragments and synthetic oligonucleotides may be used to engineer the nucleotide sequences. For example, oligonucleotide-mediated site-directed mutagenesis may be used to introduce mutations that create new restriction sites, alter glycosylation patterns, change codon preference, produce splice variants, and so forth.
[0378] In addition, a host cell strain may be chosen for its ability to modulate expression of the inserted sequences or to process the expressed polypeptide in the desired fashion. Such modifications of the polypeptide include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation. In an exemplary embodiment, antibodies that contain particular glycosylation structures or patterns may be desired. Post-translational processing, which cleaves a “prepro” form of the polypeptide, may also be used to specify protein targeting, folding, and/or activity. Different host cells that have specific cellular machinery and characteristic mechanisms for post-translational activities (e.g., CHO, HeLa, MDCK, HEK293, and W138) are available commercially and from the American Type Culture Collection (ATCC) and may be chosen to ensure the correct modification and processing of the expressed polypeptide.
[0379] Those of skill in the art will readily appreciate that natural, modified, or recombinant nucleic acid sequences may be ligated to a heterologous sequence resulting in translation of a fusion polypeptide containing heterologous polypeptide moieties in any of the aforementioned host systems. Such heterologous polypeptide moieties may facilitate purification of fusion polypeptides using commercially available affinity matrices. Such moieties include, but are not limited to, glutathione S-transferase (GST), maltose binding protein, thioredoxin, calmodulin binding peptide, 6-His (His), FLAG, c-myc, hemaglutinin (HA), and antibody epitopes such as monoclonal antibody epitopes.
[0380] In yet a further aspect, the present invention relates to a polynucleotide which may comprise a nucleotide sequence encoding a fusion protein. The fusion protein may comprise a fusion partner (e.g., HA, Fc, etc.) fused to the polypeptide (e.g., complete light chain, complete heavy chain, variable regions, CDRs etc.) described herein.
[0381] Those of skill in the art will also readily recognize that the nucleic acid and polypeptide sequences may be synthesized, in whole or in part, using chemical or enzymatic methods well known in the art. For example, peptide synthesis may be performed using various solid-phase techniques and machines such as the ABI 431A Peptide synthesizer (PE Biosystems) may be used to automate synthesis. If desired, the amino acid sequence may be altered during synthesis and/or combined with sequences from other proteins to produce a variant protein.
[0382] When only one of the light chain variable domain or the heavy chain variable domain is available, an antibody or antigen-binding fragment may be reconstituted by screening a library of complementary variable domains using methods known in the art (Portolano et al. The Journal of Immunology (1993) 150:880-887, Clarkson et al., Nature (1991) 352:624-628). As such, knowing only one of the variable region amino acid sequence (heavy chain variable region or light chain variable region) is often enough to reconstitute an intact antibody having the desired antigen binding specificity. Therefore, nucleic acids encoding a light chain variable region or a heavy chain variable region of an antibody may be useful in identifying a complementary chain which when assembled with one another forms an antigen binding fragment or antibody having sufficient antigen binding specificity. A single stranded nucleic acid (e.g., oligo) or its complement having a high level of sequence identity with the nucleic acids encoding a light chain variable region or a heavy chain variable region of an antibody may be useful to detect the latter or to detect any other nucleic acid sequence sharing a high level of sequence identity.
[0383] Therefore, in an additional aspect, the present invention also provides an isolated nucleic acid encoding the light chain variable region and/or the heavy chain variable region of the humanized or hybrid antibody described herein, encoding the antigen binding fragment described herein or the isolated antibody described herein.
[0384] In yet an additional aspect, the present invention provides a vector or construct, comprising the (isolated) nucleic acid described herein. In accordance with the present invention, the vector may be, for example, a mammalian expression vector, a bacterial expression vector etc.
[0385] The present invention also encompasses, an isolated cell comprising the isolated nucleic acid described herein or the vector described herein. Isolated cells expressing the antibody or antigen binding fragment of the present invention are also encompassed herewith. Suitable cells, include for example, a mammalian cell, a bacterial cell, etc.
[0386] Yet another aspect of the invention relate to a method for making a humanized or hybrid anti-clusterin antibody which may comprise introducing non-human heavy chain CDR amino acid residues of a non-human antibody capable of specific binding to clusterin into a framework region of a natural human antibody heavy chain variable region.
[0387] Yet an additional aspect of the invention relates to a method for making a humanized or hybrid anti-clusterin antibody which may comprise transforming a cell with a nucleic acid encoding a heavy chain variable region (or a complete heavy chain) comprising non-human heavy chain CDR amino acid residues of a non-human antibody capable of specific binding to clusterin and framework region amino acids of a natural human antibody heavy chain variable region. The method may also comprise transforming the cell with a nucleic acid encoding a complementary light chain variable region (or a complete light chain).
[0388] In another aspect, the invention relates to a method for making a humanized or hybrid anti-clusterin antibody which may comprise expressing a heavy chain variable region (or a complete heavy chain) comprising non-human heavy chain CDR amino acid residues of a non-human antibody capable of specific binding to clusterin and framework region amino acids of a natural human antibody heavy chain variable region. The method may also comprise expressing a complementary light chain variable region (or a complete light chain).
[0389] The natural human antibody heavy chain variable region which may be selected for humanization purposes may have the following characteristics: a) a three-dimensional structure similar to or identical (superimposable) to that of a heavy chain of the non-human antibody, b) a framework region having an amino acid sequence at least 70% identical to a heavy chain framework region of the non-human antibody, and/or; c) (a number of) amino acid residues in a heavy chain CDR (e.g., all three CDRs) that is the same or substantially the same as that of the non-human heavy chain CDR amino acid residues.
[0390] The method may thus comprise, for example, introducing non-human heavy chain CDR amino acid residues of at least two CDRs of the non-human antibody. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode at least two CDRs of the non-human antibody. The heavy chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise at least two CDRs of the non-human antibody.
[0391] The method may preferably comprise introducing non-human heavy chain CDR amino acid residues of all three CDRs. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode three CDRs of the non-human antibody. The heavy chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise three CDRs of the non-human antibody.
[0392] The method thus includes introducing the non-human CDRs comprising the amino acid sequence of SEQ ID NO.:1, SEQ ID NO.:2 and SEQ ID NO.:3. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode SEQ ID NO.:1, SEQ ID NO.:2 and SEQ ID NO.:3. The heavy chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise SEQ ID NO.:1, SEQ ID NO.:2 and SEQ ID NO.:3.
[0393] The method thus also includes introducing the non-human CDRs comprising the amino acid sequence of SEQ ID NO.:11, SEQ ID NO.:12 and SEQ ID NO.:13. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode SEQ ID NO.:11, SEQ ID NO.:12 and SEQ ID NO.:13. The heavy chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise SEQ ID NO.:11, SEQ ID NO.:12 and SEQ ID NO.:13.
[0394] Alternatively, shorter versions of the above-mentioned CDRs may be introduced into a framework region of a natural human antibody heavy chain variable region.
[0395] The method of the present invention may further comprise introducing non-human light chain CDR amino acid residues of a non-human antibody capable of specific binding to clusterin into a framework region of a natural human antibody light chain variable region.
[0396] The method of the present invention may comprise allowing expression of a nucleic acid encoding a light chain variable region (or a complete light chain) comprising non-human light chain CDR amino acid residues of a non-human antibody capable of specific binding to clusterin and framework region amino acids of a natural human antibody light chain variable region. The method may also comprise transforming the cell with a nucleic acid encoding a complementary heavy chain variable region (or a complete heavy chain).
[0397] In another aspect, the invention relates to a method for making a humanized or hybrid anti-clusterin antibody which may comprise expressing a light chain variable region (or a complete heavy chain) comprising non-human light chain CDR amino acid residues of a non-human antibody capable of specific binding to clusterin and framework region amino acids of a natural human antibody light chain variable region. The method may also comprise expressing a complementary heavy chain variable region (or a complete heavy chain).
[0398] The natural human antibody light chain variable region which may be selected for humanization purposes may have the following characteristics: a) a three-dimensional structure similar to or identical (superimposable) to that of a light chain of the non-human antibody, b) a framework region having an amino acid sequence at least 70% identical to a light chain framework region of the non-human antibody, and/or; c) (a number of) amino acid residues in a light chain CDR (e.g., all three CDRs) that is the same or substantially the same as that of the non-human light chain CDR amino acid residues.
[0399] The method may thus comprise, for example, introducing non-human light chain CDR amino acid residues of at least two CDRs of the non-human antibody. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode at least two CDRs of the non-human antibody. The light chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise at least two CDRs of the non-human antibody.
[0400] The method may preferably comprise introducing non-human light chain CDR amino acid residues of all three CDRs. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode three CDRs of the non-human antibody. The light chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise three CDRs of the non-human antibody.
[0401] The method thus includes introducing the non-human CDRs comprising the amino acid sequence of SEQ ID NO.:4, SEQ ID NO.:5 and SEQ ID NO.:6. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode SEQ ID NO.:4, SEQ ID NO.:5 and SEQ ID NO.:6. The light chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise SEQ ID NO.:4, SEQ ID NO.:5 and SEQ ID NO.:6.
[0402] The method thus also includes introducing the non-human CDRs comprising the amino acid sequence of SEQ ID NO.:14, SEQ ID NO.:15 and SEQ ID NO.:16. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode SEQ ID NO.:14, SEQ ID NO.:15 and SEQ ID NO.:16. The light chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise SEQ ID NO.:14, SEQ ID NO.:15 and SEQ ID NO.:16.
[0403] Alternatively, shorter versions of the above-mentioned CDRs may be introduced into a framework region of a natural human antibody heavy chain variable region.
[0404] An additional aspect of the invention concerns a method for making a humanized anti-clusterin antibody which may comprise introducing non-human heavy chain CDR amino acid residues of a non-human antibody capable of specific binding to clusterin into a framework region of a natural human antibody heavy chain variable region and introducing non-human light chain CDR amino acid residues of a non-human antibody capable of specific binding to clusterin into a framework region of a natural human antibody light chain variable region.
[0405] Yet, an additional aspect of the invention concerns a method for making a humanized anti-clusterin antibody which may comprise allowing expression of a nucleic acid encoding non-human heavy chain CDR amino acid residues of a non-human antibody capable of specific binding to clusterin and a framework region of a natural human antibody heavy chain variable region and allowing expression of a nucleic acid encoding a non-human light chain CDR amino acid residues of a non-human antibody capable of specific binding to clusterin and a framework region of a natural human antibody light chain variable region.
[0406] The natural human antibody heavy chain variable region which may be selected for humanization purposes may have the following characteristics: a) comprising a framework region having an amino acid sequence at least 70% identical to a heavy chain framework region of the non-human antibody, and; b) having (a number of) amino acid residues in a heavy chain CDR (e.g., all three CDRs) that is the same or substantially the same as that of the non-human heavy chain CDR amino acid residues, while the natural human antibody light chain variable region which may be selected for humanization purposes may have the following characteristics: a) comprising a framework region having an amino acid sequence at least 70% identical to a light chain framework region of the non-human antibody, and; b) having (a number of) amino acid residues in a light chain CDR (e.g., all three CDRs) that is the same or substantially the same as that of the non-human light chain CDR amino acid residues. The natural human antibody variable region(s) preferably has a three-dimensional structure similar to or identical (superimposable) to that of the non-human antibody variable region(s).
[0407] In accordance with the present invention, the method may comprise introducing non-human heavy chain CDR amino acid residues of at least two CDRs of the non-human antibody. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode at least two CDRs of the non-human antibody. The heavy chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise at least two CDRs of the non-human antibody.
[0408] Alternatively, the method may comprise introducing non-human heavy chain CDR amino acid residues of all three CDRs. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode three CDRs of the non-human antibody. The heavy chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise three CDRs of the non-human antibody.
[0409] Also in accordance with the present invention, the method may comprise introducing non-human light chain CDR amino acid residues of at least two CDRs of the non-human antibody.
[0410] The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode at least two CDRs of the non-human antibody. The light chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise at least two CDRs of the non-human antibody.
[0411] Alternatively, the method may comprise introducing non-human light chain CDR amino acid residues of all three CDRs. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode three CDRs of the non-human antibody. The light chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise three CDRs of the non-human antibody.
[0412] Using the method described herein, CDRs comprising the amino acid sequence of SEQ ID NO.:1, SEQ ID NO.:2 and SEQ ID NO.:3 are advantageously imported into the natural human antibody heavy chain variable region. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode SEQ ID NO.:1, SEQ ID NO.:2 and SEQ ID NO.:3. The light chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise SEQ ID NO.:1, SEQ ID NO.:2 and SEQ ID NO.:3.
[0413] Using the method described herein, CDRs comprising the amino acid sequence of SEQ ID NO.:11, SEQ ID NO.:12 and SEQ ID NO.:13 are advantageously imported into the natural human antibody heavy chain variable region. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode SEQ ID NO.:11, SEQ ID NO.:12 and SEQ ID NO.:13. The light chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise SEQ ID NO.:11, SEQ ID NO.:12 and SEQ ID NO.:13.
[0414] Using the method described herein, CDRs comprising the amino acid sequence of SEQ ID NO.:4, SEQ ID NO.:5 and SEQ ID NO.:6 are advantageously imported into the natural human antibody light chain variable region. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode SEQ ID NO.:4, SEQ ID NO.:5 and SEQ ID NO.:6. The light chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise SEQ ID NO.:4, SEQ ID NO.:5 and SEQ ID NO.:6.
[0415] Using the method described herein, CDRs comprising the amino acid sequence of SEQ ID NO.:14, SEQ ID NO.:15 and SEQ ID NO.:16 are advantageously imported into the natural human antibody light chain variable region. The nucleic acid used in methods of making humanized or hybrid antibodies may thus encode SEQ ID NO.:14, SEQ ID NO.:15 and SEQ ID NO.:16. The light chain variable region that is expressed in methods of making humanized or hybrid antibodies may thus comprise SEQ ID NO.:14, SEQ ID NO.:115 and SEQ ID NO.:16.
[0416] In another aspect, the present invention, concerns a method for making a humanized or hybrid anti-clusterin antibody which may comprise transforming a host cell with a nucleic acid encoding the heavy chain variable region described herein.
[0417] Exemplary embodiments of suitable heavy chain variable region are those of the non-human antibody which may comprise three CDRs having the amino acid sequence of SEQ ID NO.:1, SEQ ID NO.:2 and SEQ ID NO.:3 and natural human antibody heavy chain framework region having an amino acid sequence at least 70% identical to a heavy chain framework region of the non-human antibody. Preferably, the natural human antibody may comprise (a number of) heavy chain CDR amino acid residues that is the same or substantially the same as that of a CDR (e.g., all three CDRs) of the non-human heavy chain.
[0418] Exemplary embodiments of suitable heavy chain variable region are those of the non-human antibody which may comprise three CDRs having the amino acid sequence of SEQ ID NO.:11, SEQ ID NO.:12 and SEQ ID NO.:13 and natural human antibody heavy chain framework region having an amino acid sequence at least 70% identical to a heavy chain framework region of the non-human antibody. Preferably, the natural human antibody may comprise (a number of) heavy chain CDR amino acid residues that is the same or substantially the same as that of a CDR (e.g., all three CDRs) of the non-human heavy chain.
[0419] The method of the present invention may further comprise transforming a host cell with a nucleic acid encoding a complementary light chain.
[0420] If desirable, the complementary light chain may be encoded by the same nucleic acid as that encoding the heavy chain.
[0421] Such complementary light chain may comprise a light chain variable region of a non-human antibody which may comprise three CDRs having the amino acid sequence of SEQ ID NO.:4, SEQ ID NO.:5 and SEQ ID NO.:6 and natural human antibody light chain framework region having an amino acid sequence at least 70% identical to a light chain framework region of the non-human antibody. Preferably, the natural human antibody may comprise (a number of) light chain CDR amino acid residues that is the same or substantially the same as that of a CDR (e.g., all three CDRs) of the non-human light chain.
[0422] Such complementary light chain may comprise a light chain variable region of a non-human antibody which may comprise three CDRs having the amino acid sequence of SEQ ID NO.:14, SEQ ID NO.:15 and SEQ ID NO.:16 and natural human antibody light chain framework region having an amino acid sequence at least 70% identical to a light chain framework region of the non-human antibody. Preferably, the natural human antibody may comprise (a number of) light chain CDR amino acid residues that is the same or substantially the same as that of a CDR (e.g., all three CDRs) of the non-human light chain.
[0423] In yet another aspect, the present invention relates to a method for making a humanized or hybrid anti-clusterin antibody which may comprise transforming a host cell with a nucleic acid encoding a light chain variable region.
[0424] Exemplary embodiments of suitable light chain variable region are those of a non-human antibody which may comprise three CDRs having the amino acid sequence of SEQ ID NO.:4, SEQ ID NO.:5 and SEQ ID NO.:6 and natural human antibody light chain framework region having an amino acid sequence at least 70% identical to a light chain framework region of the non-human antibody. Preferably, the natural human antibody comprises (a number of) light chain CDR amino acid residues that is the same or substantially the same as that of a CDR (e.g., all three CDRs) of the non-human light chain.
[0425] Exemplary embodiments of suitable light chain variable region are those of a non-human antibody which may comprise three CDRs having the amino acid sequence of SEQ ID NO.:14, SEQ ID NO.:15 and SEQ ID NO.:16 and natural human antibody light chain framework region having an amino acid sequence at least 70% identical to a light chain framework region of the non-human antibody. Preferably, the natural human antibody comprises (a number of) light chain CDR amino acid residues that is the same or substantially the same as that of a CDR (e.g., all three CDRs) of the non-human light chain.
[0426] The method of the present invention may further comprise transforming a host cell with a nucleic acid encoding a complementary heavy chain.
[0427] If desirable, the complementary heavy chain may be encoded by the same nucleic acid as that encoding the light chain.
[0428] Pharmaceutical Compositions of the Antibodies and Their Use
[0429] In another aspect, the present invention relates to a pharmaceutical composition which may comprise, for example, the humanized or hybrid antibody described herein, the antigen binding fragment described herein or the isolated antibody described herein and a pharmaceutically acceptable carrier.
[0430] Yet other aspects of the invention relate to the use of the isolated antibody or antigen binding fragment described herein in the treatment or diagnosis of diseases.
[0431] Yet another aspect of the invention relates to a combination therapy which includes the pharmaceutical composition described herein and a chemotherapeutic agent.
[0432] In accordance with the present invention, the pharmaceutical composition may be administered (is administrable) concurrently with the chemotherapeutic agent.
[0433] Also in accordance with the present invention, the pharmaceutical composition and the chemotherapeutic agent may be administered (is administrable) at different time intervals.
[0434] Further in accordance with the present invention, the chemotherapeutic agent may be conjugated with the antibody or antigen binding fragment.
[0435] In addition to the active ingredients, a pharmaceutical composition may contain pharmaceutically acceptable carriers comprising water, PBS, salt solutions, gelatins, oils, alcohols, and other excipients and auxiliaries that facilitate processing of the active compounds into preparations that may be used pharmaceutically. In other instances, such preparations may be sterilized.
[0436] As used herein, “pharmaceutical composition” means therapeutically effective amounts of the agent together with pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, adjuvant and/or carriers. A “therapeutically effective amount” as used herein refers to that amount which provides a therapeutic effect for a given condition and administration regimen. Such compositions are liquids or lyophilized or otherwise dried formulations and include diluents of various buffer content (e.g., Tris-HCl., acetate, phosphate), pH and ionic strength, additives such as albumin or gelatin to prevent absorption to surfaces, detergents (e.g., Tween 20, Tween 80, Pluronic F68, bile acid salts). Solubilizing agents (e.g., glycerol, polyethylene glycerol), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite), preservatives (e.g., thimerosal, benzyl alcohol, parabens), bulking substances or tonicity modifiers (e.g., lactose, mannitol), covalent attachment of polymers such as polyethylene glycol to the protein, complexation with metal ions, or incorporation of the material into or onto particulate preparations of polymeric compounds such as polylactic acid, polyglycolic acid, hydrogels, etc, or onto liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts, or spheroplasts. Such compositions will influence the physical state, solubility, stability, rate of in vivo release, and rate of in vivo clearance. Controlled or sustained release compositions include formulation in lipophilic depots (e.g., fatty acids, waxes, oils). Also comprehended by the invention are particulate compositions coated with polymers (e.g., poloxamers or poloxamines). Other embodiments of the compositions of the invention incorporate particulate forms protective coatings, protease inhibitors or permeation enhancers for various routes of administration, including parenteral, pulmonary, nasal, oral, vaginal, rectal routes. In one embodiment the pharmaceutical composition is administered parenterally, paracancerally, transmucosally, transdermally, intramuscularly, intravenously, intradermally, subcutaneously, intraperitonealy, intraventricularly, intracranially and intratumorally.
[0437] Further, as used herein “pharmaceutically acceptable carrier” or “pharmaceutical carrier” are known in the art and include, but are not limited to, 0.01-0.1 M or 0.05 M phosphate buffer or 0.8% saline. Additionally, such pharmaceutically acceptable carriers may be aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers such as those based on Ringer's dextrose, and the like. Preservatives and other additives may also be present, such as, for example, antimicrobials, antioxidants, collating agents, inert gases and the like.
[0438] The pharmaceutical compositions utilized in this invention may be administered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, intraventricular, transdermal, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, or rectal means.
[0439] The term “treatment” for purposes of this disclosure refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) the targeted pathologic condition or disorder. Those in need of treatment include those already with the disorder as well as those prone to have the disorder or those in whom the disorder is to be prevented.
[0440] The antibodies and antigen binding fragments may have therapeutic uses in the treatment of various diseases. In certain instances, the antibodies or antigen binding fragments may interact with cells that express an antigen of interest and induce an immunological reaction by mediating ADCC. In other instances, the antibodies or fragments may block the interaction of the antigen with its protein partners. In yet other instances, the antibodies or fragments may sequester the antigen.
[0441] A “chemotherapeutic agent” is a compound useful in the treatment of cancer. Examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamine; nitrogen mustards such as chlorambucil, chlomaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, ranimustine; antibiotics such as aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, calicheamicin, carabicin, carminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfomithine; elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; mitoguazone; mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK7; razoxane; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2′,2′=-trichlorotriethylamine; urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (“Ara-C”); cyclophosphamide; thiotepa; taxanes, e.g. paclitaxel and doxetaxel; chlorambucil; gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitomycin C; mitoxantrone; vincristine; vinorelbine; navelbine; novantrone; teniposide; daunomycin; aminopterin; xeloda; ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoic acid; esperamicins; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above. Also included in this definition are anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and toremifene (Fareston); and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
[0442] Antibody Conjugates
[0443] The antibody or antigen binding fragment of the present invention may be conjugated with a detectable moiety (i.e., for detection or diagnostic purposes) or with a therapeutic moiety (for therapeutic purposes, e.g., chemotherapeutic agent)
[0444] A “detectable moiety” is a moiety detectable by spectroscopic, photochemical, biochemical, immunochemical, chemical and/or other physical means. A detectable moiety may be coupled either directly and/or indirectly (for example via a linkage, such as, without limitation, a DOTA or NHS linkage) to antibodies and antigen binding fragments thereof of the present invention using methods well known in the art. A wide variety of detectable moieties may be used, with the choice depending on the sensitivity required, ease of conjugation, stability requirements and available instrumentation. A suitable detectable moiety include, but is not limited to, a fluorescent label, a radioactive label (for example, without limitation, .sup.125I, In.sup.111, Tc.sup.99, I.sup.131 and including positron emitting isotopes for PET scanner etc), a nuclear magnetic resonance active label, a luminescent label, a chemiluminescent label, a chromophore label, an enzyme label (for example and without limitation horseradish peroxidase, alkaline phosphatase, etc.), quantum dots and/or a nanoparticle. Detectable moiety may cause and/or produce a detectable signal thereby allowing for a signal from the detectable moiety to be detected.
[0445] In another exemplary embodiment of the invention, the antibody or antigen binding fragment thereof may be coupled (modified) with a therapeutic moiety (e.g., drug, cytotoxic moiety).
[0446] In an exemplary embodiment, the antibodies and antigen binding fragments may comprise a chemotherapeutic agent or cytotoxic agent. For example, the antibody and antigen binding fragments may be conjugated to the chemotherapeutic agent or cytotoxic agent. In addition to those listed elsewhere in the present application, such chemotherapeutic or cytotoxic agents include, but are not limited to, Yttrium-90, Scandium-47, Rhenium-186, Iodine-131, Iodine-125, and many others recognized by those skilled in the art (e.g., lutetium (e.g., Lu.sup.177), bismuth (e.g., Bi.sup.213), copper (e.g., Cu.sup.67)). In other instances, the chemotherapeutic or cytotoxic agent may be comprised of, among others known to those skilled in the art, 5-fluorouracil, adriamycin, irinotecan, taxanes, pseudomonas endotoxin, ricin and other toxins.
[0447] Alternatively, in order to carry out the methods of the present invention and as known in the art, the antibody or antigen binding fragment of the present invention (conjugated or not) may be used in combination with a second molecule (e.g., a secondary antibody, etc.) which is able to specifically bind to the antibody or antigen binding fragment of the present invention and which may carry a desirable detectable, diagnostic or therapeutic moiety.
[0448] Methods of Treatment
[0449] A further aspect of the invention relates to a method of reducing the growth of a cancer cell expressing clusterin or of reducing volume of a tumor comprising clusterin-expressing cells. The method may comprise, for example, administering to a mammal in need an anti-clusterin antibody such as a polyclonal antibody, a monoclonal antibody, a chimeric antibody, a humanized antibody, an isolated human antibody, a hybrid antibody and a fragment thereof.
[0450] The method may further comprise administering a chemotherapeutic agent.
[0451] The present invention also relates in an additional aspect thereof to a method of treating a disease associated with increased clusterin expression or secretion. The method may comprise administering the humanized or hybrid antibody described herein, the antigen binding fragment described herein or the isolated antibody described herein to a mammal in need.
[0452] A mammal in need which would benefit from such method of treatment may include, for example, a mammal having a carcinoma, a mammal having an elevated level of clusterin, a mammal having an elevated level of plasma or blood clusterin, a mammal carrying or susceptible of carrying cells capable of epithelial-to-mesenchymal transition, a mammal having a disease related to an increased level of clusterin (pre-clusterin or secreted clusterin) or of clusterin expression or secretion (including blood or plasma clusterin) etc.
[0453] Another aspect of the invention concerns the use of the humanized or hybrid antibody described herein, the antigen binding fragment described herein or the isolated antibody described herein in the manufacture of a medicament for the treatment of a disease associated with clusterin expression or secretion.
[0454] Kits and Assays
[0455] In yet a further aspect, the present invention provides a kit comprising a vial or vials which may comprise, for example, the humanized or hybrid antibody described herein, the antigen binding fragment described herein or the isolated antibody described. The kit may be used for detection purposes or for therapeutic purposes.
[0456] In another exemplary embodiment, the kit may comprise the isolated nucleic acid described herein or the vector described herein. Such kit may find utility for detecting complementary nucleic acids, expressing the protein which it encodes or else.
[0457] The present invention therefore also relates to a method of detecting clusterin (pre-clusterin and secreted clusterin) by contacting a sample containing or suspected of containing clusterin with the humanized or hybrid antibody described herein, the antigen binding fragment described herein or the isolated antibody described. Detection is carried out with an apparatus having appropriate sensors which may detect the binding of an antigen to an antibody (e.g., BIAcore™, microplate reader, spectrophotometer, etc.). Such apparatus may be provided with a computer system.
[0458] As used herein the term “three-dimensional structure similar to that of or superimposable to” with respect to a variable region means that upon using a computerized model, a specified variable region has a conformation that allows for the antigen binding site to be exposed in a similar manner as another variable region. The variable regions are said to be superimposable when the computerized representation of the variable region amino acids occupies a similar position in space as the corresponding amino acids of another variable region.
[0459] As used herein the term “a modeled variable region” means a computerized representation of a variable region that is obtained from known three dimensional structures of closely related antibody variable region.
[0460] As used herein the term “non-human” encompasses without limitation rodent (e.g., mouse, rats, etc.), rabbit or nonhuman primate etc.
[0461] As used herein the term “non-human complementarity determining region amino acid residues” therefore means that amino acid residues of the complementarity determining region originates from a non-human, typically a rodent such as a mouse.
[0462] As used herein the term “non-human parent antibody” therefore encompasses an antibody obtained from a non-human which is used as starting material for humanization procedures.
[0463] The term “transforming a host cell” includes several techniques known in the art for transferring or introducing a desired nucleic acid into a host cell. Such techniques include, without limitation, transfection, infection, lipofection, injection, transduction, nucleofection, electroporation, sonoporation, heat shock, magnetofection, etc.
[0464] The term “importing” with respect to non-human heavy chain or light chain CDR amino acid residues encompasses physical and computerized methods, e.g., cloning techniques, chemical synthesis of a nucleic acid or protein, computer generated humanized antibodies, etc. As used herein the term “substantially the same” with respect to the number of amino acids, means that a variation of +/−3 amino acids or preferable +/−2 amino acids or even more preferably +/−1 amino acid may be tolerated.
EXAMPLE 1
Humanization by Design of the Anti-Clusterin Mouse Monoclonal Antibodies
[0465] 3D Modeling of the Variable Regions of the Mouse 16B5 Monoclonal Antibody.
[0466] This task was readily accomplished by mutating 3 light-chain residues and 7 heavy-chain residues in the available crystal structures of two different mouse antibodies (Protein Data Bank (PDB) codes 1Q9Q and 1TY7, respectively) followed by assembly of the light and heavy chains by superimposing the template structures. Part of the CDR-H3 loop was based on another antibody structure (PDB code 1UJ3, a humanized antibody) that also has high sequence similarity to the heavy chain of 16B5 but, unlike the mouse template structure, displays the same length for the CDR-H3 loop. The resulting structure was refined by energy minimization with the AMBER force-field and then used in the subsequent analysis. A good quality of the resulting homology model is expected in this case, given the high homology of the mouse 16B5 sequence to available structural templates. Nonetheless, comparable results were obtained in parallel control homology modeling experiments where we modeled the mouse 16B5 variable region by employing generic 3D homology modeling programs like Modeller or Composer, or antibody-specialized 3D homology modeling as implemented in the WAM software. A representation of the modeled variable regions of the mouse 16B5 antibody is given in
[0467] Characterization of the 16B5 Source Donor (Mouse) Amino-Acid Sequences and Modeled Structure.
[0468] This step was carried out to estimate the humanness index, to delineate the CDRs, canonical residues, inter-chain packing (VH/VL interface residues), variable-/constant-region packing (VH/CH and VL/CL interface residues), unusual framework residues, potential N- and O-glycosylation sites, buried residues, Vernier zone residues, and proximity to CDRs. Internet-available resources and local software were used to assess these properties.
[0469] Selection of the Best Human Light-Chain and Heavy-Chain Frameworks for the Mouse CDRs.
[0470] Selection of the best human light-chain and heavy-chain frameworks was done by standard sequence homology comparison against a local copy of human germline databases (VBASE), against other sequence libraries (Genbank and SwissProt), as well as the set of human framework consensus sequences. BLAST searches were conducted to retrieve sequence matches with highest homology in the framework region only (thus excluding CDRs) while matching the length of the CDR loops. The structures of the human or humanized variable sequences most similar to the 16B5 variable sequences identified from PDB were superimposed onto the modeled structure of the 16B5 variable region for structural comparison. Several most similar human framework sequences were initially retained in order to assess the amino-acid variability at candidate positions for mutation, as well as to provide a pool of suitable framework sequences as backup in the event of affinity loss upon humanization. The closest human framework sequences are aligned to the murine 16B5 sequences in
[0471] Identifying Mouse Framework Residues that can Influence Conformation and Antigen Binding.
[0472] The identification mouse framework residues that can influence conformation and antigen binding is an important step that flags amino-acid residues that should be mutated to the corresponding human sequences with particular care. These residues represent primary candidates for back-mutations to the mouse sequences in case of affinity loss. This is the most difficult and unpredictable step of humanization by design, particularly in the absence of an experimental structure of the antibody-antigen complex. This step relies on the identification of residues in one or more of the following categories: canonical, CDR-H3, Vernier zone, unusual, CDR-proximal (within 5 Å), inter-chain packing, and glycosylation-site residues. These residues might affect antigen-binding site and affinity directly or indirectly. The final humanized sequences of the 16B5 anti-clusterin mAb require 13 framework mutations in the light chain and 22 framework mutations in the heavy chain relative to the murine sequences, while not altering the CDRs regions. Surprisingly, a careful structural and comparative sequence analyses indicated a high probability of retaining high antigen-binding affinity by introducing all these mutations, thus aiming at reaching the highest degree of humanization allowed by the CDR grafting technique (i.e., 100%, excluding CDRs). 3D modeling of the designed humanized antibody supports this prediction. Nonetheless, we have identified candidate residues for back-mutations, including CDR-proximal residues (3 in the light chain and 9 in the heavy chain within 5 Å from CDRs), one light-chain residue in contact with the heavy chain, as well as several buried residues (and hence likely not be immunogenic) that may be converted back to the mouse sequence (4 in the light chain and 6 in the heavy chain). Mutated residues and candidate residues for back-mutations are indicated in
[0473] Additional Structural Analysis.
[0474] Prior to submitting the humanized sequence for recombinant expression, additional structural analysis included selection of signal peptide, selection of isotype, and analysis of structural compatibility at the variable-/constant-region junctions. In addition, a comparative analysis of inter-chain packing and variable-/constant-region packing between mouse and humanized antibodies indicated that in the case of 16B5 humanization it will be feasible to generate hybrid antibodies combining humanized and chimeric (mouse variable region) chains, i.e., mouse/mouse (M/M), mouse/humanized (M/H), humanized/mouse (H/M) and humanized/humanized (H/H) as light-chain/heavy-chain pairing. The isotype selected for the anti-clusterin antibodies was human IgG2. Human IgG2 do not harbor potent effector functions which is the hallmark of blocking antibodies as those disclosed here. In addition, human IgG2 are less susceptible to proteolytic cleavage which makes provides antibodies of this isotype more stability in vivo.
[0475] 3D Modeling of the Variable Regions of the Mouse 21B12 Monoclonal Antibody.
[0476] Modeling of the 21B12 mouse anti-clusterin antibody was conducted according to the teachings describes above for 16B5. The resulting humanized 21B12 was 100 humanized and required 18 mutations in the heavy chain and 14 mutations in the light chain. Mutated residues and candidate residues for back-mutations are indicated in
EXAMPLE 2
Kinetic Analysis of Anti-Clusterin Antibodies
[0477] The purpose of these investigations is to determine the kinetics parameters of anti-clusterin antibodies. In particular, to determine whether the humanization of the 16B5 and 21B12 anti-clusterin monoclonal antibody affects the kinetics parameters of its binding to human clusterin. To this end, a kinetic analysis method was developed using the BIAcore 3000. Human clusterin was immobilized on a sensor chip. Full length antibodies or Fab fragments were injected and allowed to interact with the immobilized clusterin. This example described the exemplary antibody 16B5 but the 21B12 exemplary antibody was prepared and tested in a similar manner.
[0478] Immobilization of Clusterin
[0479] HBST (10 mM Hepes pH 7.4, 135 mM NaCl, 3.4 mM EDTA, 0.005% Tween 20) was used as running buffer for all BIAcore experiments. Recombinant monomeric clusterin was immobilized on a CM3 chip with normal amine coupling method at a flow of 5 μl/min. Surface was activated with 35 μl of a mixture of 50 mM NHS/0.2M EDC. Clusterin in 10 mM Na-acetate pH 4.5 was injected until a desired amount was captured (below 60 RU). Unreacted esters were deactivated with 35 μl of 1M ethanolamine hydrochloride-NaOH pH 8.5. A control surface was prepared by injecting NHS/EDC and ethanolamine in the same manner.
[0480] Preparation of Humanized Anti-Clusterin IgG2 Antibodies
[0481] Expression vectors containing the cDNAs encoding the light and heavy chain immunoglobulins were expressed in 293 cells using transient transfection methods familiar to those skilled in the art. By virtue of the signal peptides incorporated at the amino-termini of both immunoglobulin chains, the mature IgG2 was harvested from the serum-free culture medium of the cells. Growth of the cells was continued for 5 days post-transfection after which the culture medium was harvested for purification of the IgG2 chimeric monoclonal antibodies. The protein was purified using Protein-A agarose as instructed by the manufacturer (Sigma-Aldrich Canada Ltd., Oakville, ON).
[0482] Preparation of Mouse 16B5 and HH 16B5 Fab
[0483] Mouse 16B5 IgG was treated with papain at a molar ratio of 1:100 for 4 hours at room temperature. The digestion was stopped by addition of a 4:1 molar ratio of the papain inhibitor E64. Fab fragments were separated from Fc fragments by chromatography on a 1 ml HiTrap Protein G column. The Fab fragments were eluted from the column with 0.1 M glycine, pH 2.7. The pH was neutralized immediately by collection of 1 ml fractions into tubes containing 100 μl of 2 M Tris, pH 9. Fab containing fractions were pooled and concentrated on an Amicon Ultra 4 centrifugal concentrator with a 30 kDa MW cutoff. The samples were passed through a Superose 12 size exclusion column (10×300 mm) in 20 mM HEPES, pH 7.5, 200 mM NaCl to separate the Fab and F(ab′)2 fractions. The Fab-containing fractions were pooled and concentrated on an Amicon Ultra 4 centrifugal concentrator with a 30 kDa MW cutoff.
[0484] For preparation of HH 16B5 Fab, the protocol was very similar to that of mouse Fab, except that the digestion time was 20 hours at room temperature and the Fab and Fc fragments were separated on a HiTrap Protein A column instead of a HiTrap Protein G column. The digestion time was increased based on results from a small scale test in an effort to try to eliminate the presence of F(ab′)2. The size exclusion profile showed that the longer digestion reduced, but did not eliminate completely, the presence of F(ab′)2 fragments. The switch to Protein A rather than Protein G was done to avoid exposure of the Fab fragments to the low pH required to elute the Fab fragments from the Protein G. The Fab fragments flowed through the Protein A column and the Fc fragments were retained by the Protein A. The size exclusion separation was done in PBS instead of HEPES buffer. The same methods were used to prepare 21B12 Fab fragments.
[0485] Kinetics Analysis of Mouse 16B5 and HH16B5 and Fab
[0486] Kinetics analysis was conducted at a flow of 50 μl/min. Full length antibodies (mouse or humanized) or Fab were diluted in HBST. Concentration range was from 1.953-31.25 nM for the full length antibodies and 15.625-250 nM for the Fab. Each concentration was injected over the clusterin and a control surface for 5 min followed with a 5 min dissociation wash. The clusterin surface was regenerated between each antibody injection with 50 μl of 20 mM HCl.
[0487] Kinetics Analysis of Antibodies Binding to Clusterin
[0488]
[0489] The kinetics parameters of the full length humanized 16B5 (HH16B5) is very similar to the kinetics of the full length mouse antibody (16B5), suggesting that the humanization did not affect the binding of the antibody to the clusterin. However, the kinetics parameters of the humanized 16B5 Fab (HH16B5 Fab) is slightly better the kinetics of the Fab mouse antibody (16B5 Fab), again suggesting that the humanization did not affect the binding of the antibody to the clusterin. The K.sub.D of the interaction between immobilized human clusterin and mouse 16B5 or humanized 16B5 is in the low nM range. The method develop can be use to compare the kinetics parameters during the humanization process of anti-clusterin antibodies.
[0490]
EXAMPLE 3
Biological Activity of h16B5 in Cell Based Assays
[0491] These studies were conducted to compare the biological activity of h16B5 with that of the mouse 16B5. To test the h16B5, two assays were used that had previously shown that blocking clusterin with a monoclonal antibody could reduce the migration and invasion of cancer cell lines.
[0492] To test the activity of anti-clusterin antibodies against cancer cell migration, a standard wound healing, or scratch assay, was used. In this assay, EMT6 cells, a mouse mammary carcinoma cell line, was plated at high density and subjected to wounding by the creation of a scratch in the cell layer. At time 0, a wide denuded area is evident that quickly fills up after incubation of the cells at 37 C for 15 h (see upper left-hand panels in
[0493] We then determined whether other cell lines such as the human prostate PC3 and DU145 cell lines, which secrete various levels of endogenous clusterin, could be affected in their invasive behavior and growth by the h16B5. When seeded in Matrigel (
[0494] Tumors derived from 4 different human pancreatic cell lines were obtained which were fixed in formalin, embedded in paraffin, and section on glass slides. Immunohistochemistry was conducted with h16B5 antibody to determine if tumors derived from this cancer indication expressed clusterin. The tumors were derived from Aspc-1, BxPC-3, PANC-1, and MiaPaCa-2 all of which were derived from pancreatic cancer patients (ATCC, Manassas, Va.). Paraffin-embedded epithelial pancreatic tumor samples were placed on glass slides and fixed for 15 min at 50° C. Deparaffinization was conducted by treating 2× with xylene followed by dehydration in successive 5 min washes in 100%, 80%, and 70% ethanol. The slides were washed 2× in PBS for 5 min arid treated with antigen retrieval solution (citrate-EDTA) to unmask the antigen. Endogenous peroxide reactive species were removed by incubating slides with H.sub.2O.sub.2 in methanol and blocking was performed by incubating the slides with serum-free blocking solution (Dakocytomation) for 20 min at room temperature. The primary mAb (a control IgG or h16B5) was added at 5 μg/ml for 1 h at room temperature. H16B5-reactive clusterin was detected by incubating with biotin-conjugated human anti-kappa followed by streptavidin-HRP tertiary antibody. Positive staining was revealed by treating the slides with DAB-hydrogen peroxide substrate for less than 5 min and subsequently counterstained with hematoxylin. As shown in
EXAMPLE 4
Biological Activity of h16B5 in Animal Models of Cancer
[0495] These studies were performed to measure the in vivo efficacy of h16B5 in models of human cancer. Antisense oligonucleotides and small interfering RNAs targeting clusterin have been reported to induce apoptosis and chemosensitivity in vitro in prostate cancer xenografts [1-4]. The model system that was used comprised the DU145 human prostate cancer cell line that is androgen-insensitive and represents one of the most well characterized models for this disease. Thus, 2 million cells were implanted sub-cutaneously into the flanks of SCID mice and the tumors were allowed to grow to approximately 100 mm.sup.3. Starting on day 1, h16B5 was injected intra-peritoneally (i.p.) at a dosage of 5 mg/kg and from day 4, taxotere (TxT) was injected i.p. at a dosage of 10 mg/kg. The h16B5 injections were continued twice per week while the TxT was administered weekly. As depicted in
[0496] A second prostate cancer model study was conducted in a different tumor model by implanting PC-3 prostate cancer cells. PC-3 cells are also hormone-insensitive but are documented as being slightly more invasive than the DU145 cells. As was described above, the cells were implanted sub-cutaneously in SCID mice and treatments were initiated when the tumors reached a volume of approximately 100 mm.sup.3 (designated day 1). The h16B5 injections were administered i.p. on day 1 at 5 mg/kg and continued twice per week thereafter whereas a single TxT injection at 10 mg/kg was administered i.p. on day 5. This modification in the TxT schedule was performed because it was found that PC-3 cells are significantly more susceptible to this chemotherapeutic drug compared to the DU145 tumors.
[0497] The results of this study are depicted in
[0498] The cytotoxic effect of TxT against prostate cancer cells was observed but the tumors appeared to recover from this treatment approximately 18 days following the injection. The growth of the tumors in the TxT group even surpassed that of the tumors in the group that received the AB-16B5 (see day 50,
EXAMPLE 5
H16B5 Inhibits the Internalization of Secreted Clusterin in Cancer Cells
[0499] The results disclosed above indicate that induction of the epithelial-to-mesenchymal transition (EMT) leads to the secretion of clusterin by cancer cells. Additionally, our data also showed that clusterin secreted by these cancer cells is a potent inducer of EMT. These findings imply that secreted clusterin is mediating this effect either indirectly by interacting with other tumor-associated factors in the extra-cellular matrix or directly by interacting with a receptor on the cell surface of cancer cells. Although secreted clusterin present in normal serum is known to associate with many different proteins such as members of the complement cascade, leptin, various apolipoproteins, the presence of protein partners for secreted clusterin in cancer cells or in the tumor micro-environment remains relatively unexplored. Some examples include a published report by Jo and co-workers (Jo et al., 2008) showed that tumor-secreted clusterin associated with IGF-1 under conditions of stress induced by serum deprivation. In addition, clusterin contained in prostate cancer cell lines was found to interact with a protein called COMMD1 (Zoubeidi et al., 2010). This interaction resulted in increased activation of NF-kappaB-related pathways which in turn promoted prostate cancer cell survival. These findings begin to elucidate some of the ways secreted clusterin might contribute to tumorigenesis but the molecular mechanism for how it promotes EMT is unknown.
[0500] In order to begin to address this question, cell-based experiments were undertaken to determine if secreted clusterin interacted with cancer cells directly or via other secreted factors in the cell medium. In order to measure this, secreted clusterin was fluorescently labelled and incubated with BRI-JM01 mouse mammary carcinoma cells. It was found that after approximately 24 hours of treatment, that the fluorescence signal was contained inside the cells. Analysis of these cells over shorter time points revealed that the fluorescently labelled secreted clusterin was internalized by the cells (see
[0501] This secreted clusterin internalization was further examined by testing if h16B5 could block this activity. The cells were treated with secreted clusterin-Alexa480 in the presence of h16B5 or an isotype control IgG. As shown, in
[0502] Taken together, these results which show that this the internalization of secreted clusterin can be inhibited by the addition of h16B5 suggests that this might be one of the mechanism by which the antibody prevents secreted clusterin from mediating EMT in cancer cells.
[0503] The experiments described herein may be carried out to determine how specific mutations in the amino acid sequence of an antibody (e.g., in the variable region(s), the constant region, the framework region or in the CDR(s)) affect the biological activity of the antibody. For example, one or more mutations may be introduced in the framework region of the variable light chain or variable heavy chain of h16B5 (or in the murine 16B5) and tumor growth may be assed as described herein.
[0504] Binding of variant antibodies and antigen binding fragments to human or murine clusterin may be tested by several methods known in the art such as, for example, ELISA, Western blot, surface plasmon resonance, etc.
EXAMPLE 6
Anti-Clusterin Antibodies May Bind to Clusterin Variants
[0505] The antibodies and antigen binding fragments of the present invention bind to both the human and murine form of clusterin. These two proteins share 77% amino acid sequence identity and 89% similarity (see
[0506] The present invention shows that anti-clusterin antibodies target clusterin that is expressed in human tumors. To demonstrate that the interaction of the anti-clusterin antibodies, such as h16B5, with murine tumor clusterin, frozen sections prepared from 4T1 mouse mammary tumors were incubated with h16B5. Briefly, the frozen sections were fixed with ice-cold acetone for 10 minutes and non-specific binding was blocked with a reagent supplied in a commercially available kit (Dako Canada, Inc., Burlington, ON). H16B5 was incubated with the mouse tumor section for 1 h at a concentration of 5 μg/ml. After washing, specific staining was revealed by incubating with a HRP-conjugated anti-human IgG. A control sample was processed in an identical manner with a human isotype control IgG. As shown in
[0507] Binding of the antibodies and antigen binding fragments of the present invention to naturally occurring variant or synthetic variants of clusterin may also be tested by methods known in the art, including for example, the above mentioned methods.
[0508] The CLU gene is conserved in human, chimpanzee, dog, cow, mouse, rat, chicken and zebrafish. Testing of the antibodies and antigen binding fragments in these models is encompassed by the present invention.
TABLE-US-00003 SEQUENCE LISTING: SEQ ID NO.: 1 16B5 CDRH1: GFNIKDIYMH SEQ ID NO.: 2 16B5 CDRH2: RIDPAYGNTKYDPKFQG SEQ ID NO.: 3 16B5 CDRH3: RYDTAMDY SEQ ID NO.: 4 16B5 CDRL1: KSSQSLLNSRTRKNYLA SEQ ID NO.: 5 16B5 CDRL2: WASTRES SEQ ID NO.: 6 16B5 CDRL3: KQSYNLWT SEQ ID NO.: 7 16B5 Humanized heavy chain variable region QVQLVQSGAEVKKPGATVKISCKVSGENIKDIYMHWVQQAPGKGLEWMGRIDPAY GNTKYDPKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCARRYDTAMDYWGQG TLVTVSS SEQ ID NO.: 8 16B5 Humanized light chain variable region DIVMTQSPDSLAVSLGERATINCKSSQSLENSRTRKNYLAWYQQKPGQPPKWYWA STRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCKQSYNLWTFGQGTKLEIK SEQ ID NO.: 9 Complete heavy chain immunoglobulin sequences for h16B5 QVQLVQSGAEVKKPGATVKISCKVSGENIKDIYMHWVQQAPGKGLEWMGRIDPAY GNTKYDPKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCArRYDTAMDYwgqgtlvt vsSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPV AGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPR EEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMEDSDGSFEL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO.: 10 Complete light chain immunoglobulin sequences for h16B5 DIVMTQSPDSLAVSLGERATINCKSSQSLENSRTRKNYLAWYQQKPGQPPKWYWA STRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCKQSYNLWTFGQGTKLEIKVAA PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO.: 11 21B12 CDRH1: GYTFTNYGMH SEQ ID NO.: 12 21B12 CDRH2: WINTYTGEPTYADDFKG SEQ ID NO.: 13 21B12 CDRH3: DGFLYFFDY SEQ ID NO.: 14 21B12 CDRL1: KSSQSLLYSSNQKNYLA SEQ ID NO.: 15 21B12 CDRL2: WASTRES SEQ ID NO.: 16 21B12 CDRL3: QQYYIYPRT SEQ ID NO.: 17 21B12 Humanized heavy chain variable region QVQLVQSGSELKKPGASVKVSCKASGYTFTNYGMHWVRQAPGQGLEWMGW1NTY TGEPTYADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCARDGFLYFFDYWGQG TLVTVSS SEQ ID NO.: 18 21B12 Humanized light chain variable region DIVMTQSPDSLAVSLGERATINCKSSQSLLYSSNQKNYLAWYQQKPGQPPKWYWA STRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYIYPRTFGQGTKLEIK SEQ ID NO.: 19 Complete heavy chain immunoglobulin sequences for h21B12 QVQLVQSGSELKKPGASVKVSCKASGYTFTNYGMHWVRQAPGQGLEWMGWINTY TGEPTYADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCARdGFLYFFDYWGQG TLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPC PAPPVAGPSVELFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA KTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPR EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO.: 20 Complete light chain immunoglobulin sequences for h21B12 DIVMTQSPDSLAVSLGERATINCKSSQSLLYSSNQKNYLAWYQQKPGQPPKWYWA STRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYIYPRTFGQGTKLEIKRTV AAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQSGNSQESVTEQD SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO.: 21 Complete nucleotide sequence of the heavy chain of h16B5 ATGGACTGGACCTGGCGGATCCTGTTCCTGGTGGCCGCTGCTACCGGCACCCACG CCCAGGTGCAGCTGGTGCAGTCTGGCGCCGAGGTGAAGAAGCCTGGCGCCACCG TCAAGATCAGCTGCAAGGTGTCCGGCTTCAACATCAAGGACATCTACATGCACTG GGTGCAGCAGGCTCCAGGCAAGGGACTGGAGTGGATGGGCCGGATCGACCCTGC CTACGGCAACACCAAGTACGACCCTAAGTTCCAGGGCCGGGTGACCATCACCGC CGACACCTCCACCGACACCGCCTACATGGAACTGTCCTCCCTGCGGTCCGAGGAC ACCGCCGTGTACTACTGCGCCCGGAGATACGACACCGCCATGGATTACTGGGGCC AGGGCACCCTGGTGACCGTGTCCTCCGCTTCCACCAAGGGCCCATCGGTCTTCCC CCTGGCGCCCTGCTCCAGGAGCACCTCCGAGAGCACAGCGGCCCTGGGCTGCCTG GTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCTCTGA CCAGCGGCGTGCACACCTTCCCAGCTGTCCTACAGTCCTCAGGACTCTACTCCCTC AGCAGCGTGGTGACCGTGCCCTCCAGCAACTTCGGCACCCAGACCTACACCTGCA ACGTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGACAGTTGAGCGCAAAT GTTGTGTCGAGTGCCCACCGTGCCCAGCACCACCTGTGGCAGGACCGTCAGTCTT CCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTC ACGTGCGTGGTGGTGGACGTGAGCCACGAAGACCCCGAGGTCCAGTTCAACTGG TACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCACGGGAGGAGCAG TTCAACAGCACGTTCCGTGTGGTCAGCGTCCTCACCGTTGTGCACCAGGACTGGC TGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCAGCCCCCA TCGAGAAAACCATCTCCAAAACCAAAGGGCAGCCCCGAGAACCACAGGTGTACA CCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCT GGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCA GCCGGAGAACAACTACAAGACCACACCTCCCATGCTGGACTCCGACGGCTCCTTC TTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTC TTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCC TCTCCCTGTCTCCGGGTAAATGA SEQ ID NO.: 22 Complete nucleotide sequence of the heavy chain of h21B12 ATGGACTGGACCTGGCGGATCCTGTTTCTGGTGGCCGCTGCTACCGGCACACACG CCCAGGTGCAGCTGGTGCAGTCCGGCTCCGAGCTGAAGAAACCTGGCGCCTCCGT GAAGGTGTCCTGCAAGGCCTCCGGCTACACCTTCACCAACTACGGCATGCACTGG GTGCGCCAGGCACCTGGACAGGGACTGGAATGGATGGGCTGGATCAACACCTAC ACCGGCGAGCCTACCTACGCCGACGACTTCAAGGGCAGATTCGTGTTCTCCCTGG ACACCTCCGTGTCCACCGCCTACCTGCAGATCTCCTCCCTGAAGGCCGAGGACAC CGCCGTGTACTACTGCGCCAGGGACGGCTTCCTGTACTTCTTCGACTACTGGGGC CAGGGCACCCTGGTGACCGTGTCCTCTGCCTCCACCAAGGGCCCTTCCGTGTTCC CTCTGGCCCCTTGCTCCCGGTCCACCTCTGAGTCTACCGCCGCTCTGGGCTGCCTG GTGAAGGACTACTTCCCTGAGCCTGTGACAGTGTCCTGGAACTCTGGCGCCCTGA CCTCTGGCGTGCACACCTTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTG TCCTCCGTGGTGACAGTGCCTTCCTCCAACTTCGGCACCCAGACCTACACCTGCA ACGTGGACCACAAGCCTTCCAACACCAAGGTGGACAAGACCGTGGAGCGGAAGT GCTGCGTGGAGTGCCCTCCTTGTCCTGCTCCTCCTGTGGCTGGCCCTAGCGTGTTC CTGTTCCCTCCTAAGCCTAAGGACACCCTGATGATCTCCCGGACCCCTGAAGTGA CCTGCGTGGTGGTGGACGTGTCCCACGAGGACCCTGAGGTGCAGTTCAATTGGTA CGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCCTCGGGAGGAACAGTT CAACTCCACCTTCCGGGTGGTGTCCGTGCTGACCGTGGTGCACCAGGACTGGCTG AACGGCAAAGAATACAAGTGCAAGGTGTCCAACAAGGGCCTGCCTGCCCCTATC GAAAAGACCATCTCTAAGACCAAGGGCCAGCCTCGCGAGCCTCAGGTGTACACC CTGCCTCCCTCCCGCGAGGAAATGACCAAGAACCAGGTGTCCCTGACCTGTCTGG TGAAGGGCTTCTACCCTTCCGATATCGCCGTGGAGTGGGAGTCTAACGGCCAGCC TGAGAACAACTACAAGACCACCCCTCCTATGCTGGACTCCGACGGCTCCTTCTTC CTGTACAGCAAGCTGACAGTGGACAAGTCCCGGTGGCAGCAGGGCAACGTGTTC TCCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGT CCCTGTCTCCTGGCAAGTGA SEQ ID NO.: 23 Complete nucleotide sequence of the light chain of h16B5 ATGGTGCTGCAGACCCAGGTGTTCATCTCCCTGCTGCTGTGGATCTCCGGCGCCT ACGGCGACATCGTGATGACCCAGTCCCCCGACTCCCTGGCCGTGTCCCTGGGCGA GAGAGCCACCATCAACTGCAAGTCCTCCCAGTCCCTGCTGAACTCCCGGACCCGG AAGAACTACCTGGCCTGGTATCAGCAGAAGCCTGGCCAGCCTCCTAAGCTGCTGA TCTACTGGGCCTCCACCCGGGAGTCCGGCGTGCCTGACCGGTTCTCCGGCTCCGG CAGCGGCACCGACTTCACCCTGACCATCAGCTCCCTGCAGGCCGAGGACGTGGCC GTGTACTACTGCAAGCAGTCCTACAACCTGTGGACCTTCGGCCAGGGCACCAAGC TGGAGATCAAGCGGACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGAT GAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCC CAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTC CCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAG CACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGA AGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGA GTGTTAG SEQ ID NO.: 24 Complete nucleotide sequence of the light chain of h21B12 ATGGTGCTGCAGACCCAGGTGTTCATCTCCCTGCTGCTGTGGATCTCTGGCGCCTA CGGCGACATCGTGATGACCCAGTCCCCCGACTCTCTGGCTGTGTCCCTGGGCGAG CGGGCCACCATCAACTGCAAGTCCTCCCAGTCCCTGCTGTACTCCTCCAACCAGA AGAACTACCTGGCCTGGTATCAGCAGAAGCCTGGCCAGCCTCCTAAGCTGCTGAT CTACTGGGCCTCCACCCGGGAATCTGGCGTGCCTGACCGGTTCTCCGGCTCTGGC TCCGGCACCGACTTCACCCTGACCATCAGCTCCCTGCAGGCCGAGGACGTGGCCG TGTACTACTGCCAGCAGTACTACATCTACCCTCGGACCTTCGGCCAGGGCACCAA GCTGGAAATCAAGCGGACCGTGGCCGCTCCTTCCGTGTTCATCTTCCCCCCTTCCG ACGAGCAGCTGAAGTCCGGCACCGCCTCTGTGGTGTGCCTGCTGAACAACTTCTA CCCCCGGGAGGCCAAGGTGCAGTGGAAGGTGGACAACGCCCTGCAGTCCGGCAA CTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACTCTACCTACTCCCTGTCC TCCACCCTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGCG AAGTGACCCACCAGGGCCTGTCCTCTCCCGTGACCAAGTCCTTCAACCGGGGCGA GTGCTGA SEQ ID NO.: 25 (murine 16B5 VL) DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYW ASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLWTFGGGTKLEFK SEQ ID NO.: 26 (h16B5 VL consensus1) DIVMXQSPXSLAVSXGEXXTXXCKSSQSLLNSRTRKNYLAWYQQKPGQXPKLLIY WASTRESGVPDRFXGSGSGTDFTLTISSXQAEDXAVYYCKQSYNLWTFGXGTKLEX K;
[0509] X is an amino acid substitution in comparison with a corresponding amino acid in the polypeptide set forth in SEQ ID NO.:25.
TABLE-US-00004 (h16B5 VL consensus2) SEQ ID NO.: 27 DIVMX.sub.a1QSPX.sub.a2SLAVSX.sub.a3GEX.sub.a4X.sub.a5TX.sub.a6X.sub.a7CKSSQSLLNSRTRICNYLA WYQQKPGQX.sub.a8PKLLIYWASTRESGVPDRFX.sub.a9GSGSGTDFTLTISSX.sub.a10Q AEDX.sub.a11AVYYCKQSYNL-WTFGX.sub.a12GTKLEXa.sub.13K
[0510] X.sub.a1 is a neutral hydrophilic amino acid such as for example, T or S;
[0511] X.sub.a2 is D or S;
[0512] X.sub.a3 is an hydrophobic amino acid such as for example, L or A;
[0513] X.sub.a4 is a basic amino acid such as for example R or K;
[0514] X.sub.a5 is an hydrophobic amino acid such as for example A or V;
[0515] X.sub.a6 is an hydrophobic amino acid as for example I or M;
[0516] X.sub.a7 is N or S;
[0517] X.sub.a8 is P or S;
[0518] X.sub.a9 is a neutral hydrophilic amino acid such as for example S or T;
[0519] X.sub.a10 is an hydrophobic amino acid such as for example L or V;
[0520] X.sub.a11 is an hydrophobic amino acid such as for example V or L;
[0521] X.sub.a12 is Q or G and;
[0522] X.sub.a13 is I or F.
TABLE-US-00005 (h16B5 VL consensus3) SEQ ID NO.: 28 DIVMX.sub.a1QSPX.sub.a2SLAVSX.sub.a3GEX.sub.a4X.sub.a5TX.sub.a6X.sub.a7CKSSQSLLNSRTRKNYLAW YQQKPGQX.sub.a8PKLLIYWASTRESGVPDRFX.sub.a9GSGSGTDFTLTISSX.sub.a10QA EDX.sub.a11AVYYCKQSYNL-WTFGX.sub.a12GTKLEX.sub.a13K Xa1 is T or S; Xa2 is D or S; Xa3 is L or A; Xa4 is R or K; Xa5 is A or V; Xa6 is I or M; Xa7 is N or S; Xa8 is P or S; Xa9 is S or T; Xa10 is L or V; Xa11 is V or L; Xa12 is Q or G and; Xa13 is I or F. (murine 16B5 VH) SEQ ID NO.: 29 EVQLQQSGAELVKPGASVRLSCTTSGFNIKDIYMHWVKQRPEQGLEWIGRI DPAYGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCARRYDT AMDYWGQGTSVTVSS (h16B5 VH consensusl) SEQ ID NO.: 30 XVQLXQSGAEXXKPGAXVXXSCXXSGFNIKDIYMHWVXQXPXXGLEWXGRI DPAYGNTKYDPKFQGXXTITADTSXXTAYXXLSSLXSEDTAVYYCARRYDT AMDYWGQGTXVTVSS;
[0523] X is an amino acid substitution in comparison with a corresponding amino acid in the polypeptide set forth in SEQ ID NO.:29.
TABLE-US-00006 (h16B5 VH consensus2) SEQ ID NO.: 31 X.sub.b1VQLX.sub.b2QSGAEX.sub.b3X.sub.b4KPGAX.sub.b5VX.sub.b6X.sub.b7SCX.sub.b8X.sub.b9SGFNIKDIYMHWV X.sub.b10QX.sub.b11PX.sub.b12X.sub.b13GLEWX.sub.b14GRIDPAYGNTKYDPKFQGX.sub.b15X.sub.b16TITAD TSX.sub.b17X.sub.b18TAYX.sub.b19X.sub.b20LSSLX.sub.b21SEDTAVYYCARRYDTAMDYWGQGT X.sub.b22VTVSS;
[0524] X.sub.b1 is Q or E;
[0525] X.sub.b2 is V or Q;
[0526] X.sub.b3 is an hydrophobic amino acid such as for example V or L;
[0527] X.sub.b4 is K or V;
[0528] X.sub.b5 is a neutral hydrophilic amino acid such as for example T or S;
[0529] X.sub.b6 is a basic amino acid such as for example K or R;
[0530] X.sub.b7 is an hydrophobic amino acid such as for example I or L;
[0531] X.sub.b8 is K or T;
[0532] X.sub.b9 is V or T;
[0533] X.sub.b10 is a basic amino acid such as for example Q or K;
[0534] X.sub.b11 is A or R;
[0535] X.sub.b12 is G or E;
[0536] X.sub.b13 is a basic amino acid such as for example K or Q;
[0537] X.sub.b14 is an hydrophobic amino acid such as for example M or I;
[0538] X.sub.b15 is a basic amino acid such as for example R or K;
[0539] X.sub.b16 is an hydrophobic amino acid such as for example V or A;
[0540] X.sub.b17 is a neutral hydrophilic amino acid such as for example T or S;
[0541] X.sub.b18 is for example D or N;
[0542] X.sub.b19 is an hydrophobic amino acid such as for example M or L;
[0543] X.sub.b20 is E or Q;
[0544] X.sub.b21 is R or T and;
[0545] X.sub.b22 is L or S.
TABLE-US-00007 (h16B5 VH consensus3) SEQ ID NO.: 32 X.sub.b1VQLX.sub.b2QSGAEX.sub.b3X.sub.b4KPGAX.sub.b5VX.sub.b6X.sub.b7SCX.sub.b8X.sub.b9SGFNIKDIYMHWV X.sub.b10QX.sub.b11PX.sub.b12X.sub.b13GLEWX.sub.b14GRIDPAYGNTKYDPKFQGX.sub.b15X.sub.b16TITAD TSX.sub.b17X.sub.b18TAYX.sub.b19X.sub.b20LSSLX.sub.b21SEDTAVYYCARRYDTAMDYWGQGT X.sub.b22VTVSS; X.sub.b1 is Q or E; X.sub.b2 is V or Q; X.sub.b3 is V or L; X.sub.b4 is K or V; X.sub.b5 is T or S; X.sub.b6 is K or R; X.sub.b7 is I or L; X.sub.b8 is K or T; X.sub.b9 iS V or T; X.sub.b10 is Q or K; X.sub.b11 is A or R; X.sub.b12 is G or E; Xb.sub.13 is K or Q; X.sub.b14 is M or I; Xb.sub.15 is R or K; X.sub.b16 iS V or A; X.sub.b17 is T or S; X.sub.b18 is D or N; X.sub.b19 is M or L; Xb.sub.20 is E or Q; Xb.sub.21 is R or T and; Xb.sub.22 is L or S. (murine 21B12 VL) SEQ ID NO.: 33 DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSSNQKNYLAWYQQRPGQS PKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYY IYPRTEGGGTKLEIK (h21B12 VL consensus1) SEQ ID NO.: 34 DIVMMSPXSLAVSXGEXXTXXCKSSQSLLYSSNQKINYLAWYQQXPGQX PKLLIYWASTRESGVPDRFXGSGSGTDFTLTISSXXAEDXAVYYCQQYY IYPRTFGXGTKLEIK
[0546] X is an amino acid substitution in comparison with a corresponding amino acid in the polypeptide set forth in SEQ ID NO.:33.
TABLE-US-00008 (h21B12 VL consensus2) SEQ ID NO.: 35 DIVMX.sub.c1QSPX.sub.c2SLAVSX.sub.c3GEX.sub.c4X.sub.c5TX.sub.c6X.sub.c7CKSSQSLLYSSNQ KNYLAWYQQX.sub.c8PGQX.sub.c9PKLLIYWASTRESGVPDRFX.sub.c10GSGSGTD FTLTISSX.sub.c11Xc.sub.12AEDX.sub.c13AVYYCQQYYIYPRTFGX.sub.c14GTKLEIK;
[0547] X.sub.c1 is a neutral hydrophilic amino acid such as for example T or S;
[0548] X.sub.c2 is D or S;
[0549] X.sub.c3 is an hydrophobic amino acid such as for example L or V;
[0550] X.sub.c4 is a basic amino acid such as for example R or K;
[0551] X.sub.c5 is an hydrophobic amino acid such as for example A or V;
[0552] X.sub.c6 is an hydrophobic amino acid such as for example I or M;
[0553] X.sub.c7 is N or S;
[0554] X.sub.c8 is a basic amino acid such as for example K or R;
[0555] X.sub.c9 is P or S;
[0556] X.sub.c10 is a neutral hydrophilic amino acid such as for example S or T;
[0557] X.sub.c11 is an hydrophobic amino acid such as for example L or V;
[0558] X.sub.c12 is a basic amino acid such as for example Q or K;
[0559] X.sub.c13 is an hydrophobic amino acid such as for example V or L and;
[0560] X.sub.c14 is Q or G.
TABLE-US-00009 (h21B12 VL consensus3) SEQ ID NO.: 36 DIVMX.sub.c1QSPX.sub.c2SLAVSX.sub.c3GEX.sub.c4X.sub.c5TX.sub.c6X.sub.c7CKSSQSLLYSSNQKNYLA WYQQX.sub.c8PGQX.sub.c9PKWYWASTRESGVPDRFX.sub.c10GSGSGTDFTLTISSX.sub.c11 X.sub.c12AEDX.sub.c13AVYYCQQYYIYPRTFGX.sub.c14GTKLEIK; X.sub.c1 is T or S; X.sub.c2 is D or S; Xc.sub.3 is L or V; X.sub.c4 is R or K; X.sub.c5 is A or V; X.sub.c6 is I or M; X.sub.c7 is N or S; X.sub.c8 is K or R; X.sub.c9 is P or S; X.sub.c10 is S or T; X.sub.c11 is L or V; X.sub.c12 is Q or K; X.sub.c13 iS V or L and; X.sub.c14 is Q or G. (murine 21B12 VH) SEQ ID NO.: 37 QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMHWVKQAPGKGLKWMGW INTYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARDG FLYFFDYWGQGTTLTVSS (h21B12 VH consensusl) SEQ ID NO.: 38 QXQLVQSGXELKKPGXXVKXSCKASGYTFTNYGMHWVXQAPGXGLXWMGW INTYTGEPTYADDFKGRFXFSLXTSXSTAYLQIXXLKXEDTAXYXCARDG FLYFFDYWGQGTXXTVSS
[0561] X is an amino acid substitution in comparison with a corresponding amino acid in the polypeptide set forth in SEQ ID NO.:37.
TABLE-US-00010 (h21B12 VH consensus2) SEQ ID NO.: 39 QX.sub.d1QLVQSGX.sub.d2ELKKPGX.sub.d3X.sub.d4VKX.sub.d5SCKASGYTFTNYGMHWVX.sub.d6Q APGX.sub.d7GLX.sub.d8WMGWINTYTGEPTYADDFKGRFX.sub.d9FSLX.sub.d10TSX.sub.d11ST AYLQIX.sub.d12X.sub.d13LKX.sub.d14EDTAX.sub.d15YX.sub.d16CARDGFLYFFDYWGQGTX.sub.d17 X.sub.d18TVSS;
[0562] X.sub.d1 is an hydrophobic amino acid such as for example V or I;
[0563] X.sub.d2 is S or P;
[0564] X.sub.d3 is A or E;
[0565] X.sub.d4 is a neutral hydrophilic amino acid such as for example S or T;
[0566] X.sub.d5 is an hydrophobic amino acid such as for example V or I;
[0567] X.sub.d6 is a basic amino acid such as for example R or K;
[0568] X.sub.d7 is a basic amino acid such as for example Q or K;
[0569] X.sub.d8 is E or K;
[0570] X.sub.d9 is an hydrophobic amino acid such as for example V or A;
[0571] X.sub.d10 is an acidic amino acid such as for example D or E;
[0572] X.sub.d11 is an hydrophobic amino acid such as for example V or A;
[0573] X.sub.d12 is S or N;
[0574] X.sub.d13 is S or N;
[0575] X.sub.d14 is A or N;
[0576] X.sub.d15 is V or T;
[0577] X.sub.d16 is an aromatic amino acid such as for example Y or F;
[0578] X.sub.d17 is L or T and;
[0579] X.sub.d18 is hydrophobic amino acid such as for example V or L.
TABLE-US-00011 (h21B12 VH consensus3) SEQ ID NO.: 40 QX.sub.d1QLVQSGX.sub.d2ELKKPGX.sub.d3X.sub.d4VKX.sub.d5SCKASGYTFTNYGMHWVX.sub.d6QAPG X.sub.d7GLX.sub.d8WMGWINTYTGEPTYADDFKGRFX.sub.d9FSLX.sub.d10TSX.sub.d11STAYLQI X.sub.d12X.sub.d13LKX.sub.d14EDTAX.sub.d15YX.sub.d16CARDGFLYFFDYWGQGTX.sub.d17X.sub.d18TVSS; X.sub.d1 is V or I; X.sub.d2 is S or P; X.sub.d3 is A or E; X.sub.d4 is S or T; X.sub.d5 is V or I; X.sub.d6 is R or K; X.sub.d7 is Q or K; X.sub.d8 is E or K; X.sub.d9 IS V or A; X.sub.d10 is D or E; X.sub.d11 is V or A; X.sub.d12 is S or N; X.sub.d13 is S or N; Xd.sub.14 is A or N; X.sub.d15 is V or T; X.sub.d16 is Y or F; X.sub.d17 is L or T and; X.sub.d18 is V or L. (human model of 16B5VL) SEQ ID NO.: 41 DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNSKNYLAWYQQKPGQPP KLLIYWAKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYY CQQYYSTPYSFGQGTKLEIK (human model of 16B5VH) SEQ ID NO.: 42 QVQLVQSGAEVKKPGATVKISCKVSGYTFTDYYMHWVQQAPGKGLEWMGL VDPEDGETIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCARIP LFGRDHWGQGTLVTVSR (human model of 21B12VL) SEQ ID NO.: 43 DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNSKNYLAWYQQKPGQPP KWYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPY SFGQGTKLEIK (human model of 21B12VH) SEQ ID NO.: 58 QVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGW INTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCARDW GQGTLVTVSSVATIDENWFDP 16B5 CDRH1: SEQ ID NO.: 44 GFNIKDIY 16B5 CDRH2: SEQ ID NO.: 45 IDPAYGNT 16B5 CDRH3: SEQ ID NO.: 46 X.sub.1X.sub.2RYDTAMDY X.sub.1 is A; X.sub.2 is R; or X.sub.1 and X.sub.2 are outside the CDRH3 16B5 CDRL1: SEQ ID NO.: 47 QSLLNSRTRKNY 16B5 CDRL2: WAS 16B5 CDRL3: SEQ ID NO.: 49 KQSYNLWT 21B12 CDRH1: SEQ ID NO.: 50 GYTFTNYG 21B12 CDRH2: SEQ ID NO.: 51 INTYTGEP 21B12 CDRH3: SEQ ID NO.: 52 X.sub.3X.sub.4DGFLYFFDY X.sub.3 is A; X.sub.4 iS R; or X.sub.3 and X.sub.4 are outside the CDRH3 21B12 CDRL1: SEQ ID NO.: 53 QSLLYSSNQKNY 21812 CDRL2: WAS SEQ ID NO.: 55 21B12 CDRL3: QQYYIYPRT
REFERENCES
[0580] 1. Gleave, M. E., et al., Use of antisense oligonucleotides targeting the antiapoptotic gene, clusterin/testosterone-repressed prostate message 2, to enhance androgen sensitivity and chemosensitivity in prostate cancer. Urology, 2001. 58 (2 Suppl 1): p. 39-49. [0581] 2. Trougakos, I. P., et al., Silencing expression of the clusterin/apolipoprotein j gene in human cancer cells using small interfering RNA induces spontaneous apoptosis, reduced growth ability, and cell sensitization to genotoxic and oxidative stress. Cancer Res, 2004. 64(5): p. 1834-42. [0582] 3. Gleave, M. and H. Miyake, Use of antisense oligonucleotides targeting the cytoprotective gene, clusterin, to enhance androgen- and chemo-sensitivity in prostate cancer. World J Urol, 2005. 23(1): p. 38-46. [0583] 4. Springate, C. M., et al., Efficacy of an intratumoral controlled release formulation of clusterin antisense oligonucleotide complexed with chitosan containing paclitaxel or docetaxel in prostate cancer xenograft models. Cancer Chemother Pharmacol, 2005. 56(3): p. 239-47. [0584] 5. Jo, H., Jia, Y., et al., Cancer cell-derived clusterin modulates the phosphatidylinositol-3′-kinase-Akt pathway through attenuation of insulin-like growth factor 1 during serum deprivation. Mol. Cell. Biol. 2008. 28:4285-4299. [0585] 6. Zoubeidi, A., ettinger, S. et al., Clusterin facilitates COMMD1 and I-kappaB degradation to enhance NF-kappaB activity in prostate cancer cells. Mol. Cancer Res. 2010, 8:119-130.