NON-VIRAL TRANSGENESIS

20220307050 · 2022-09-29

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided herein are new compositions and methods for use in introducing transgenes into cells. The compositions are non-viral but achieve levels of transgene integration comparable to those obtained with viral-mediated methods, and can be used for targeted integration of a transgene at a specific genomic locus.

Claims

1. A polynucleotide comprising: (a) one or more selection markers, wherein the selection markers are flanked by (b) first and second att sites, wherein the att sites are flanked by (c) first and second truncated retroviral long terminal repeats (LTRs), wherein the first truncated LTR is upstream of the first att site, the second truncated LTR is downstream of the second att site, and the first and second truncated retroviral LTRs are flanked by (d) recognition sites for a restriction enzyme, wherein cleavage of the recognition sites generates blunt ends; and (e) first and second 5′-ACTG-3′ sequences, present at or near the termini of the polynucleotide.

2-5. (canceled)

6. The polynucleotide of claim 1, wherein the retroviral LTRs are LTRs from a lentivirus comprising a human immunodeficiency virus (HIV).

7-10. (canceled)

11. The polynucleotide of claim 1, wherein the first truncated LTR sequence comprises: TABLE-US-00016 (SEQ. ID NO. 4) GGTCTCTssCTGGTTAGACCAGATCTGsAGCCTGGGAGCTCTCTGGCTAA CTAGGGAACCCACTGCTTAAGCCTCAATAAAGCTTGCCTTGAGTGCTTCA AGTAGTGTGTGCCCGTCTGTTGTGTGACTCTGGTAACTAGAGATCCCTCA GACCCTTTTAGTCAGTGTGGAAAATCTCTAGCA

12. The polynucleotide of claim 1, wherein the second truncated LTR sequence comprises: TABLE-US-00017 (SEQ. ID NO. 5) TGGAAGGGCTAATTCACTCCCAACGAAGACAAGATCTGCTTTTTGCTTGT ACTGGGTCTCTCTGGTTAGACCAGATCTGAGCCTGGGAGCTCTCTGGCTA ACTAGGGAACCCACTGCTTAAGCCTCAATAAAGCTTGCCTTGAGTGCTTC AAGTAGTGTGTGCCCGTCTGTTGTGTGACTCTGGTAACTAGAGATCCCTC AGACCCTTTTAGTCAGTGTGGAAAATCTCTAGCA

13. The polynucleotide of claim 1, wherein the restriction enzyme is selected from the group consisting of PmeI, ScaI and Bst Z17I.

14. The polynucleotide of claim 1, wherein the first and second 5′-ACTG-3′ sequences are present at the termini of the polynucleotide.

15. The polynucleotide of claim 1, wherein the first and second 5′-ACTG-3′ sequences are present one base pair inside the termini of the polynucleotide.

16. The polynucleotide of claim 1, wherein the first and second 5′-ACTG-3′ sequences are present two base pairs inside the termini of the polynucleotide.

17. A polynucleotide vector comprising: (a) sequences encoding chloramphenicol resistance and the ccdB locus, wherein the sequences are flanked by (b) an upstream attR4 site and a downstream attR3 site, wherein the att sites are flanked by (c) a 5′ dLTR sequence comprising R and U5 sequence elements upstream of the attR4 site and a 3′ dLTR sequence comprising dU3, R and U5 sequence elements downstream of the attR3 site, wherein the 5′ and 3′ dLTR sequences are flanked by (d) recognition sites for a restriction enzyme selected from the group consisting of PmeI, ScaI and BstZ17I.

18. The polynucleotide vector of claim 17, wherein the 5′ dLTR sequence comprises SEQ ID NO:4, and the 3′ dLTR sequence comprises SEQ ID NO:5.

19-21. (canceled)

22. The polynucleotide of claim 1, wherein: (a) the polynucleotide further comprises a transgene disposed between the first and second truncated retroviral LTRs; and (b) the polynucleotide does not contain a selection marker.

23-24. (canceled)

25. A polynucleotide vector comprising: (a) sequences encoding a transgene, wherein the sequences encoding a transgene are flanked by (b) an upstream attP4 site and a downstream attP3 site, wherein the att sites are flanked by (c) a 5′ dLTR sequence comprising R and U5 sequence elements upstream of the attR4 site and a 3′ dLTR sequence comprising dU3, R and U5 sequence elements downstream of the attR3 site, wherein the 5′ and 3′ dLTR sequences are flanked by (d) recognition sites for a restriction enzyme selected from the group consisting of PmeI, ScaI and BstZ17I.

26-27. (canceled)

28. The polynucleotide vector of claim 25, wherein: (a) the vector further comprises a transgene disposed between the first and second truncated retroviral LTRs; and (b) the vector does not contain a selection marker disposed between the first and second truncated retroviral LTRs.

29. (canceled)

30. The polynucleotide vector of claim 28, wherein the vector is cleaved with a restriction enzyme selected from the group consisting of PmeI, ScaI and BstZ17I.

31-33. (canceled)

34. The polynucleotide vector of claim 28, further comprising a plasmid containing sequences encoding a retroviral integrase to form a combination.

35-37. (canceled)

38. The polynucleotide vector of claim 28, further comprising mRNA encoding a retroviral integrase.

39-40. (canceled)

41. The polynucleotide vector of claim 34, wherein the retroviral integrase is from a lentivirus comprising human immunodeficiency virus (HIV).

42. (canceled)

43. The polynucleotide vector of claim 34, wherein the retroviral integrase comprises an additional nuclear localization signal (NLS) not present in the naturally-occurring integrase protein.

44. (canceled)

45. A method for inserting a transgene into the genome of a cell, the method comprising contacting the cell with the combination of claim 34.

46-47. (canceled)

48. The method of claim 45, wherein contact is by transfection.

49. (canceled)

50-53. (canceled)

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0052] FIG. 1 is a schematic diagram of a retroviral single-stranded RNA genome, focusing on the terminal sequences. R signifies a repeated sequence present at both termini of viral RNA. U5 is a noncoding sequence unique to the 5′ end of viral RNA. U3 is a noncoding sequence unique to the 3′ end of viral RNA. The remainder of the viral genome (containing gag, pol, env and other genes) is represented by the horizontal line.

[0053] FIG. 2 is a schematic diagram of a retroviral double-stranded DNA genome, focusing on the terminal sequences. R signifies a repeated sequence present at both termini of viral RNA. U5 is a noncoding sequence unique to the 5′ end of viral RNA. U3 is a noncoding sequence unique to the 3′ end of viral RNA. The remainder of the viral genome (containing gag, pol, env and other genes) is represented by the horizontal lines. The long terminal repeat (LTR) regions of the double-stranded genome are indicated.

[0054] FIG. 3 shows a schematic diagram (not to scale) of an exemplary transgene cassette. RE indicates a recognition site for a restriction enzyme that generates a blunt-ended cleavage product (e.g., PmeI, ScaI or BstZ17I). IR represents the inverted repeat sequence 5′-ACTG-3′. 5′ dLTR represents the truncated LTR sequence shown in FIG. 8B. 3′ dLTR represents the truncated LTR sequence shown in FIG. 9B. att represents an att site. INS represents a transgene. The RE and IR sites may overlap each other.

[0055] FIG. 4 is a schematic diagram of a transgene vector. The top row of the diagram shows regions of the HIV-1 LTR (dU3, U3, R and U5) relevant to construction of the vector and also shows certain restriction sites that can be used in the vector. The middle row shows the structures of the ends of the transgene cassette: the light-colored box represents one of the three restriction sites shown in the top row, and the darker boxes represent portions of the LTR present in the 5′ dLTR and 3′ dLTR sequences. The sequence 5′-ACTG-3′ is present between the restriction site and each dLTR sequence. The bottom row shows a diagram of a gateway-compatible vector containing the dLTRs shown in the middle row, along with 5′ entry sequences, middle entry sequences, and 3′ entry sequences for insertion of transgenes and regulatory sequences.

[0056] FIG. 5 is a schematic diagram (not to scale) illustrating construction of the dU3 sequence. The U3 sequence is arbitrarily divided into 3 regions: A, B and C. In the dU3 sequence, internal sequences represented by B have been deleted.

[0057] FIG. 6 is a schematic diagram of an exemplary transgene cassette, focusing on the 5′ dLTR and 3′ dLTR sequences. R signifies a repeated sequence present at both termini of viral RNA. U5 is a noncoding sequence unique to the 5′ end of viral RNA. dU3 is a deleted U3 sequence. The remainder of the cassette is represented by the horizontal lines.

[0058] FIG. 7 shows the nucleotide sequence of the HIV-1 long terminal repeat (SEQ ID NO:1). The sequence of the R region is underlined. Sequences upstream of the R region constitute the U3 region. Sequences downstream of the R region constitute the U5 region.

[0059] FIG. 8A shows the nucleotide sequence of the HIV-1 U3 region (SEQ ID NO:2). Underlining indicates the portions of the U3 region that are retained in the deleted U3 (dU3) sequence. FIG. 8B shows the nucleotide sequence of dU3 (SEQ ID NO:3).

[0060] FIG. 9A shows the nucleotide sequence of the HIV-1 LTR (SEQ ID NO:1). The R region is underlined, and the sequences present in 5′ dLTR are shaded. FIG. 9B shows the nucleotide sequence of 5′ dLTR (SEQ ID NO:4).

[0061] FIG. 10A shows the nucleotide sequence of the HIV-1 LTR (SEQ ID NO:1). The R region is underlined, and the sequences present in 3′ dLTR are shaded. FIG. 10B shows the nucleotide sequence of 3′ dLTR (SEQ ID NO:5).

[0062] FIG. 11 is a schematic diagram of a transgene (pLTR) vector, showing the locations of 5′ dLTR and 3′ dLTR sequences and other features of the vector. Abbreviations: “cmR” refers to sequences encoding resistance to chloramphenicol; “ccdB” refers to sequences encoding a DNA gyrase inhibitor lethal to E. coli; “f1(+) ori” refers to the replication origin for the + strand of f1 bacteriophage; “AmpR” refers to sequences encoding resistance to ampicillin; “ColE1 origin” refers to the replication origin for Col E1 plasmid; “5′ . . . 83” refers to the 5′ dLTR sequence; “3′ L . . . 319” refers to the 3′ dLTR sequence. Recognition sites for the BstZ17I restriction enzyme are also shown.

[0063] FIG. 12 is a schematic diagram showing portions of the pLTR vector (shown in FIG. 11) in greater detail. “attR3” and “attR4” refer to sites at which recombination will occur with other att sites in the presence of bacteriophage λ recombination proteins.

[0064] FIG. 13 shows schematic diagrams of the nucleic acids used for zebrafish injection and an outline of the experimental plan. “5′ dLTR” and “3′ dLTR” are truncated HIV-1 LTR sequences as described elsewhere herein. CMV indicates the cytomegalovirus early promoter. EGFP indicates sequences encoding enhanced green fluorescent protein. pA indicates the bovine growth hormone polyadenylation signal.

[0065] FIG. 14 shows a quantitative analysis of EGFP expression in zebrafish that developed from embryos that had been injected with integrase mRNA and a transgene cassette encoding enhanced green fluorescent protein. Analysis was conducted at two concentrations of each nucleic acid: a low dose of 12.5 ng/μl integrase mRNA and 12.5 ng/μl EGFP transgene cassette (second pair of bars from left), and a high dose of 25 integrase mRNA and 25 ng/μl EGFP transgene cassette (fourth pair of bars from left). Control samples were injected with 12.5 ng/μl (left-most pair of bars) or 25 ng/μl (third pair of bars from left) EGFP transgene cassette only (i.e., in the absence of integrase mRNA).

[0066] Fish were sorted into five groups depending on degree of expression of the transgene (Group 0: no expression through Group 4:highest level of expression), and results are expressed as the percentage of total individuals examined that fell into each group. For each pair of bars, white coloring indicates the percentage of fish in Group 0; light stippling indicates the percentage of fish in Group 1; heavy stippling indicates the percentage of fish in Group 2; dark shading indicates the percentage of fish in Group 3; and black indicates the percentage of fish in Group 4.

[0067] FIG. 15 shows a quantitative analysis of EGFP expression in zebrafish in which a EGFP transgene was introduced using a Tol2-mediated transposition system (right-most pair of bars). Results from a control experiment which did not include Tol2 mRNA are shown in the left-most pair of bars. The percentage of fish in each group (Group 0 through Group 4) is indicated by shading, as in FIG. 14.

[0068] FIG. 16 shows a quantitative analysis of EGFP expression in zebrafish in which a EGFP transgene was introduced using I-SceI meganuclease-mediated integration (right-most pair of bars. Results from a control experiment which did not include the I-SceI meganuclease are shown in the left-most pair of bars. The percentage of fish in each group (Group 0 through Group 4) is indicated by shading, as in FIG. 14.

[0069] FIG. 17 shows a quantitative analysis of EGFP expression in zebrafish that developed from embryos that had been injected with integrase mRNA and a transgene cassette containing sequences encoding enhanced green fluorescent protein under the transcriptional control of the endothelial-specific Flilep enhancer. Analysis was conducted at two concentrations of nucleic acid: a low dose of 12.5 ng/μl integrase mRNA and 12.5 ng/μl EGFP transgene cassette (second pair of bars from left), and a high dose of 25 integrase mRNA and 25 ng/μl EGFP transgene cassette (fourth pair of bars from left). Control samples were injected with 12.5 ng/μl (left-most pair of bars) or 25 ng/μl (third pair of bars from left) EGFP transgene cassette only (i.e., in the absence of integrase mRNA).

[0070] Fish were sorted into five groups depending on degree of expression of the transgene, and results are expressed as the percentage of total individuals examined that fell into each group. The percentage of fish in each group (Group 0 through Group 4) is indicated by shading, as in FIG. 14.

[0071] FIG. 18 shows schematic diagrams of the nucleic acids used for transfection of cultured cells and an outline of the experimental plan. “CMV” indicates the cytomegalovirus early promoter. “Integrase” indicates sequences encoding the HIV-1 integrase protein. “2A-tomato” indicates sequences encoding a red fluorescent protein. “5′ dLTR” and “3′ dLTR” are truncated HIV-1 LTR sequences as described elsewhere herein. EGFP indicates sequences encoding enhanced green fluorescent protein. pA indicates the bovine growth hormone polyadenylation signal.

[0072] FIG. 19 shows representative fluorescent micrographic images of cultured cells from two cell lines (A549 and PANC-1) that had been transfected with a transgene cassette encoding EGFP. The upper panels (“Control”) show images of cells transfected with an EGFP-encoding transgene cassette and a 2A-tomato-encoding vector. The lower panels (“Integrase”) show images of cells transfected with an EGFP-encoding transgene cassette and a vector encoding HIV-1 integrase and 2A-tomato. Fluorescence is indicative of stable integration of the transgene into the cellular genome.

[0073] FIG. 20 shows results of measurement of the percentage of cells exhibiting green fluorescence, which is indicative of stable integration of an EGFP-encoding transgene. The right-most pair of bars shows results obtained with cells transfected with an EGFP-encoding transgene cassette and a plasmid encoding HIV-1 integrase. The left-most pair of bars shows results obtained with cells transfected with an EGFP-encoding transgene cassette and a control plasmid lacking integrase-encoding sequences. The left-most bar in each pair shows results for A549 cells; the right-most bar in each pair shows results for PANC-1 cells.

[0074] FIG. 21 shows percentage of zebrafish stably expressing a tdTomato transgene after injection of embryos with tdTomato transgene cassettes terminating in ScaI ends (left-most pair of bars) BstZ17I ends (second pair of bars from left), PmeI ends (third pair of bars from left) or ends generated by double digestion with Apa I and MluI (right-most pair of bars). The sequence in and adjacent to the recognition site for each enzyme, or enzyme pair, is shown below each pair of bars.

[0075] For each pair of bars, the right-most bar (indicated by “+” beneath the graph) shows percentage of individuals stably expressing red fluorescence after co-injection of tdTomato-containing transgene cassette and integrase mRNA; the left-most bar (indicated by “−” beneath the graph) shows results of control injections of tdTomato-containing transgene cassette only. Fish were sorted into groups depending on their degree of red fluorescence: fish in Group 1 (indicated by light shading) exhibited partial fluorescence in heart; and fish in Group 2 (indicated by darker shading) exhibited full fluorescence in heart.

[0076] FIG. 22 is a schematic diagram illustrating the method used for targeted integration. A dCAs9/LEDGF (psip1a) fusion protein is recruited to the target sequence by a sgRNA having a portion complementary to the target sequence and a hairpin portion that binds dCas9. LEDGF in turn binds to the pre-integration complex (comprising integrase bound at both termini of the transgene cassette, on right of diagram), thereby tethering the pre-integration complex to the target sequence and directing integration at the target sequence.

[0077] FIG. 23 is a schematic diagram of the pCS-NLS-dCas9-(GGS).sub.5-zpsip1a vector.

[0078] FIG. 24 is a schematic diagram of the pCS-zpsip1a-(GGS)5-dCas9-NLS vector.

[0079] FIG. 25 is a schematic diagram of the pLTRB-CMV-tdTomato vector.

[0080] FIG. 26 shows Z-stack fluorescent confocal images of zebrafish embryos at 5 hours post-fertilization, showing green fluorescence (left), red fluorescence (center) and merged fluorescence (right). Several red cells (arrow) are visible in the merged image.

[0081] FIG. 27 shows the percentage of embryos exhibiting positive fluorescence (i.e., in groups 2, 3 or 4) after co-injection of a transgene cassette and mRNA encoding HIV-1 integrase protein or variants thereof. The transgene cassette, containing sequences encoding EGFP under the transcriptional control of an endothelium-specific enhancer (pFLi1ep:EGFP-pA), was co-injected with sequences encoding wild-type HIV-1 integrase (WT, left-most bar); sequences encoding an integrase variant containing a c-myc NLS appended to the N-terminus (5′NLS.sup.c-myc, center bar) or sequences encoding an integrase variant containing a c-myc NLS appended to the C-terminus (3′NLS.sup.c-myc, right-most bar). Fish were sorted into groups as shown, with Group 2 showing the lowest degree of fluorescence, and Group 4 showing the highest degree of fluorescence.

DETAILED DESCRIPTION

[0082] Practice of the present disclosure employs, unless otherwise indicated, standard methods and conventional techniques in the fields of cell biology, molecular biology, biochemistry, cell culture, recombinant DNA and related fields as are within the skill of the art. Such techniques are described in the literature and thereby available to those of skill in the art. See, for example, Alberts, B. et al., “Molecular Biology of the Cell,” 6.sup.th edition, Garland Science, New York, N.Y., 2015; Watson et al., “Molecular Biology of the Gene,” 7.sup.th edition, Pearson, London, 2014; Lodish et al. “Molecular Cell Biology,” 8.sup.th edition, W.H. Freeman, New York, N.Y., 2016; Voet, D. et al. “Fundamentals of Biochemistry: Life at the Molecular Level,” 5.sup.th edition, John Wiley & Sons, Hoboken, N.J., 2016; Sambrook, J. et al., “Molecular Cloning: A Laboratory Manual,” 3.sup.rd edition, Cold Spring Harbor Laboratory Press, 2001; Ausubel, F. et al., “Current Protocols in Molecular Biology,” John Wiley & Sons, New York, 1987 and periodic updates; Freshney, R. I., “Culture of Animal Cells: A Manual of Basic Technique,” 4.sup.th edition, John Wiley & Sons, Somerset, N J, 2000; and the series “Methods in Enzymology,” Academic Press, San Diego, Calif.

I. Definitions

[0083] A “transgene vector,” or “pLTR vector,” as disclosed herein, is a DNA plasmid vector which, when cleaved by an appropriate restriction enzyme, generates a DNA molecule that resembles the substrate for integration of a retroviral DNA genome. Transgene vectors are characterized by sequences that facilitate introduction of an exogenous gene (e.g., att sites), flanked by truncated retroviral long terminal repeat (LTR) sequences, which are in turn flanked by the sequence 5′-ACTG-3′, which in turn overlaps with, or is flanked by, recognition sites for a restriction enzyme whose cleavage generates blunt ends and whose recognition sequence optionally contains six or more nucleotides. A transgene vector suitable for insertion of a transgene, but which do not comprise a transgene, is denoted an “insertion vector.”

[0084] A “transgene” is any DNA sequence inserted into a transgene vector as described herein. A transgene will often be a sequence encoding a protein, but can also be, e.g., a regulatory sequence (e.g., promoter, enhancer) or a sequence encoding a regulatory RNA, such as an antisense RNA or a siRNA.

[0085] A “transgene cassette” refers to a nucleic acid (e.g., DNA) molecule comprising a transgene (or one or more selection markers) flanked by sequences promoting recombination (e.g., att sites), which recombination-promoting sequences are in turn flanked by truncated LTR sequences, which truncated LTR sequences are in turn flanked by 5′-ACTG-3′ sequences, which 5′-ACTG-3′ sequences in turn overlap with, or are flanked by, recognition sequences for a restriction enzyme that, upon cleavage, generates blunt ends. A transgene cassette can be a portion of a transgene vector, wherein the transgene vector contains additional sequences such as, for example, replication origins, transcriptional regulatory sequences and additional selection markers. A transgene cassette can an isolated DNA molecule resulting from cleavage of a transgene vector with a blunt end-generating restriction enzyme as described herein. A transgene cassette may or may not comprise a transgene; if a transgene cassette comprises a transgene, it is denoted a “transgene-containing transgene cassette.”

[0086] The terms “interior” (or “internal”) and “exterior” (or “external”) refer to relative location within a transgene cassette or transgene vector. Taking the transgene (or the selection marker(s) present in the vector before insertion of the transgene) as center; a first element being “interior to” a second element means that the first element is closer to the transgene (or selection marker) than is the second element. Alternatively, a first element being “exterior to” a second element means that the second element is closer to the transgene (or selection marker) than is the first element.

[0087] An “integrase vector,” as disclosed herein, is a DNA plasmid vector containing sequences encoding a retroviral or lentiviral integrase protein. An integrase vector can also contain control sequences that regulate expression of the integrase protein. Such control sequences can be, for example, promoters for in vitro transcription, such as, for example, a SP6 promoter or a T7 promoter or the like; or a promoter (optionally in operative linkage with an enhancer) able to function in a eukaryotic cell. Such promoters and enhancers are known in the art. Sites specifying transcription termination and polyadenylation can also be present.

[0088] A restriction enzyme recognition site (or recognition sequence) is a DNA sequence to which a restriction enzyme binds in the process of DNA cleavage by the restriction enzyme. For most restriction enzymes, their recognition site is also the site at which the restriction enzyme cleaves DNA. However, certain restriction enzymes (e.g., FokI) cleave at a site that is distinct from the sequence at which they bind.

[0089] Cleavage of DNA by a restriction enzyme generates two DNA ends at the site of cleavage. If the terminal nucleotide of those ends is base-paired, the ends are denoted “blunt ends.” If one or more of the 5′-terminal nucleotides are not base-paired, the ends are said to have a 5′ extension or a 5′-overhang. If one or more of the 3′-terminal nucleotides are not base-paired, the ends are said to have a 3′ extension or a 3′-overhang. 5′- and 3′-overhangs can consist of one, two, three, four or more unpaired nucleotides.

II. Homology and Identity of Nucleic Acids

[0090] “Homology” or “identity” or “similarity” as used herein refers to the relationship between two nucleic acid molecules based on an alignment of their nucleotide sequences. Homology and identity can each be determined by comparing a position in each sequence which may be aligned for purposes of comparison. For example, a “reference sequence” can be compared with a “test sequence.” When a position in the reference sequence is occupied by the same nucleotide at an equivalent position in the test sequence, then the molecules are identical at that position; when the equivalent position is occupied by a similar nucleotide residue (e.g., similar in steric and/or electronic nature, and/or in its hydrogen-bonding properties), then the molecules can be referred to as homologous (similar) at that position. The relatedness of two sequences, when expressed as a percentage of homology/similarity or identity, is a function of the number of identical or similar nucleotides at positions shared by the sequences being compared. In comparing two sequences, the absence of nucleotide residues, or presence of extra residues, in one sequence as compared to the other, also decreases the identity and homology/similarity.

[0091] As used herein, the term “identity” refers to the percentage of identical nucleotide residues at corresponding positions in two or more sequences when the sequences are aligned to maximize sequence matching, i.e., taking into account gaps and insertions. Identity can be readily calculated by known methods, including but not limited to those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math., 48: 1073 (1988). Methods to determine identity are designed to give the highest degree of match between the sequences tested. Moreover, methods to determine identity are codified in publicly available computer programs. Computer program methods to determine identity between two sequences include, but are not limited to, the GCG program package (Devereux et al. (1984) Nucleic Acids Research 12:387), BLASTP, BLASTN, and FASTA (Altschul et al. (1990) J. Molec. Biol. 215:403-410; Altschul et al. (1997) Nucleic Acids Res. 25:3389-3402). The BLAST X program is publicly available from NCBI and other sources. See, e.g., BLAST Manual, Altschul, S., et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul et al. (1990) J. Mol. Biol. 215:403-410. The well known Smith-Waterman algorithm can also be used to determine identity.

[0092] For sequence comparison, typically one sequence acts as a reference sequence, to which one or more test sequences are compared. Sequences are generally aligned for maximum correspondence over a designated region, e.g., a region at least about 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65 or more nucleotides in length, and the region can be as long as the full-length of the reference nucleotide sequence. When using a sequence comparison algorithm, test and reference sequences are input into a computer program, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.

[0093] Examples of algorithms that are suitable for determining percent sequence identity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215:403-410 and Altschul et al. (1977) Nucleic Acids Res. 25:3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information at www.ncbi.nlm.nih.gov (visited Jul. 22, 2019). Further exemplary algorithms include ClustalW (Higgins et al. (1994) Nucleic Acids Res. 22:4673-4680), available at www.ebi.ac.uk/Tools/clustalw/index.html (visited Jul. 22, 2019).

[0094] Sequence identity between two nucleic acids can also be described in terms of annealing, reassociation, or hybridization of two polynucleotides to each other, mediated by base-pairing. Hybridization between polynucleotides proceeds according to well-known and art-recognized base-pairing properties, such that adenine base-pairs with thymine or uracil, and guanine base-pairs with cytosine. The property of a nucleotide that allows it to base-pair with a second nucleotide is called complementarity. Thus, adenine is complementary to both thymine and uracil, and vice versa; similarly, guanine is complementary to cytosine and vice versa. An oligonucleotide or polynucleotide which is complementary along its entire length with a target sequence is said to be perfectly complementary, perfectly matched, or fully complementary to the target sequence, and vice versa. Two polynucleotides can have related sequences, wherein the majority of bases in the two sequences are complementary, but one or more bases are noncomplementary, or mismatched. In such a case, the sequences can be said to be substantially complementary to one another. If two polynucleotide sequences are such that they are complementary at all nucleotide positions except one, the sequences have a single nucleotide mismatch with respect to each other.

[0095] Conditions for hybridization are well-known to those of skill in the art and can be varied within relatively wide limits. Hybridization stringency refers to the degree to which hybridization conditions disfavor the formation of hybrids containing mismatched nucleotides, thereby promoting the formation of perfectly matched hybrids or hybrids containing fewer mismatches; with higher stringency correlated with a lower tolerance for mismatched hybrids. Factors that affect the stringency of hybridization include, but are not limited to, temperature, pH, ionic strength, and concentration of organic solvents such as formamide and dimethylsulfoxide. As is well known to those of skill in the art, hybridization stringency is increased by higher temperatures, lower ionic strengths, and lower solvent concentrations. See, for example, Ausubel et al., supra; Sambrook et al., supra; M. A. Innis et al. (eds.) PCR Protocols, Academic Press, San Diego, 1990; B. D. Hames et al. (eds.) Nucleic Acid Hybridisation: A Practical Approach, IRL Press, Oxford, 1985; and van Ness et al., (1991) Nucleic Acids Res. 19:5143-5151.

[0096] Thus, in the formation of hybrids (duplexes) between two polynucleotides, the polynucleotides are incubated together in solution under conditions of temperature, ionic strength, pH, etc., that are favorable to hybridization, i.e., under hybridization conditions. Hybridization conditions are chosen, in some circumstances, to favor hybridization between two nucleic acids having perfectly-matched sequences, as compared to a pair of nucleic acids having one or more mismatches in the hybridizing sequence. In other circumstances, hybridization conditions are chosen to allow hybridization between mismatched sequences, favoring hybridization between nucleic acids having fewer mismatches.

[0097] The degree of hybridization between two polynucleotides, also known as hybridization strength, is determined by methods that are well-known in the art. A preferred method is to determine the melting temperature (T.sub.m) of the hybrid duplex. This is accomplished, for example, by subjecting a duplex in solution to gradually increasing temperature and monitoring the denaturation of the duplex, for example, by absorbance of ultraviolet light, which increases with the unstacking of base pairs that accompanies denaturation. T.sub.m is generally defined as the temperature midpoint of the transition in ultraviolet absorbance that accompanies denaturation. Alternatively, if T.sub.ms are known, a hybridization temperature (at fixed ionic strength, pH and solvent concentration) can be chosen that is below the T.sub.m of the desired duplex and above the T.sub.m of an undesired duplex. In this case, determination of the degree of hybridization is accomplished simply by testing for the presence of duplex polynucleotide. Adsorption to hydroxyapatite can also be used to distinguish single-stranded nucleic acids from double-stranded nucleic acids.

[0098] Hybridization conditions are selected following standard methods in the art. See, for example, Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, (1989) Cold Spring Harbor, N.Y. For example, hybridization reactions can be conducted under stringent conditions. An example of stringent hybridization conditions is hybridization at 50° C. or higher in 0.1×SSC (15 mM sodium chloride/1.5 mM sodium citrate). Another example of stringent hybridization conditions is overnight incubation at 42° C. in a solution: 50% formamide, 5×SSC (0.75 M NaCl, 75 mM trisodium citrate), 50 mM sodium phosphate (pH7.6), followed by washing in 0.1×SSC at about 65° C. Optionally, one or more of 5×Denhardt's solution, 10% dextran sulfate, and/or 20 mg/ml heterologous nucleic acid (e.g., yeast tRNA, denatured, sheared salmon sperm DNA) can be included in a hybridization reaction. Stringent hybridization conditions are hybridization conditions that are at least as stringent as the above representative conditions, where conditions are considered to be at least as stringent if they are at least about 80% as stringent, typically at least 90% as stringent as the above specific stringent conditions.

[0099] The term “substantially identical” is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences possess a common functional property (e.g., enhancing the expression, stability or transport of mRNA).

[0100] The term “homology” describes a mathematically based comparison of sequence similarities which is used to identify sequences with similar functions or motifs. A reference nucleotide sequence (e.g., a sequence as disclosed herein) is used as a “query sequence” to perform a search against public databases to, for example, identify other family members, related sequences or homologues. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul et al. (1990) J. Mol. Biol. 215:403-410. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12 to obtain nucleotide sequences homologous to a reference nucleotide sequence. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al. (1997) Nucleic Acids Res. 25:3389-3402. When utilizing the BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and BLAST) can be used (see ncbi.nlm.nih.gov).

[0101] Nucleic acids and polynucleotides of the present disclosure encompass those having a nucleotide sequence that is at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.9% or 100% identical to any of SEQ ID NOs:1-5.

[0102] Nucleotide analogues are known in the art. Accordingly, nucleic acids (i.e., SEQ ID NOs:1-5) comprising nucleotide analogues are also encompassed by the present disclosure.

III. Transgene Vectors and Transgene Cassettes

[0103] Transgene vectors are based on Gateway destination vectors and are designed so that, after insertion of transgene sequences; cleavage of the vector with an appropriate restriction enzyme generates a DNA molecule resembling a retroviral pre-integration substrate. Thus, a transgene vector contains a transgene cassette comprising one or more pairs of att sites to facilitate insertion of the transgene by Gateway cloning methods. The att sites are flanked externally by truncated retroviral (e.g., lentiviral) LTR sequences (denoted 5′ dLTR and 3′ dLTR herein) which, in turn, are flanked (externally) by the inverted repeat sequence 5′-ACTG-3′. The 5′-ACTG-3′ sequences are flanked, in turn, by recognition sites for a restriction enzyme whose cleavage generates blunt-ended products. In certain embodiments, the 5′-ACTG-3′ sequences overlap with the recognition site for the blunt end-generating restriction enzyme. In certain embodiments, the recognition sites are six nucleotide pairs or greater in length. A schematic diagram of a transgene cassette is shown in FIG. 3. A transgene cassette can be part of a DNA vector (e.g., a circular plasmid) or can exist as a linear, double-stranded DNA molecule. A schematic diagram of a transgene vector, designed for insertion of a transgene and/or regulatory elements by Gateway cloning, is shown in FIG. 4.

[0104] In certain embodiments of a transgene vector, one or more selection markers are located between the att sites, to allow for selection of vectors containing an inserted transgene. The selection marker can be a negative selection marker (e.g., the ccdB gene) that causes cell death or blocks cell growth; so that replacement of the negative selection marker by transgene sequences allows survival of cells harboring a transgene-containing vector. Selection markers are known in the art and include, for example, β-lactamase, ccdB, dihydrofolate reductase (DHFR), glutamine synthetase (GS), puromycin-N-acetyl transferase, hygromycin phosphotransferase, aminoglycoside-3-phosphotransferase, ble; and sequences encoding resistance to ampicillin, tetracycline, kanamycin, chloramphenicol, G418, gentamycin and neomycin.

[0105] A. Restriction Enzyme Recognition Sites

[0106] Integration of the retroviral double-stranded DNA genome requires a blunt-ended genome, terminating in the inverted repeat sequence

TABLE-US-00006 5′-ACTG-3′ 3′-TGAC-5′

[0107] as a substrate for retroviral integrase activity. Accordingly, for transgene integration according to the present invention, the transgene is present on a blunt-ended DNA molecule; hence the restriction enzyme recognition sites that flank the transgene cassette are sites whose cleavage results in production of a blunt end (i.e., recognition sites for a blunt end-generating restriction enzyme) and whose recognition site contains all or part of the sequence 5′-ACTG-3′.

[0108] In addition, to avoid the possibility of cleavage within the transgene itself, it is preferable that the recognition site contain six nucleotide pairs or more; e.g., six nucleotide pairs, seven nucleotide pairs, eight nucleotide pairs, nine nucleotide pairs, ten nucleotide pairs, eleven nucleotide pairs, twelve nucleotide pairs or more. However, depending on the size and nucleotide sequence of the transgene, blunt end-generating restriction enzymes whose recognition sites contain four or five nucleotide pairs can also be used.

[0109] Exemplary restriction enzymes for use in the methods described herein, that produce blunt ends and whose recognition sequences contain all or part of the sequence 5′-ACTG-3′, include Sca I, PmeI and BstZ17I, whose recognition sequences are shown in Table 1.

TABLE-US-00007 TABLE 1 Exemplary restriction enzymes and their recognition sequences* Enzyme Recognition sequence Sca I 5′--AGT ACT--3′ 3′--TCA TGA--5′        ↑ Pme I: 5′--GTTT AAAC--3′ 3′--CAAA TTTG--5′         ↑ Bst Z17I: 5′--GTA TAC--3′ 3′--CAT ATG--5′        ↑ *Cleavage site is indicated by arrow

[0110] Additional restriction enzyme recognition sequence suitable for use in the transgene vectors described herein include those whose cleavage generates blunt ends terminating in the sequence 5′-ACTG-3′, or in which the sequence 5′-ACTG-3′ is within 1, 2, 3, 4 or 5 base pairs of a blunt-ended terminus. In addition, restriction enzymes generating 5′-overhanging ends which can be repaired by a DNA polymerase to generate (1) a blunt-end terminating in the sequence 5′-ACTG-3′; or (2) a blunt-ended in which the sequence 5′-ACTG-3′ is within 1, 2, 3, 4 or 5 base pairs of the blunt-ended terminus, can also be used. Furthermore, restriction enzymes generating 3′-overhanging ends which can be processed by a protein having 3′-specific, single-stranded exonuclease activity (e.g., S1 nuclease, mung bean nuclease, E. coli. exonuclease I, E. coli. exonuclease X, E. coli DNA polymerase I, E. coli DNA polymerase II, E. coli DNA polymerase III, E. coli exonuclease T), to generate (1) a blunt-end terminating in the sequence 5′-ACTG-3′; or (2) a blunt-ended in which the sequence 5′-ACTG-3′ is within 1, 2, 3, 4 or 5 base pairs of the blunt-ended terminus, can also be used.

[0111] B. Inverted Repeat Sequence

[0112] For integration of a double-stranded viral DNA genome into a host cell chromosome, the blunt-ended inverted repeat sequence

TABLE-US-00008 5′-ACTG-3′ 3′-TGAC-5′

[0113] is required at the termini of the double-stranded viral DNA genome. The 3′-processing activity of the viral integrase (int) protein removes the terminal GT dinucleotide, leaving a 5′ extension of the dinucleotide AC at both ends of the DNA molecule, which allows the molecule to serve as a substrate for strand transfer (i.e., integration).

[0114] Accordingly, the transgene vectors disclosed herein contain, at both ends of the transgene cassette, the inverted repeat (IR) sequence

TABLE-US-00009 5′-ACTG-3′ 3′-TGAC-5′.

[0115] This 5′-ACTG-3′ sequence can be part of the blunt end-generating restriction enzyme recognition site (as discussed in the previous section) or can overlap, either fully or partially, with the recognition site.

[0116] C. Truncated LTRs

[0117] The termini of retroviral and lentiviral genomes consist of identical long terminal repeat (LTR) sequences. A typical LTR contains three sequence elements: U5, a sequence unique to the 5′ end of the RNA genome; U3, a sequence unique to the 3′ end of the RNA genome; and R, a sequence contained at both the 5′ and 3′ ends of the RNA genome external to the U5 and U3 sequences. A generalized structure of a retroviral RNA genome, focusing on the terminal sequences, is shown in FIG. 1.

[0118] During the infective cycle, the single-stranded RNA genome is converted to a double-stranded DNA molecule. Due to the nature of the reverse transcription reaction, certain terminal genomic sequences are duplicated and transferred to the other end of the genome, generating long terminal repeat (LTR) sequences, as shown schematically in FIG. 2.

[0119] The LTR-containing double-stranded DNA genome is the substrate for integration; however, not all LTR sequences are required for integration of viral double-stranded DNA. In particular, many, if not all of the approximately 50 transcriptional regulatory elements, present in the U3 region, are unnecessary for integration. Accordingly, in the transgene vectors and transgene cassettes disclosed herein, not all U3 sequences are present in the truncated LTRs (dLTRs) present in the transgene vectors. In particular, the 5′ dLTR does not contain any U3 sequences, consisting of R and U5 sequences; and the 3′ dLTR contains an internally deleted U3 (dU3) region (that retains only the Sp1 and GATA-3 binding sites) along with R and U5 sequences. FIG. 5 shows a schematic diagrams of how U3 sequences were deleted to construct a dU3 sequence. A schematic diagram of the dLTR sequences of the transgene vectors and transgene cassettes is shown in FIG. 6.

[0120] The derivation of the 5′ dLTR and 3′ dLTR are shown in more detail in FIGS. 7-10. FIG. 7 shows the nucleotide sequence of the wild-type HIV-1 LTR, indicating the U3, R and U5 regions. FIG. 8A shows the sequence of the U3 region, indicating sequences which are deleted (no underlining) and sequences which are retained (underlined) in dU3. FIG. 8B show the nucleotide sequence of dU3. FIG. 9A shows the nucleotide sequence of the HIV-1 LTR and indicates the sequences present in 5′ dLTR. FIG. 9B show the nucleotide sequence of the 5′ dLTR which contains R and U5 sequences. FIG. 10A shows the nucleotide sequence of the HIV-1 LTR and indicates the sequences present in 3′ dLTR. FIG. 10B show the nucleotide sequence of the 3′ dLTR which contains dU3, R and U5 sequences.

[0121] D. att Sites

[0122] Transgene vectors are designed for rapid and simple insertion of transgenes using the gateway cloning system. See, for example, Hartley et al., supra. Accordingly, the transgene vectors disclosed herein, based on Gateway destination vectors, contain one or more pairs of att sites.

[0123] att sites are DNA sequences involved in the integration of the bacteriophage λ genome into, and its excision from, the E. coli. chromosome. The bacteriophage contains two sequence denoted attP, which, in the presence of a recombinase protein, recombine with a pair of bacterial sequence known as attB sites. The result of the recombination reaction is an E. coli genome containing an integrated λ genome, in which the integrated λ genome is flanked by hybrid att sites denoted attL and attR. Excision of an integrated λ genome is catalyzed by the xis protein, resulting in the regeneration of the attP sites in the phage genome and regeneration of the attB sites in the bacterial genome.

[0124] In a vector with a single pair of att sites, one att site lies just interior to the 5′ dLTR sequence, and the other att site lies just interior to the 3′ dLTR sequence. In certain embodiments, transgene vectors contain two pairs of att sites. In additional embodiments, transgene vectors contain three pairs of att sites: a first pair of att sites for 5′ entry clones; a second pair of att sites for middle entry clones and a third pair of att sites for 3′ entry clones as described, for example, by Kwan et al. (2007) Devel. Dynamics 236:3088-3099. Exemplary pairs of att sites include:

[0125] att L1 and att L2

[0126] att L3 and att L4

[0127] att R1 and att R2

[0128] att R3 and att R4

[0129] att B1 and att B2

[0130] att B3 and att B4

[0131] att P1 and att P2

[0132] att P3 and att P4

IV. Nucleic Acids Encoding Retroviral Integrase

[0133] Retroviral integrase proteins are encoded by a portion of the retroviral pol gene, near its 3′ end. Integrase proteins comprise approximately 300 to 400 amino acids and include three domains, that are joined by linkers of varying length. The N-terminal domain includes two pairs of zinc-chelating histidine and cysteine residues (the HHCC motif) in which a bound Zn.sup.2+ ion stabilizes a helix-turn-helix structure. The catalytic core domain is characterized by three acidic amino acids: two aspartic acid residues and a glutamic acid residue (the DDE motif) with the second aspartic acid and the glutamic acid being separated by approximately 35 residues. The DDE motif is also involved in metal ion chelation. Also within the central region of HIV-1 integrase is a non-canonical nuclear localization signal (NLS), having the amino acid sequence IIGQVRDQAEHLK (SEQ ID NO:12) which is in part responsible for the ability of HIV to infect non-dividing cells. The C-terminal domain of integrase proteins is the least well-conserved but contains β-strand barrels resembling that found in the SH3 domain and includes determinants for DNA binding and multimerization (retroviral integrases are active only as multimers: a dimer is capable of 3′-end processing, but a tetramer is required for strand transfer and integration). Certain retroviral integrases also contain a N-terminal extension.

[0134] A nucleic acid comprising sequences encoding a polypeptide having retroviral integrase activity can be, for example, a mRNA molecule. Such mRNA molecules can be generated, for example, by in vitro transcription of a DNA molecule having appropriate transcriptional control sequences such as, for example, a bacteriophage T7 promoter or a bacteriophage SP6 promoter. Transcription termination can be regulated by the presence of a transcriptional terminator sequence or a RNA molecule can be generated as the result of run-off transcription from a linear DNA template. Optionally, such integrase mRNAs contain translational regulatory sequences; e.g., a Kozak sequence or an internal ribosome entry site (IRES).

[0135] Alternatively, sequences encoding polypeptides having retroviral integrase activity are present in a DNA molecule, for example, a plasmid. In these cases, promoter and enhancer sequences, additional transcriptional regulatory sequences such as transcription termination signals and polyadenylation signals, insulators and translational regulatory sequences (such as Kozak sequences and internal ribosome entry sites) can also be present in the plasmid. See also Masuda (2011) Frontiers in Microbiology 2:1-5 (Article 210).

[0136] In additional embodiments, the disclosure provides integrase proteins (and nucleic acids encoding them) that have been engineered to contain one or more additional nuclear localization signals. For example, in addition to the endogenous NLS present in HIV-1 integrase; NLS sequences from SV40 (PKKKRKV, SEQ ID NO:13), c-myc (PAAKRVKLD, SEQ ID NO:14), the HIV Vpr protein (RRTRNGASKS, SEQ ID NO:15) and hnRNPA1 (SSNFGPMLGGNRFFRSSPY, SEQ ID NO:16) are introduced at the N-terminus and/or the C-terminus of the integrase protein. In certain embodiments, a linker sequence is present between the integrase protein and the exogenous nuclear localization signal(s) at the N- and/or C-terminus. Since different nuclear localization signals are recognized by different importin proteins (e.g., the HIV integrase NLS is recognized by importin α3 and the HIV Vpr NLS is recognized by importin al, while other NLS sequences are recognized by importin β); integrase proteins containing multiple different nuclear localization signals will accumulate at higher levels in cell nuclei; thereby increasing integration efficiency.

V. Regulatory Elements

[0137] The transgene cassettes and transgene vectors disclosed herein are gateway compatible; accordingly, it is straightforward to include not only coding sequences, but also 5′ and 3′ regulatory sequences, such as, for example, enhancers, promoters, transcription termination sites, polyadenylation signals and translation initiation sites; using two-way or three-way gateway cloning protocols. Accordingly, transgene-containing transgene cassettes, and integrated transgenes obtained by the methods described herein, can contain transcriptional and translational regulatory sequences to control the expression (e.g., temporal expression and/or regional expression) of the integrated transgene. Certain regulatory sequences, known in the art, can also provide constitutive expression of a transgene (e.g., actin promoter, CMV promoter, 3-GPDH promoter, ribosomal promoters). Transcriptional regulatory sequences include, for instance, promoters, enhancers, polyadenylation signals and insulators.

[0138] Promoters active in eukaryotic cells are known in the art and include, for example viral promoters (e.g., SV40 early promoter, SV40 late promoter, cytomegalovirus major immediate early (MIE) promoter, herpes simplex virus thymidine kinase (HSV-TK) promoter), EF1-alpha (translation elongation factor-1 α subunit) promoter, Ubc (ubiquitin C) promoter, PGK (phosphoglycerate kinase) promoter, actin promoter and others. See also Boshart et al., GenBank Accession No. K03104; Uetsuki et al. (1989) J. Biol. Chem. 264:5791-5798; Schorpp et al. (1996) Nucleic Acids Res. 24:1787-1788; Hamaguchi et al. (2000) J. Virology 74:10778-10784; and Dreos et al. (2013) Nucleic Acids Res. 41(D1):D157-D164. Tissue-specific promoters, such as the cMLC2 promoter, which specifies transcription in myocardial cells, can also be used.

[0139] Enhancer elements, and their nucleotide sequences, are known in the art. Certain enhancers can be used to direct tissue-specific expression of genes (e.g., transgenes) to which they are operatively linked. For example, the Fli1EP enhancer directs transcription to endothelial cells.

[0140] Polyadenylation signals, and their nucleotide sequences, are known in the art. Generally, a polyadenylation signal is present downstream, in the transcriptional sense, of the transgene. Polyadenylation signals that are active in eukaryotic cells include, but are not limited to, the SV40 polyadenylation signal, the bovine growth hormone (BGH) gene polyadenylation signal and the herpes simplex virus thymidine kinase gene polyadenylation signal. The polyadenylation signal directs 3′ end cleavage of pre-mRNA, polyadenylation of the pre-mRNA at the cleavage site and termination of transcription downstream of the polyadenylation signal. A core sequence AAUAAA is generally present in the polyadenylation signal. See also Cole et al. (1985) Mol. Cell. Biol. 5:2104-2113.

[0141] In further embodiments, the vectors and transgene cassettes disclosed herein contain an insulator element, also known as a matrix attachment region (MAR) or scaffold attachment region (SAR). MAR and SAR sequences act, inter alia, to insulate the chromatin structure of adjacent sequences. Thus, in a stably transformed cell, in which heterologous sequences are chromosomally integrated, an insulator sequence can prevent repression of transcription of a transgene that has integrated into a region of the cellular genome having a repressive chromatin structure. Accordingly, inclusion of one or more insulator sequences in a vector can facilitate expression of a transgene from the vector in stably-transformed cells.

[0142] Exemplary insulator elements include those from the human interferon beta gene (IBM), the chicken (G. gallus) lysozyme gene 5′ matrix attachment region (CLM), the human interferon alpha-2 gene (IAM), the mouse S4 MAR/SAR and the human X29 MAR/SAR. The insulator can be located at any location within the vector or the cassette. In certain embodiments, insulator elements are located within the transgene cassette upstream (in the transcriptional sense) of a promoter. In additional embodiments, insulator elements are present at both ends of a transgene.

[0143] In certain embodiments, the vectors also include, within an expression cassette (as defined above) a post-transcriptional regulatory element (PRE). In certain embodiments, the post-transcriptional regulatory element is a cis-acting element that promotes mRNA stability. In other embodiments, the post-transcriptional regulatory element is a cis-acting element that promotes transport of RNA from the nucleus to the cytoplasm. Exemplary PREs include the human hepatitis B virus PRE (HPRE) and the woodchuck hepatitis virus post-transcriptional regulatory element (WPRE). See, e.g., U.S. Pat. No. 6,136,597; Huang & Liang (1993) Mol. Cell. Biol. 13:7476-7486; Huang & Yen (1994) J. Virol. 68:3193-3199; Donello et al. (1996) J. Virol. 70:4345-4351; and Donello et al. (1998) J. Virology 72:5085-5092. Sub-elements of the HPRE (a element and f3 element) and WPRE (a element, f3 element and y element) have been identified. Accordingly, chimeric PREs containing mixtures of HPRE and WPRE sub-elements are also contemplated for use in the compositions disclosed herein.

[0144] Additional post-transcriptional regulatory elements include, but are not limited to, the 5′-untranslated region of the human Hsp70 gene, the SP163 sequence from the vascular endothelial growth factor (VEGF) gene, the tripartite leader sequence associated with adenovirus late mRNAs and the first intron of the human cytomegalovirus immediate early gene. See, for example, Mariati et al. (2010) Protein Expression and Purification 69:9-15.

[0145] A transgene can comprise an intron which, in certain instances, can increase production of mRNA from an integrated transgene. Exemplary introns that can be used include the human β-globin intron and the first intron of the human cytomegalovirus major immediate early (MIE) gene, also known as “intron A.”

[0146] Vectors containing a transgene cassette can contain a replication origin that functions in prokaryotic cells. Replication origins that functions in prokaryotic cells are known in the art and include, but are not limited to, the oriC origin of E. coli; plasmid origins such as, for example, the pSC101 origin, the pBR322 origin (rep) and the pUC origin; and viral (i.e., bacteriophage) replication origins (e.g., the f1 replication origin). Methods for identifying prokaryotic replication origins are provided, for example, in Sernova & Gelfand (2008) Brief. Bioinformatics 9(5):376-391.

VI. Selection Markers

[0147] Selection markers, both positive and negative, are known in the art. An exemplary selection marker that functions in eukaryotic cells is the glutamine synthetase (GS) gene; selection is applied by culturing cells in medium lacking glutamine or medium containing methionine sulfoximine. Another exemplary selection marker that functions in eukaryotic cells is the gene encoding resistance to neomycin (neo); selection is applied by culturing cells in medium containing neomycin or G418. An exemplary gene encoding neomycin resistance is the TN5 Neo gene. Additional selection markers include sequences encoding dihydrofolate reductase (DHFR, imparts resistance to methotrexate), puromycin-N-acetyl transferase (provides resistance to puromycin), hygromycin kinase (provides resistance to hygromycin B), hygromycin phosphotransferase, aminoglycoside-3-phosphotransferase, ble, and genes encoding resistance to zeocin. Yet additional selection markers that function in eukaryotic cells are known in the art. Selective agents that can be used in the methods disclosed herein are known in the art and include, but are not limited to, G418, methotrexate, neomycin, geneticin, puromycin, bleomycin, Zeocin, blasticidin, hygromycin, methionine sulfoximine and L-glutamine. Any of the sequences encoding a selection marker as described above can be operatively linked to a promoter and/or a polyadenylation signal.

[0148] The vectors disclosed herein can also contain one or more selection markers that function in prokaryotic cells. Selection markers that function in prokaryotic cells are known in the art and include, for example, sequences that encode polypeptides conferring resistance to a selective agent such as, for example, ampicillin, kanamycin, chloramphenicol, or tetracycline. An example of a polypeptide conferring resistance to ampicillin (and other beta-lactam antibiotics) is the beta-lactamase (bla) enzyme. Kanamycin resistance can result from activity of the neomycin phosphotransferase gene; and chloramphenicol resistance is mediated by chloramphenicol acetyl transferase.

[0149] Negative selection markers that are active in prokaryotic cells include the ccdB gene, which encodes a DNA gyrase inhibitor.

[0150] The vectors disclosed herein can be any nucleic acid vector known in the art. Exemplary vectors include plasmids, cosmids, bacterial artificial chromosomes (BACs) and viral vectors.

VII. Transgenes

[0151] Any sequence, coding or noncoding, can serve as a transgene. For example, a transgene can encode a detectable moiety; e.g., a fluorescent protein, such as green fluorescent protein (GFP), enhanced green fluorescent protein (EGFP), red fluorescent protein, yellow fluorescent protein, tdTomato, luciferase and the like. A transgene can also encode an enzymatic activity (e.g., β-galactosidase, β-glucuronidase, luciferase and the like). A transgene can also be a therapeutic protein, such as globin, a coagulation factor, or a therapeutic antibody.

[0152] A transgene can encode, for example, a recombinant protein, a fusion protein, an antibody, a cytokine, a hormone, an enzyme or a clotting factor. Exemplary antibodies include monoclonal antibodies, single chain antibodies, bispecific antibodies, and antibody conjugates.

[0153] Exemplary transgenes include those encoding therapeutic proteins, e.g., hormones (such as, for example, growth hormone), cytokines (e.g., erythropoietin), antibodies, monoclonal antibodies (e.g., rituximab), antibody conjugates, fusion proteins (e.g., IgG-fusion proteins), interleukins, CD proteins, MHC proteins, enzymes and clotting factors.

[0154] Exemplary cytokines include, but are not limited to, erythropoietin, granulocyte colony-stimulating factor (G-CSF), filgrastim, and PEGfilgrastim.

[0155] Exemplary hormones include, but are not limited to, human growth hormone, luteinizing hormone (Luveris), and epoetin (Procrit).

[0156] Insertion of a transgene into a transgene vector is conducted using standard gateway cloning procedures, which results in conversion of the att sites present in the transgene vector into different att sites in the transgene-containing transgene vector. For example, in certain embodiments, attR sites (e.g., attR4 and attR3) present in a transgene vector are converted to attP sites (e.g., attP4 and attP3) in the process of inserting a transgene into the vector. Depending on the method of inserting transgene sequences, multiple att sites can be present in a transgene-containing transgene vector. For example, a transgene-containing transgene vector constructed by three-way gateway cloning will comprise four att sites.

VIII. Methods for Transgenesis

[0157] The compositions disclosed herein can be used for convenient, high-efficiency, non-viral insertion of a transgene into the genome of a cell, by contacting the cell with a combination comprising (1) a transgene-containing transgene cassette (2) and a nucleic acid comprising sequences encoding a polypeptide having retroviral integrase activity. A transgene-containing transgene cassette can be an isolated, double-stranded DNA molecule or it can be one of a plurality of DNA molecules generated by digestion of a transgene-containing transgene vector with a restriction enzyme. Contact can be by any method known in the art, including transfection, injection, electroporation, biolistic delivery, protoplast fusion, polyethylene glycol (PEG)-mediated methods, polyethyleneimine (PEI)-mediated methods, DEAE-dextran-mediated methods, calcium phosphate co-precipitation, and lipid-based particles (e.g., lipofection).

[0158] The methods and compositions described herein achieve high-efficiency transgene integration. In certain embodiments, at least 5% of cells exposed to a transgene undergo stable integration of the transgene into the genome (i.e. 5% efficiency of integration). In additional embodiments, the efficiency of integration is greater than 10%, greater than 15%, greater than 20%, greater than 25%, greater than 30%, greater than 35%, greater than 40%, greater than 45%, greater than 50%, greater than 55%, greater than 60%, greater than 65%, greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95%, or greater than 98%.

[0159] The cell can be any type of cell, including eukaryotic, prokaryotic or Archaeal. Exemplary eukaryotic cells include fungal cells (e.g., Trichoderma sp., Pichia pastoris, Schizosaccharomyces pombae and Saccharomyces cerevisiae), plant cells (e.g., Arabidopsis cells and tobacco BY2 cells), insect cells (e.g., Sf9, Sf21, and Drosophila S2 cells), vertebrate cells, teleost cells (e.g., Danio sp., e.g. Danio rerio or zebrafish), mammalian cells, primate cells and human cells. The transgene-containing transgene cassette can be an isolated and/or purified nucleic acid or can be part of a collection of nucleic acid molecules resulting from restriction enzyme digestion of a larger DNA molecule, e.g., a plasmid.

[0160] Cultured mammalian cell lines, useful for expression of recombinant polypeptides, include Chinese hamster ovary (CHO) cells, human embryonic kidney (HEK) cells, virally transformed HEK cells (e.g., HEK293 cells), NS0 cells, SP20 cells, CV-1 cells, baby hamster kidney (BHK) cells, 3T3 cells, Jurkat cells, HeLa cells, COS cells, PERC.6 cells, CAP® cells, CAP-T® cells (the latter two cell lines being commercially available from Cevec Pharmaceuticals, Cologne, Germany) and cancer cell lines such as A549 and PANC-1. A number of derivatives of CHO cells are also available such as, for example, CHO-DXB11, CHO-DG-44, CHO-K1 and CHO-S. Derivatives of any of the cells described herein obtained, for example, by mutagenesis, selection, gene knock-out, targeted integration (e.g., CRISPR/CAS9; zinc finger nucleases) or cloning, are also provided. Mammalian primary cells can also be used. Myeloma and hybridoma cells can also be used.

[0161] Nucleic acids comprising sequences encoding retroviral integrase activity, for use in these methods, are described elsewhere herein.

IX: Additional Embodiments

[0162] Each retrovirus encodes its own integrase protein, has unique LTR sequences and has a unique 5′ terminal sequence of its double-stranded DNA pre-integration intermediate. Accordingly, the present disclosure provides additional transgene vectors and transgene cassettes containing dLTR sequences and 5′-terminal inverted repeat sequences of a retrovirus other than HIV-1 and methods in which such transgene vectors and transgene cassettes are used in conjunction with nucleic acids encoding an integrase protein from the virus used to provide the dLTR and inverted repeat sequences.

X. Targeted Integration

[0163] For certain applications, it is desirable to insert a transgene(s) at a specific location in the genome of the target cell or target organism. Targeted integration is achieved by taking advantage of elements of the CRISPR-Cas9 targeting system. The Cas9 protein is a RNA-guided DNA endonuclease that cleaves DNA sequences that are complementary to a guide RNA. Guide RNAs can be synthesized to be complementary to any DNA sequence of choice, and are thereby able to target the Cas9 endonuclease to any DNA sequence of choice (i.e., a genomic DNA sequence complementary to the targeting portion of the sequence of the guide RNA). Moreover, mutants of Cas9 that lack endonuclease activity (so-called “dead Cas9” or dCas9) can be fused to functional domains (such as transcriptional activation domains and transcriptional repression domains) to target the activity of these domains to particular genomic sequences (e.g., promoters).

[0164] dCas9 is a catalytically inactive mutant of the Streptococcus pyogenes cas9 protein that lacks endonuclease activity. The dCas9 protein remains capable of binding to DNA/RNA duplexes and therefore can be targeted to a particular chromosomal sequence using a guide RNA of appropriate nucleotide sequence.

[0165] The amino acid sequence of S. pyogenes dCas9 is:

TABLE-US-00010 (SEQ ID NO: 6) MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIK KNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVD DSFFHRLE ESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLR LIYLALAH MIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKA ILSARLSK SRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSK DTYDDDLD NLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYD EHHQDLTL LKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMD GTEELLVK LNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEK ILTFRIPY YVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDK NLPNEKVL PKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRK VTVKQLKE DYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDIL EDIVLTLT LFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQ SGKTILDF LKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPA IKKGILQT VKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKE LGSQILKE HPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLK DDSIDNKV LTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERG GLSELDKA GFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVS DFRKDFQF YKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMI AKSEQEIG KATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDF ATVRKVLS MPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPT VAYSVLVV AKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLII KLPKYSLF ELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQ KQLFVEQH KHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHL FTLTNLGA PAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD

[0166] Lens epithelium-derived growth factor (LEGDF/p75) also known as psip1a, PC4 or SFRS1-interacting protein, is a host factor that participates in integration of the HIV genome into a host chromosome. The C-terminal portion of this protein contains an integrase-binding domain, which interacts with lentiviral integrase proteins and with other cellular proteins. The psip1a protein also binds to chromosomal DNA, thereby tethering integrase to chromosomal DNA at the integration site.

[0167] The amino acid sequence of zebrafish psip1a is:

TABLE-US-00011 (SEQ ID NO: 7) MAQDFKAGDLIFAKMKGYPHWPARIDEIPDGAVKPSNIKFPIFF FGTHETAFLGPKDIFPYLTNKDKYGKPNKRKGFNEGLWEIENNPKVELNG HKVKKVGE VSIKDLSSNEEGDDEKRTKSAQIAHSEGLEDEVDIEKEDGGDMDVSDQRL VKDEDLSQ KDSTNVTAKAKRGRKRKSDAEQDSDTENSSPTAGGSGLDFLSTGTSIMLL KRRGRKSK TEKSIILQQQASKELPRSGKDGKRDERKGDKRKESTLQKLHGEIKTSLKI GNLDVRKC VHALDELSSLHVTTQHLQRHSELIATLKKICRFKSSQDVMDKAIMLYNKF KSMFLMGE GESVLSQVLNKSLTEQKLFEEAKRGVLKNTEQTKEQKDTKILNEDFNSEE DAETEKDK LGGNILSMVKNNMTDPAEESV

[0168] For targeted integration using the transgene vectors disclosed herein, the transgene vector and integrase-encoding nucleic acid are supplemented with a nucleic acid (e.g., DNA, RNA) encoding a fusion between dCas9 and the psip1a (LEDGF) protein, in conjunction with a guide RNA whose targeting region is complementary to the genomic sequence at which integration is desired. The guide RNA targets the dCas9 portion of the fusion protein to the target genomic sequence, while the psip1a portion of the fusion protein interacts with integrase to tether the integrase/transgene cassette pre-integration complex to the target genomic sequence, thereby facilitating integration at the target genomic sequence. A schematic diagram illustrating this method is shown in FIG. 22.

[0169] Accordingly, in certain embodiments for targeted integration of a transgene, the following constituents are introduced into the target cell:

[0170] (1) single guide RNA (sgRNA) with a sequence complementary to the target genomic sequence and a hairpin sequence that binds dCas9,

[0171] (2) a dCas9-psip1a fusion protein, or mRNA encoding a dCas9-psip1a fusion protein,

[0172] (3) mRNA encoding an integrase, and

[0173] (4) a transgene cassette.

[0174] In additional embodiments, sequences encoding the dCas9-psip1a fusion protein are present on a DNA molecule (e.g., a plasmid) and are under the transcriptional and translational control of elements that are active in the target cell.

[0175] In additional embodiments, sequences encoding the integrase protein are present on a DNA molecule (e.g., a plasmid) and are under the transcriptional and translational control of elements that are active in the target cell.

[0176] The foregoing methods for targeted integration rely on binding of the psip1a portion of the psip1a-dCas9 fusion protein to integrase molecules that are present at both ends of the transgene cassette in a preintegration complex. However, endogenous psip1a (already present in the cell) can compete with binding of the psip1a-dCas9 fusion protein to the integrase proteins present in the preintegration complex. Accordingly, in certain embodiments, the psip1a-dCas9 fusion protein is overexpressed in target cells, for example, by injecting RNA encoding the psip1a-dCas9 fusion protein at a molar excess to integrase RNA, by injecting a quantity of RNA encoding the psip1a-dCas9 fusion protein that will produce a molar excess of psip1a-dCas9 fusion protein to endogenous psip1a, or by introducing an expression vector containing sequences encoding the psip1a-dCas9 fusion protein (instead of RNA encoding the psip1a-dCas9 fusion protein) in which the sequences encoding the psip1a-dCas9 fusion protein are under the transcriptional control of sequences that express, or can be induced to express, the psip1A-dCas9-encoding sequence at high levels. In additional embodiments, inhibition of expression of endogenous psip1a, for example, by blocking splicing of psip1a pre-mRNA with morpholino compounds, can also be used to enhance the efficiency of targeted integration.

[0177] Translational control elements (e.g., Kozak sequences or the like) which are active at high levels in the host cell can also be included in vectors for overexpression of the psip1a-dCas9 fusion protein.

EXAMPLES

Example 1: Construction of Transgene Vectors

[0178] Transgene plasmids (pLTR vectors) were constructed by modifying the Gateway cloning destination vector pminiTol2 R4R3 (Addgene #40970, see also Kwan et al. (2007) Devel. Dynamics 236:3088-3099), which contains an attR4/attR3 gateway cassette flanked by Tol2 transposon sequences.

[0179] Briefly, the upstream and downstream miniTol2 sequences were replaced by two truncated HIV-1 LTR sequences. The upstream miniTol2 sequence was replaced with sequences containing the R and U5 sequences of the HIV-1 LTR (5′-dLTR; template from Addgene #14883). The downstream miniTol2 sequence was replaced with sequences containing dU3, R and U5 sequences of the HIV-1 LTR (3′-dLTR; template from Addgene #19319).

[0180] For sequence replacement, DNA molecules were constructed that contained the replacement sequence (5′ dLTR or 3′ dLTR) with the sequence 5′-ACTG-3′ appended to the 5′ end of the replacement sequence, and terminating in a recognition site for a blunt end-generating restriction enzyme (e.g., ScaI, PmeI or BstZ17I). Replacement DNA molecules were amplified by PCR, using Addgene 14883 and 19319 as templates, using Platinum™ Taq DNA Polymerase High Fidelity (Invitrogen). The amplification products were then inserted into the pminiTol2R4R3 vector. 5′ dLTR-containing PCR products were ligated into NdeI/XhoI-digested pminiTol2R4R3. 3′ dLTR-containing PCR products were ligated into ApaI/ScaII-digested pminiTol2R4R3.

[0181] A schematic diagram of the vector is shown in FIG. 11. A more detailed map of the transgene cassette portion of the vector is provided in FIG. 12. The vector shown in FIG. 11 has recognition sites for the blunt end-generating restriction enzyme BstZ17I external to the truncated LTR (i.e., 5′ dLTR and 3′ dLTR) sequences. Two additional vectors have been constructed: one having PmeI sites at these locations and the other having ScaI sites at these locations.

[0182] Transgenes, and optionally regulatory sequences, are inserted into the transgene vector using standard gateway cloning methods. One-way, two-way, or three-way insertions can be used, depending on the nature of the transgene and associated (e.g., regulatory) sequences. See, e.g., Hartley et al., supra for additional details of methods for one-way, two-way and three-way insertions.

[0183] Plasmids were amplified in One Shot® TOP10 E. coli cells (Invitrogen, Carlsbad, Calif.) and purified using a PureLink® Quick Plasmid Miniprep Kit (Invitrogen) for subsequent microinjection, transfection, or production of mRNA by in vitro transcription.

Example 2: Construction of Integrase Vectors

[0184] The pCS2-integrase and pCS2-integrase-2A-tdTomato overexpression vectors were constructed using standard gateway cloning protocols with pCSDest2 (Addgene #22424), p3E-2a-tdTomato (Addgene #67707) and pME-integrase. pME-integrase was generated by conducting a standard gateway BP reaction using wild-type HIV-1 integrase in pET15b (Addgene #61668) as a template for PCR. A Kozak sequence was present in the vector for regulation of translation of the integrase sequences. All constructs were verified by DNA sequencing.

[0185] The p5E-CMV/SP6 plasmid (a 5′ entry gateway clone containing the CMV promoter) was obtained from Dr. Nathan Lawson. p5E-cmlc2 was obtained from a zebrafish Tol2 kit generated by Dr. Chien Chi-Bin. Kwan, K. M. et al. (2007) Dev Dyn 236:3088-3099. cmlc2 is a promoter that specifies transcription in the heart.

Example 3: Stable Integration of a Transgene in Zebrafish

[0186] This example shows that co-injection of an EGFP-expressing transgene cassette and integrase-encoding mRNA, into zebrafish embryos, results in high-efficiency, stable transfection.

[0187] Adult zebrafish were housed in an Aquaneering (San Diego, Calif.) zebrafish housing system at 28° C. on a 14-hours light and 10-hours dark cycle. Single pair crossing were used to generate fertilized embryos for microinjection to test for stable genomic integration of transgenes. After analysis, selected embryos were incubated in the egg water at 28° C. for up to 6 days post-fertilization (dpf) before being raised in the main system.

[0188] A transgene cassette comprising sequences encoding enhanced green fluorescent protein (EGFP) under the control of a CMV promoter (pLTR-CMV-EGFP) was constructed by inserting a CMV promoter, EGFP cDNA and a BGH polyadenylation signal into the vector described in Example 1 using a 3-way (i.e., 5′ entry (CMV promoter), middle entry (EGFP) and 3′ entry (polyadenylation signal)) gateway insertion. See FIG. 13.

[0189] Integrase-encoding mRNA was generated using a mMESSAGE mMACHINE® SP6 Transcription Kit (Invitrogen) with pCS2-Integrase, linearized with NotI, as a template. RNA was purified by phenol/chloroform extraction and ethanol precipitation.

[0190] One-cell zebrafish embryos were co-injected with the EGFP transgene cassette and the integrase mRNA, as shown schematically in FIG. 13. Microinjection was performed as described. Kawakami, K. (2007) Genome Biol 8 Suppl 1:S7; Thermes, V. et al. (2002) Mech Dev 118:91-98. Embryos at the one-cell stage were injected with a high dose of 25 ng/ul each of DNA and RNA, or with a low dose of 12.5 ng/ul each of DNA and RNA) in a volume of 0.5 nl per embryo.

[0191] The injected embryos were analyzed for the expression of the EGFP transgene at 6 days post-fertilization (DPF). For fluorescence analysis, live embryos were placed in egg water containing 1× tricaine. Fluorescence images were acquired using a Leica M165 FC stereo microscope. Injected embryos were categorized in five different groups (Group 0 through Group 4) based on the degree of GFP expression, with Group 0 showing no EGFP fluorescence and Group 4 showing the highest amount of EGFP fluorescence. Groups 2-4 represent successful genome integration with strong transgene expression and a high potential for germ line transmission in F1 fish. Group 0 and Group 1 represent fish in which no integration occurred (Group 0) or a very small amount of integration occurred (Group 1).

[0192] A comparison of integration levels using two different doses of injected nucleic acid (a high dose of 25 ng/ul each of mRNA and DNA or a low dose of 12.5 ng/ul each) was performed, and the results were quantified. As shown in FIG. 14, stable integration (i.e., generation of fish in groups 2, 3 and 4) was obtained in 55% of embryos injected at the high dose; and in 38% of embryos injected at the low dose. When these results are compared with those obtained from embryos in control experiments injected with only the transgene cassette (FIG. 14, first and third pairs of bars), it is clear that the HIV-1 integrase greatly facilitates the integration rate. Accordingly, the methods disclosed herein are capable of achieving stable transgenesis in zebrafish with very high efficiency.

Example 4: Comparison with Other Methods of Zebrafish Transgenesis

[0193] Existing methods for construction of transgenic zebrafish (and other organisms) without using viral vectors include (1) Tol2-mediated transgenesis and (2) meganuclease (e.g., I-SceI)-mediated transgenesis. Accordingly, the methods described herein were compared to these two methods of performing transgenesis in zebrafish. FIG. 15 shows that Tol2-mediated integration resulted in 62% stable transgenesis (i.e., 62% of fish that developed from treated embryos fell into Groups 2, 3 and 4); and FIG. 16 shows that I-SceI-mediated integration results in 20% stable transgenesis (i.e., 20% of fish that developed from treated embryos fell into Groups 2, 3 and 4) These results were consistent with those obtained previously Kawakami et al. (2007) Genome Biol. 8:Suppl 1: S7; Thermes et al. (2002) Mech. Devel. 118:91-98. Thus, the efficiency of transgenesis obtained with the methods disclosed herein (up to 55%) is much higher than that obtained using the I-SceI method, and comparable to that obtained using Tol2-mediated transposon sequences. Moreover, the methods disclosed herein do not suffer from the disadvantage, encountered with Tol2-mediated transgenesis, of mobilization of the integrated transgene in the presence of the Tol2 transposon. These results indicate that the efficiency of transgenesis obtained with the methods disclosed herein is better than or similar to current methods.

Example 5: Tissue-Specific Transgene Expression

[0194] To test for the ability to direct tissue-specific expression of a transgene introduced by the methods disclosed herein, a transgene cassette containing sequences encoding EGFP under the control of Flilep enhancer (which directs transcription in endothelial cells) was constructed and denoted pLTR-Fli1ep:EGFP-pA. The p5E-fli1ep plasmid, containing the Flilep enhancer, was obtained from Dr. Nathan Lawson.

[0195] As in Example 3, fish that developed from injected embryos were grouped into five categories based on the degree of EGFP expression (negative expression: Group 0, low expression: Group 1 and increasing degrees of positive expression: Groups 2, 3 and 4). Fluorescent images of zebrafish that developed from embryos that had been injected with integrase mRNA and a transgene cassette containing sequences encoding enhanced green fluorescent protein under the transcriptional control of the endothelial-specific Flilep enhancer showed that; in Groups 2, 3 and 4; EGFP expression was primarily restricted to the vasculature. In addition, the levels of stable transgene integration were 57% in fish injected with 25 ng/ul and 27% in fish injected with 12.5 ng/ul (FIG. 17) similar to the levels observed in Example 3 using an enhancerless construct. These results demonstrate that the methods disclosed herein provide the ability for regional, spatial and tissue-specific control of stable transgene expression.

[0196] In additional experiments using the catalytically-deficient integrase mutants D116A and E152A, a much lower integration efficiency (approximately 10%) was obtained; and all integrants were in Group 2 (i.e., low level of integration). These results indicate that, although a certain amount of integration can occur in the absence of integrase activity, high levels of integration depend on functional integrase.

Example 6: Stable Transgenesis in Cultured Cells

[0197] This example shows that high levels of stable integration are obtained following co-transfection, into cultured human cells, of (1) a transgene cassette containing EGFP-encoding sequences under the transcriptional control of a CMV promoter and a (2) plasmid encoding HIV-1 integrase under the transcriptional control of a CMV promoter (pCS2-Integrase-2A-tdTomato). The transgene cassette was obtained by cleavage of the pLTR-CMV-EGFP plasmid (described in Example 3) with BstZ17I. The design of the experiment is shown schematically in FIG. 18.

[0198] Two human epithelial cancer lines, A549 and PANC-1, were used in these experiments. Human lung cancer cell line A549 was acquired from ATCC (#CCL-185) and maintained in F12 medium supplied with 10% fetal bovine serum at 37° C. in a humidified atmosphere of 5% CO.sub.2/95% air in the presence of antibiotics. The human pancreatic cancer line PANC-1 was obtained from Sigma (#87092802) and maintained in DMEM with 10% fetal bovine serum at 37° C. in a humidified atmosphere of 5% CO.sub.2/95% air in the presence of antibiotics.

[0199] Transfection was conducted using Lipofectamine® 3000 (Invitrogen, Carlsbad, Calif.) according to the manufacturer's instructions. Briefly, one day before transfection, cells were seeded at a density of 2×10.sup.5 cells/well in a 12-well plate. After 24 hours, the cells were rinsed with phosphate-buffered saline (PBS). Each group was transfected with a mixture of 1 μg BstZ17I-digested pLTR-CMV-EGFP and 1 μg of pCS2-Integrase-2A-tdTomato, using Lipofectamine®-p3000 mixture in Opti-MEM for 4 hours, after which an equal volume of complete medium was added. In control experiments, cells were transfected with the EGFP transgene cassette and a plasmid that lacked sequences encoding integrase (pSC2-2ATomato-pA).

[0200] One day after transfection, the cells were subcultured and analyzed by flow cytometry to determine the number of cells that received both DNA molecules. Single cell suspensions of the samples were prepared by trypsinization, and the fluorescence intensity of each sample was evaluated on a LSR II flow cytometer (BD Biosciences, San Jose, Calif.). For each analysis, at least 10,000 events were recorded. Green (GFP) and Red (tdTomato) fluorescent signal were used as indicators for successful co-transfection of transgene and integrase plasmid, respectively, and the percentages of double positive events (both red and green fluorescence) were calculated using FACSDiva software (BD Biosciences). Untransfected cells served as a negative control.

[0201] Seven days after transfection (approximately three passages), at which time only stable transfectants persist, the degree of integration was determined by fluorescence imaging using a Leica M165 FC stereomicroscope. At least four images were taken in random locations of the dish for each experimental group. Representative images are shown in FIG. 19, with green fluorescence (shown as white in the figure) indicating stable integration of the EGFP transgene cassette.

[0202] To quantify the percentage of the cells with positive GFP expression, all images were analyzed and processed consistently using Image J by adjusting the threshold and counting the positive pixels.

[0203] Quantified results were averaged and normalized to the transfection efficiency. FIG. 20 shows the results of the quantitative analysis, which indicate that 42% of A549 cells, and 41% of PANC-1 cells, that received both the EGFP transgene cassette and the integrase plasmid expressed EGFP, compared to 12% of A5459 cells, and 13% of PANC-1 cells, that received the transgene cassette and a plasmid that did not express integrase (pCS2-2Atomato-pA).

Example 7: Effect of End Structure on Integration Efficiency

[0204] As noted elsewhere herein, retroviral integrases require a linear double-stranded DNA molecule, containing the terminal inverted repeat sequence 5′-ACTG-3′, as a substrate for end processing and strand transfer (i.e., integration). In this example, the effect, on integration efficiency, of the location of the 5′-ACTG-3′ sequence (the IR sequence), with respect to the termini of the transgene cassette, was tested. To this end, four versions of a transgene vector containing sequences encoding the red fluorescent protein tdTomato, under the transcriptional control of the cardiac-specific cMLC2 promoter and the BGH polyadenylation site, were generated. Each had a different end structure external to the IR sequences. Cleavage of the transgene vector with ScaI generated perfect 5′-ACTG-3′ blunt-ends on the resulting transgene DNA cassette; while cleavage with BstZ17I generated a transgene cassette with one additional terminal nucleotide exterior to the IR sequence (5′-TACTG-3′) and cleavage with PmeI generated a transgene cassette with two extra nucleotides exterior to the IR sequence (5′-AAACTG-3′). Double digestion with MluI and ApaI generated ends with 4-nucleotide overhangs exterior to the IR sequence.

[0205] One-cell embryos were injected with 12.5 ng/μl of integrase-encoding mRNA and 12.5 ng/μl of the of each of four different tdTomato-encoding transgene cassettes. Fish developing from injected embryos were analyzed for red fluorescence at 6 days post-fertilization dpf) and categorized into three groups: Group 0 (no fluorescence); Group 1 (partial fluorescence in heart) and Group 2 (full fluorescence in heart). The percentage of embryos in Groups 1 and 2 (i.e., percentage of embryos in which transgene was stably integrated) is shown in FIG. 21. As can be seen, there were no significant differences, in integration efficiency among transgene cassettes terminating in ScaI ends, BstZ17I ends and PmeI ends. Thus, the presence of one or two extra nucleotide, external to the IR sequence, does not affect integration efficiency. In contrast, if the transgene cassette possessed ends having 4-nucleotide overhangs (generated by double digestion with MluI (5′-CGCG overhang) and ApaI (3′-CCGG overhang) external to the 5′-ACTG-3′ IR sequence, integrase-dependent integration was totally abolished (FIG. 21), suggesting that the integrase cannot perform 3′ processing or strand transfer on such a substrate. These results indicate that the terminal sequence and structure of the transgene cassette is important for high-efficiency integration, but that a certain amount of variability in the location of the IR sequence is tolerated.

[0206] In additional experiments, the contribution of the LTR sequences that are present in the transgene cassette was investigated. The following results were obtained:

[0207] (a) transgenes whose expression was directed by an endothelium-specific enhancer, flanked on both ends with a 21-nucleotide U3 sequence that included a 5′-ACTG-3′ blunt-ended sequence (i.e., no dLTR sequences), integrated efficiently in the presence of integrase; however, integration was non-specific;

[0208] (b) transgenes with a single downstream 3′-dLTR (i.e., no upstream 5′ dLTR) integrated with higher efficiency than transgenes flanked by both a 5′-dLTR and a 3′-dLTR;

[0209] (c) transgenes with a single upstream 5′-dLTR (i.e., no downstream 3′ dLTR) integrated with lower efficiency than transgenes flanked by both a 5′-dLTR and a 3′-dLTR.

[0210] Statistical Analysis

[0211] All assays were carried out in triplicate or more. Data was expressed as a mean or stacked mean with standard deviation (SD). The Student's t-test was used to compare the mean between groups to determine statistical significance; with a p value <0.05 considered statistically significant.

Example 8: Vectors Encoding dCas9-psip1a Fusions

[0212] A vector encoding a fusion between LEGDF (psip1A) and dCas9 was constructed as follows. Sequences encoding zebrafish psip1a (zpsip1a) cDNA were cloned from zebrafish DNA and inserted by gateway cloning into the pME entry vector. Cas9 sequences were obtained as a KpnI/NheI fragment produced by double digestion of the dCas9 plasmid #100091 (Addgene, Watertown, Mass.). The psip1a sequence, the cas9 sequence, linearized pCS expression vector (Miyoshi et al. (1998) J. Virol. 72:8150-8157), a nuclear localization sequence (NLS) and sequences encoding (GGS).sub.5 (SEQ ID NO:17) linkers were joined by Gibson assembly (Gibson et al. (2009) Nature Methods 6:343-345) to generate two fusions: one in which dCas9 sequences are upstream of psip1a sequences; the other in which dCas9 sequences are downstream of psip1a sequences. Schematically, the two fusions have the following structures: [0213] pCS-NLS-dCas9-(GGS).sub.5-zpsip1a (Cas-psip vector) [0214] pCS-zpsip1a-(GGS).sub.5-dCas9-NLS (psip-Cas vector)

[0215] The nucleotide sequence of the pCS-NLS-dCas9-(GGS).sub.5-zpsip1a vector is:

TABLE-US-00012 (SEQ ID NO: 8) 1 CGCCATTCTG CCTGGGGACG TCGGAGCAAG CTTGATTTAG GTGACACTAT AGAATACAAG 61 CTACTTGTTC TTTTTGCAGG ATccgccacc ATGcccaaga agaagaggaa ggtgggtggt 121 tccggaggaa gccggccaat ggacaagaag tactccattg ggctcgctat cggcacaaac 181 agcgtcggct gggccgtcat tacggacgag tacaaggtgc cgagcaaaaa attcaaagtt 241 ctgggcaata ccgatcgcca cagcataaag aagaacctca ttggcgccct cctgttcgac 301 tccggggaga cggccgaagc cacgcggctc aaaagaacag cacggcgcag atatacccgc 361 agaaagaatc ggatctgcta cctgcaggag atctttagta atgagatggc taaggtggat 421 gactctttct tccataggct ggaggagtcc tttttggtgg aggaggataa aaagcacgag 481 cgccacccaa tctttggcaa tatcgtggac gaggtggcgt accatgaaaa gtacccaacc 541 atatatcatc tgaggaagaa gcttgtagac agtactgata aggctgactt gcggttgatc 601 tatctcgcgc tggcgcatat gatcaaattt cggggacact tcctcatcga gggggacctg 661 aacccagaca acagcgatgt cgacaaactc tttatccaac tggttcagac ttacaatcag 721 cttttcgaag agaacccgat caacgcatcc ggagttgacg ccaaagcaat cctgagcgct 781 aggctgtcca aatcccggcg gctcgaaaac ctcatcgcac agctccctgg ggagaagaag 841 aacggcctgt ttggtaatct tatcgccctg tcactcgggc tgacccccaa ctttaaatct 901 aacttcgacc tggccgaaga tgccaagctt caactgagca aagacaccta cgatgatgat 961 ctcgacaatc tgctggccca gatcggcgac cagtacgcag accttttttt ggcggcaaag 1021 aacctgtcag acgccattct gctgagtgat attctgcgag tgaacacgga gatcaccaaa 1081 gctccgctga gcgctagtat gatcaagcgc tatgatgagc accaccaaga cttgactttg 1141 ctgaaggccc ttgtcagaca gcaactgcct gagaagtaca aggaaatttt cttcgatcag 1201 tctaaaaatg gctacgccgg atacattgac ggcggagcaa gccaggagga attttacaaa 1261 tttattaagc ccatcttgga aaaaatggac ggcaccgagg agctgctggt aaagcttaac 1321 agagaagatc tgttgcgcaa acagcgcact ttcgacaatg gaagcatccc ccaccagatt 1381 cacctgggcg aactgcacgc tatcctcagg cggcaagagg atttctaccc ctttttgaaa 1441 gataacaggg aaaagattga gaaaatcctc acatttcgga taccctacta tgtaggcccc 1501 ctcgcccggg gaaattccag attcgcgtgg atgactcgca aatcagaaga gaccatcact 1561 ccctggaact tcgaggaagt cgtggataag ggggcctctg cccagtcctt catcgaaagg 1621 atgactaact ttgataaaaa tctgcctaac gaaaaggtgc ttcctaaaca ctctctgctg 1681 tacgagtact tcacagttta taacgagctc accaaggtca aatacgtcac agaagggatg 1741 agaaagccag cattcctgtc tggagagcag aagaaagcta tcgtggacct cctcttcaag 1801 acgaaccgga aagttaccgt gaaacagctc aaagaagact atttcaaaaa gattgaatgt 1861 ttcgactctg ttgaaatcag cggagtggag gatcgcttca acgcatccct gggaacgtat 1921 cacgatctcc tgaaaatcat taaagacaag gacttcctgg acaatgagga gaacgaggac 1981 attcttgagg acattgtcct cacccttacg ttgtttgaag atagggagat gattgaagaa 2041 cgcttgaaaa cttacgctca tctcttcgac gacaaagtca tgaaacagct caagaggcgc 2101 cgatatacag gatgggggcg gctgtcaaga aaactgatca atgggatccg agacaagcag 2161 agtggaaaga caatcctgga ttttcttaag tccgatggat ttgccaacag gaacttcatg 2221 cagttgatcc atgatgactc tctcaccttt aaggaggaca tccagaaagc acaagtttct 2281 ggccaggggg acagtcttca cgagcacatc gctaatcttg caggtagccc agctatcaaa 2341 aagggaatac tgcagaccgt taaggtcgtg gatgaactcg tcaaagtaat gggaaggcat 2401 aagcccgaga atatcgttat cgagatggcc cgagagaacc aaactaccca gaagggacag 2461 aagaacagta gggaaaggat gaagaggatt gaagagggta taaaagaact ggggtcccaa 2521 atccttaagg aacacccagt tgaaaacacc cagcttcaga atgagaagct ctacctgtac 2581 tacctgcaga acggcaggga catgtacgtg gatcaggaac tggacatcaa tcggctctcc 2641 gactacgacg tggatgctat cgtgccccag tcttttctca aagatgattc tattgataat 2701 aaagtgttga caagatccga taaaaataga gggaagagtg ataacgtccc ctcagaagaa 2761 gttgtcaaga aaatgaaaaa ttattggcgg cagctgctga acgccaaact gatcacacaa 2821 cggaagttcg ataatctgac taaggctgaa cgaggtggcc tgtctgagtt ggataaagcc 2881 ggcttcatca aaaggcagct tgttgagaca cgccagatca ccaagcacgt ggcccaaatt 2941 ctcgattcac gcatgaacac caagtacgat gaaaatgaca aactgattcg agaggtgaaa 3001 gttattactc tgaagtctaa gctggtctca gatttcagaa aggactttca gttttataag 3061 gtgagagaga tcaacaatta ccaccatgcg catgatgcct acctgaatgc agtggtaggc 3121 actgcactta tcaaaaaata tcccaagctt gaatctgaat ttgtttacgg agactataaa 3181 gtgtacgatg ttaggaaaat gatcgcaaag tctgagcagg aaataggcaa ggccaccgct 3241 aagtacttct tttacagcaa tattatgaat tttttcaaga ccgagattac actggccaat 3301 ggagagattc ggaagcgacc acttatcgaa acaaacggag aaacaggaga aatcgtgtgg 3361 gacaagggta gggatttcgc gacagtccgg aaggtcctgt ccatgccgca ggtgaacatc 3421 gttaaaaaga ccgaagtaca gaccggaggc ttctccaagg aaagtatcct cccgaaaagg 3481 aacagcgaca agctgatcgc acgcaaaaaa gattgggacc ccaagaaata cggcggattc 3541 gattctccta cagtcgctta cagtgtactg gttgtggcca aagtggagaa agggaagtct 3601 aaaaaactca aaagcgtcaa ggaactgctg ggcatcacaa tcatggagcg atcaagcttc 3661 gaaaaaaacc ccatcgactt tctcgaggcg aaaggatata aagaggtcaa aaaagacctc 3721 atcattaagc ttcccaagta ctctctcttt gagcttgaaa acggccggaa acgaatgctc 3781 gctagtgcgg gcgagctgca gaaaggtaac gagctggcac tgccctctaa atacgttaat 3841 ttcttgtatc tggccagcca ctatgaaaag ctcaaagggt ctcccgaaga taatgagcag 3901 aagcagctgt tcgtggaaca acacaaacac taccttgatg agatcatcga gcaaataagc 3961 gaattctcca aaagagtgat cctcgccgac gctaacctcg ataaggtgct ttctgcttac 4021 aataagcaca gggataagcc catcagggag caggcagaaa acattatcca cttgtttact 4081 ctgaccaact tgggcgcgcc tgcagccttc aagtacttcg acaccaccat agacagaaag 4141 cggtacacct ctacaaagga ggtcctggac gccacactga ttcatcagtc aattacgggg 4201 ctctatgaaa caagaatcga cctctctcag ctcggtggag acggtggtag tggaggttca 4261 ggaggatccg gggggagcgg agggagcgct agcatggctc aggatttcaa agctggtgat 4321 ctgatttttg ctaagatgaa gggttatcca cactggcctg caaggattga tgagattcca 4381 gatggtgctg tcaaaccatc aaatataaaa tttcccatct tcttttttgg cactcatgaa 4441 acagcattcc tgggtcctaa agacatattc ccctatttga ccaataaaga caaatatggc 4501 aaacctaaca aaaggaaggg tttcaatgaa ggcttgtggg aaattgaaaa caatcctaaa 4561 gtggagctta atggacacaa ggtaaaaaag gttggagaag tttcaattaa agatttgagc 4621 agcaatgaag agggagatga tgagaagagg acaaagtcag ctcaaattgc tcacagtgag 4681 gggctggagg acgaggtgga cattgagaag gaagatggtg gtgacatgga cgtttctgat 4741 cagagacttg ttaaagatga agacctatca cagaaagatt cgacaaatgt cactgccaaa 4801 gctaaaagag gaaggaagag aaagagtgat gctgaacaag actctgatac agaaaattca 4861 agcccaactg caggcggttc cggtttagat ttcctatcaa caggtacatc aattatgtta 4921 ctgaagcgca gaggaaggaa atctaaaaca gagaagtcaa taatactaca acaacaggct 4981 tcaaaggaat taccaaggtc aggtaaagat ggaaagagag atgaaagaaa aggtgacaaa 5041 agaaaggagt ccacactgca gaagttgcac ggggagatta agacatcatt gaagattggt 5101 aatttagatg taaggaaatg tgtacatgca ttggatgagt taagctctct acatgttacc 5161 actcaacatc ttcagagaca tagtgaactc atagcaactc tgaaaaagat ctgcagattc 5221 aaatccagcc aggatgtgat ggacaaagct attatgctat ataataagtt taaaagtatg 5281 tttttaatgg gagaaggaga atcagtgcta agtcaggtgc tcaataaaag tctgactgaa 5341 cagaaactat ttgaagaagc caagagggga gtcctaaaaa acacagaaca aactaaagag 5401 cagaaagata ccaagatttt gaatgaagac ttcaactccg aagaggacgc tgagacagag 5461 aaggacaaat taggaggaaa catcttatct atggtgaaaa acaacatgac tgatcctgca 5521 gaagagtctg tctgacTCGA GCCTCTAGAA CTATAGTGAG TCGTATTACG TAGATCCAGA 5581 CATGATAAGA TACATTGATG AGTTTGGACA AACCACAACT AGAATGCAGT GAAAAAAATG 5641 CTTTATTTGT GAAATTTGTG ATGCTATTGC TTTATTTGTA ACCATTATAA GCTGCAATAA 5701 ACAAGTTAAC AACAACAATT GCATTCATTT TATGTTTCAG GTTCAGGGGG AGGTGTGGGA 5761 GGTTTTTTAA TTCGCGGCCG CGGCGCCAAT GCATTGGGCC CGGTACCCAG CTTTTGTTCC 5821 CTTTAGTGAG GGTTAATTGC GCGCTTGGCG TAATCATGGT CATAGCTGTT TCCTGTGTGA 5881 AATTGTTATC CGCTCACAAT TCCACACAAC ATACGAGCCG GAAGCATAAA GTGTAAAGCC 5941 TGGGGTGCCT AATGAGTGAG CTAACTCACA TTAATTGCGT TGCGCTCACT GCCCGCTTTC 6001 CAGTCGGGAA ACCTGTCGTG CCAGCTGCAT TAATGAATCG GCCAACGCGC GGGGAGAGGC 6061 GGTTTGCGTA TTGGGCGCTC TTCCGCTTCC TCGCTCACTG ACTCGCTGCG CTCGGTCGTT 6121 CGGCTGCGGC GAGCGGTATC AGCTCACTCA AAGGCGGTAA TACGGTTATC CACAGAATCA 6181 GGGGATAACG CAGGAAAGAA CATGTGAGCA AAAGGCCAGC AAAAGGCCAG GAACCGTAAA 6241 AAGGCCGCGT TGCTGGCGTT TTTCCATAGG CTCCGCCCCC CTGACGAGCA TCACAAAAAT 6301 CGACGCTCAA GTCAGAGGTG GCGAAACCCG ACAGGACTAT AAAGATACCA GGCGTTTCCC 6361 CCTGGAAGCT CCCTCGTGCG CTCTCCTGTT CCGACCCTGC CGCTTACCGG ATACCTGTCC 6421 GCCTTTCTCC CTTCGGGAAG CGTGGCGCTT TCTCATAGCT CACGCTGTAG GTATCTCAGT 6481 TCGGTGTAGG TCGTTCGCTC CAAGCTGGGC TGTGTGCACG AACCCCCCGT TCAGCCCGAC 6541 CGCTGCGCCT TATCCGGTAA CTATCGTCTT GAGTCCAACC CGGTAAGACA CGACTTATCG 6601 CCACTGGCAG CAGCCACTGG TAACAGGATT AGCAGAGCGA GGTATGTAGG CGGTGCTACA 6661 GAGTTCTTGA AGTGGTGGCC TAACTACGGC TACACTAGAA GGACAGTATT TGGTATCTGC 6721 GCTCTGCTGA AGCCAGTTAC CTTCGGAAAA AGAGTTGGTA GCTCTTGATC CGGCAAACAA 6781 ACCACCGCTG GTAGCGGTGG TTTTTTTGTT TGCAAGCAGC AGATTACGCG CAGAAAAAAA 6841 GGATCTCAAG AAGATCCTTT GATCTTTTCT ACGGGGTCTG ACGCTCAGTG GAACGAAAAC 6901 TCACGTTAAG GGATTTTGGT CATGAGATTA TCAAAAAGGA TCTTCACCTA GATCCTTTTA 6961 AATTAAAAAT GAAGTTTTAA ATCAATCTAA AGTATATATG AGTAAACTTG GTCTGACAGT 7021 TACCAATGCT TAATCAGTGA GGCACCTATC TCAGCGATCT GTCTATTTCG TTCATCCATA 7081 GTTGCCTGAC TCCCCGTCGT GTAGATAACT ACGATACGGG AGGGCTTACC ATCTGGCCCC 7141 AGTGCTGCAA TGATACCGCG AGACCCACGC TCACCGGCTC CAGATTTATC AGCAATAAAC 7201 CAGCCAGCCG GAAGGGCCGA GCGCAGAAGT GGTCCTGCAA CTTTATCCGC CTCCATCCAG 7261 TCTATTAATT GTTGCCGGGA AGCTAGAGTA AGTAGTTCGC CAGTTAATAG TTTGCGCAAC 7321 GTTGTTGCCA TTGCTACAGG CATCGTGGTG TCACGCTCGT CGTTTGGTAT GGCTTCATTC 7381 AGCTCCGGTT CCCAACGATC AAGGCGAGTT ACATGATCCC CCATGTTGTG CAAAAAAGCG 7441 GTTAGCTCCT TCGGTCCTCC GATCGTTGTC AGAAGTAAGT TGGCCGCAGT GTTATCACTC 7501 ATGGTTATGG CAGCACTGCA TAATTCTCTT ACTGTCATGC CATCCGTAAG ATGCTTTTCT 7561 GTGACTGGTG AGTACTCAAC CAAGTCATTC TGAGAATAGT GTATGCGGCG ACCGAGTTGC 7621 TCTTGCCCGG CGTCAATACG GGATAATACC GCGCCACATA GCAGAACTTT AAAAGTGCTC 7681 ATCATTGGAA AACGTTCTTC GGGGCGAAAA CTCTCAAGGA TCTTACCGCT GTTGAGATCC 7741 AGTTCGATGT AACCCACTCG TGCACCCAAC TGATCTTCAG CATCTTTTAC TTTCACCAGC 7801 GTTTCTGGGT GAGCAAAAAC AGGAAGGCAA AATGCCGCAA AAAAGGGAAT AAGGGCGACA 7861 CGGAAATGTT GAATACTCAT ACTCTTCCTT TTTCAATATT ATTGAAGCAT TTATCAGGGT 7921 TATTGTCTCA TGAGCGGATA CATATTTGAA TGTATTTAGA AAAATAAACA AATAGGGGTT 7981 CCGCGCACAT TTCCCCGAAA AGTGCCACCT AAATTGTAAG CGTTAATATT TTGTTAAAAT 8041 TCGCGTTAAA TTTTTGTTAA ATCAGCTCAT TTTTTAACCA ATAGGCCGAA ATCGGCAAAA 8101 TCCCTTATAA ATCAAAAGAA TAGACCGAGA TAGGGTTGAG TGTTGTTCCA GTTTGGAACA 8161 AGAGTCCACT ATTAAAGAAC GTGGACTCCA ACGTCAAAGG GCGAAAAACC GTCTATCAGG 8221 GCGATGGCCC ACTACGTGAA CCATCACCCT AATCAAGTTT TTTGGGGTCG AGGTGCCGTA 8281 AAGCACTAAA TCGGAACCCT AAAGGGAGCC CCCGATTTAG AGCTTGACGG GGAAAGCCGG 8341 CGAACGTGGC GAGAAAGGAA GGGAAGAAAG CGAAAGGAGC GGGCGCTAGG GCGCTGGCAA 8401 GTGTAGCGGT CACGCTGCGC GTAACCACCA CACCCGCCGC GCTTAATGCG CCGCTACAGG 8461 GCGCGTCCCA TTCGCCATTC AGGCTGCGCA ACTGTTGGGA AGGGCGATCG GTGCGGGCCT 8521 CTTCGCTATT ACGCCAGTCG ACCATAGCCA ATTCAATATG GCGTATATGG ACTCATGCCA 8581 ATTCAATATG GTGGATCTGG ACCTGTGCCA ATTCAATATG GCGTATATGG ACTCGTGCCA 8641 ATTCAATATG GTGGATCTGG ACCCCAGCCA ATTCAATATG GCGGACTTGG CACCATGCCA 8701 ATTCAATATG GCGGACTTGG CACTGTGCCA ACTGGGGAGG GGTCTACTTG GCACGGTGCC 8761 AAGTTTGAGG AGGGGTCTTG GCCCTGTGCC AAGTCCGCCA TATTGAATTG GCATGGTGCC 8821 AATAATGGCG GCCATATTGG CTATATGCCA GGATCAATAT ATAGGCAATA TCCAATATGG 8881 CCCTATGCCA ATATGGCTAT TGGCCAGGTT CAATACTATG TATTGGCCCT ATGCCATATA 8941 GTATTCCATA TATGGGTTTT CCTATTGACG TAGATAGCCC CTCCCAATGG GCGGTCCCAT 9001 ATACCATATA TGGGGCTTCC TAATACCGCC CATAGCCACT CCCCCATTGA CGTCAATGGT 9061 CTCTATATAT GGTCTTTCCT ATTGACGTCA TATGGGCGGT CCTATTGACG TATATGGCGC 9121 CTCCCCCATT GACGTCAATT ACGGTAAATG GCCCGCCTGG CTCAATGCCC ATTGACGTCA 9181 ATAGGACCAC CCACCATTGA CGTCAATGGG ATGGCTCATT GCCCATTCAT ATCCGTTCTC 9241 ACGCCCCCTA TTGACGTCAA TGACGGTAAA TGGCCCACTT GGCAGTACAT CAATATCTAT 9301 TAATAGTAAC TTGGCAAGTA CATTACTATT GGAAGGACGC CAGGGTACAT TGGCAGTACT 9361 CCCATTGACG TCAATGGCGG TAAATGGCCC GCGATGGCTG CCAAGTACAT CCCCATTGAC 9421 GTCAATGGGG AGGGGCAATG ACGCAAATGG GCGTTCCATT GACGTAAATG GGCGGTAGGC 9481 GTGCCTAATG GGAGGTCTAT ATAAGCAATG CTCGTTTAGG GAAC

[0216] Vector backbone sequences are represented by uppercase letters. Underlined segments of the sequence are as follows:

[0217] 35-51: SP6 promoter

[0218] 64-78: β-globin translational leader sequence

[0219] 94-114: nuclear localization sequence from SV40 large T-antigen

[0220] 139-4242: dCas 9

[0221] 4243-4287: (GGS).sub.5 linker (SEQ ID NO:17) (not underlined)

[0222] 4294-5535: zebrafish psip1a

[0223] 5573-5768: SV40 polyadenylation signal

[0224] 7020-7880: Amp.sup.R gene.

[0225] A map of this vector is shown in FIG. 23.

[0226] The nucleotide sequence of the pCS-zpsip1a-(GGS).sub.5-dCas9-NLS vector is:

TABLE-US-00013 (SEQ ID NO: 9) 1 CGCCATTCTG CCTGGGGACG TCGGAGCAAG CTTGATTTAG GTGACACTAT AGAATACAAG 61 CTACTTGTTC TTTTTGCAGG ATccgccacc atggctcagg atttcaaagc tggtgatctg 121 atttttgcta agatgaaggg ttatccacac tggcctgcaa ggattgatga gattccagat 181 ggtgctgtca aaccatcaaa tataaaattt cccatcttct tttttggcac tcatgaaaca 241 gcattcctgg gtcctaaaga catattcccc tatttgacca ataaagacaa atatggcaaa 301 cctaacaaaa ggaagggttt caatgaaggc ttgtgggaaa ttgaaaacaa tcctaaagtg 361 gagcttaatg gacacaaggt aaaaaaggtt ggagaagttt caattaaaga tttgagcagc 421 aatgaagagg gagatgatga gaagaggaca aagtcagctc aaattgctca cagtgagggg 481 ctggaggacg aggtggacat tgagaaggaa gatggtggtg acatggacgt ttctgatcag 541 agacttgtta aagatgaaga cctatcacag aaagattcga caaatgtcac tgccaaagct 601 aaaagaggaa ggaagagaaa gagtgatgct gaacaagact ctgatacaga aaattcaagc 661 ccaactgcag gcggttccgg tttagatttc ctatcaacag gtacatcaat tatgttactg 721 aagcgcagag gaaggaaatc taaaacagag aagtcaataa tactacaaca acaggcttca 781 aaggaattac caaggtcagg taaagatgga aagagagatg aaagaaaagg tgacaaaaga 841 aaggagtcca cactgcagaa gttgcacggg gagattaaga catcattgaa gattggtaat 901 ttagatgtaa ggaaatgtgt acatgcattg gatgagttaa gctctctaca tgttaccact 961 caacatcttc agagacatag tgaactcata gcaactctga aaaagatctg cagattcaaa 1021 tccagccagg atgtgatgga caaagctatt atgctatata ataagtttaa aagtatgttt 1081 ttaatgggag aaggagaatc agtgctaagt caggtgctca ataaaagtct gactgaacag 1141 aaactatttg aagaagccaa gaggggagtc ctaaaaaaca cagaacaaac taaagagcag 1201 aaagatacca agattttgaa tgaagacttc aactccgaag aggacgctga gacagagaag 1261 gacaaattag gaggaaacat cttatctatg gtgaaaaaca acatgactaa tcctgcagaa 1321 gagtctgtcg gtggtagtgg aggttcagga ggatccgggg ggagcggagg gagccggcca 1381 atggacaaga agtactccat tgggctcgct atcggcacaa acagcgtcgg ctgggccgtc 1441 attacggacg agtacaaggt gccgagcaaa aaattcaaag ttctgggcaa taccgatcgc 1501 cacagcataa agaagaacct cattggcgcc ctcctgttcg actccgggga gacggccgaa 1561 gccacgcggc tcaaaagaac agcacggcgc agatataccc gcagaaagaa tcggatctgc 1621 tacctgcagg agatctttag taatgagatg gctaaggtgg atgactcttt cttccatagg 1681 ctggaggagt cctttttggt ggaggaggat aaaaagcacg agcgccaccc aatctttggc 1741 aatatcgtgg acgaggtggc gtaccatgaa aagtacccaa ccatatatca tctgaggaag 1801 aagcttgtag acagtactga taaggctgac ttgcggttga tctatctcgc gctggcgcat 1861 atgatcaaat ttcggggaca cttcctcatc gagggggacc tgaacccaga caacagcgat 1921 gtcgacaaac tctttatcca actggttcag acttacaatc agcttttcga agagaacccg 1981 atcaacgcat ccggagttga cgccaaagca atcctgagcg ctaggctgtc caaatcccgg 2041 cggctcgaaa acctcatcgc acagctccct ggggagaaga agaacggcct gtttggtaat 2101 cttatcgccc tgtcactcgg gctgaccccc aactttaaat ctaacttcga cctggccgaa 2161 gatgccaagc ttcaactgag caaagacacc tacgatgatg atctcgacaa tctgctggcc 2221 cagatcggcg accagtacgc agaccttttt ttggcggcaa agaacctgtc agacgccatt 2281 ctgctgagtg atattctgcg agtgaacacg gagatcacca aagctccgct gagcgctagt 2341 atgatcaagc gctatgatga gcaccaccaa gacttgactt tgctgaaggc ccttgtcaga 2401 cagcaactgc ctgagaagta caaggaaatt ttcttcgatc agtctaaaaa tggctacgcc 2461 ggatacattg acggcggagc aagccaggag gaattttaca aatttattaa gcccatcttg 2521 gaaaaaatgg acggcaccga ggagctgctg gtaaagctta acagagaaga tctgttgcgc 2581 aaacagcgca ctttcgacaa tggaagcatc ccccaccaga ttcacctggg cgaactgcac 2641 gctatcctca ggcggcaaga ggatttctac ccctttttga aagataacag ggaaaagatt 2701 gagaaaatcc tcacatttcg gataccctac tatgtaggcc ccctcgcccg gggaaattcc 2761 agattcgcgt ggatgactcg caaatcagaa gagaccatca ctccctggaa cttcgaggaa 2821 gtcgtggata agggggcctc tgcccagtcc ttcatcgaaa ggatgactaa ctttgataaa 2881 aatctgccta acgaaaaggt gcttcctaaa cactctctgc tgtacgagta cttcacagtt 2941 tataacgagc tcaccaaggt caaatacgtc acagaaggga tgagaaagcc agcattcctg 3001 tctggagagc agaagaaagc tatcgtggac ctcctcttca agacgaaccg gaaagttacc 3061 gtgaaacagc tcaaagaaga ctatttcaaa aagattgaat gtttcgactc tgttgaaatc 3121 agcggagtgg aggatcgctt caacgcatcc ctgggaacgt atcacgatct cctgaaaatc 3181 attaaagaca aggacttcct ggacaatgag gagaacgagg acattcttga ggacattgtc 3241 ctcaccctta cgttgtttga agatagggag atgattgaag aacgcttgaa aacttacgct 3301 catctcttcg acgacaaagt catgaaacag ctcaagaggc gccgatatac aggatggggg 3361 cggctgtcaa gaaaactgat caatgggatc cgagacaagc agagtggaaa gacaatcctg 3421 gattttctta agtccgatgg atttgccaac aggaacttca tgcagttgat ccatgatgac 3481 tctctcacct ttaaggagga catccagaaa gcacaagttt ctggccaggg ggacagtctt 3541 cacgagcaca tcgctaatct tgcaggtagc ccagctatca aaaagggaat actgcagacc 3601 gttaaggtcg tggatgaact cgtcaaagta atgggaaggc ataagcccga gaatatcgtt 3661 atcgagatgg cccgagagaa ccaaactacc cagaagggac agaagaacag tagggaaagg 3721 atgaagagga ttgaagaggg tataaaagaa ctggggtccc aaatccttaa ggaacaccca 3781 gttgaaaaca cccagcttca gaatgagaag ctctacctgt actacctgca gaacggcagg 3841 gacatgtacg tggatcagga actggacatc aatcggctct ccgactacga cgtggatgct 3901 atcgtgcccc agtcttttct caaagatgat tctattgata ataaagtgtt gacaagatcc 3961 gataaaaata gagggaagag tgataacgtc ccctcagaag aagttgtcaa gaaaatgaaa 4021 aattattggc ggcagctgct gaacgccaaa ctgatcacac aacggaagtt cgataatctg 4081 actaaggctg aacgaggtgg cctgtctgag ttggataaag ccggcttcat caaaaggcag 4141 cttgttgaga cacgccagat caccaagcac gtggcccaaa ttctcgattc acgcatgaac 4201 accaagtacg atgaaaatga caaactgatt cgagaggtga aagttattac tctgaagtct 4261 aagctggtct cagatttcag aaaggacttt cagttttata aggtgagaga gatcaacaat 4321 taccaccatg cgcatgatgc ctacctgaat gcagtggtag gcactgcact tatcaaaaaa 4381 tatcccaagc ttgaatctga atttgtttac ggagactata aagtgtacga tgttaggaaa 4441 atgatcgcaa agtctgagca ggaaataggc aaggccaccg ctaagtactt cttttacagc 4501 aatattatga attttttcaa gaccgagatt acactggcca atggagagat tcggaagcga 4561 ccacttatcg aaacaaacgg agaaacagga gaaatcgtgt gggacaaggg tagggatttc 4621 gcgacagtcc ggaaggtcct gtccatgccg caggtgaaca tcgttaaaaa gaccgaagta 4681 cagaccggag gcttctccaa ggaaagtatc ctcccgaaaa ggaacagcga caagctgatc 4741 gcacgcaaaa aagattggga ccccaagaaa tacggcggat tcgattctcc tacagtcgct 4801 tacagtgtac tggttgtggc caaagtggag aaagggaagt ctaaaaaact caaaagcgtc 4861 aaggaactgc tgggcatcac aatcatggag cgatcaagct tcgaaaaaaa ccccatcgac 4921 tttctcgagg cgaaaggata taaagaggtc aaaaaagacc tcatcattaa gcttcccaag 4981 tactctctct ttgagcttga aaacggccgg aaacgaatgc tcgctagtgc gggcgagctg 5041 cagaaaggta acgagctggc actgccctct aaatacgtta atttcttgta tctggccagc 5101 cactatgaaa agctcaaagg gtctcccgaa gataatgagc agaagcagct gttcgtggaa 5161 caacacaaac actaccttga tgagatcatc gagcaaataa gcgaattctc caaaagagtg 5221 atcctcgccg acgctaacct cgataaggtg ctttctgctt acaataagca cagggataag 5281 cccatcaggg agcaggcaga aaacattatc cacttgttta ctctgaccaa cttgggcgcg 5341 cctgcagcct tcaagtactt cgacaccacc atagacagaa agcggtacac ctctacaaag 5401 gaggtcctgg acgccacact gattcatcag tcaattacgg ggctctatga aacaagaatc 5461 gacctctctc agctcggtgg agacggtggt agtggaggtt caggaggatc cggggggagc 5521 ggagggagcg ctagcATGcc caagaagaag aggaaggtgg gtggttccTA GcTCGAGCCT 5581 CTAGAACTAT AGTGAGTCGT ATTACGTAGA TCCAGACATG ATAAGATACA TTGATGAGTT 5641 TGGACAAACC ACAACTAGAA TGCAGTGAAA AAAATGCTTT ATTTGTGAAA TTTGTGATGC 5701 TATTGCTTTA TTTGTAACCA TTATAAGCTG CAATAAACAA GTTAACAACA ACAATTGCAT 5761 TCATTTTATG TTTCAGGTTC AGGGGGAGGT GTGGGAGGTT TTTTAATTCG CGGCCGCGGC 5821 GCCAATGCAT TGGGCCCGGT ACCCAGCTTT TGTTCCCTTT AGTGAGGGTT AATTGCGCGC 5881 TTGGCGTAAT CATGGTCATA GCTGTTTCCT GTGTGAAATT GTTATCCGCT CACAATTCCA 5941 CACAACATAC GAGCCGGAAG CATAAAGTGT AAAGCCTGGG GTGCCTAATG AGTGAGCTAA 6001 CTCACATTAA TTGCGTTGCG CTCACTGCCC GCTTTCCAGT CGGGAAACCT GTCGTGCCAG 6061 CTGCATTAAT GAATCGGCCA ACGCGCGGGG AGAGGCGGTT TGCGTATTGG GCGCTCTTCC 6121 GCTTCCTCGC TCACTGACTC GCTGCGCTCG GTCGTTCGGC TGCGGCGAGC GGTATCAGCT 6181 CACTCAAAGG CGGTAATACG GTTATCCACA GAATCAGGGG ATAACGCAGG AAAGAACATG 6241 TGAGCAAAAG GCCAGCAAAA GGCCAGGAAC CGTAAAAAGG CCGCGTTGCT GGCGTTTTTC 6301 CATAGGCTCC GCCCCCCTGA CGAGCATCAC AAAAATCGAC GCTCAAGTCA GAGGTGGCGA 6361 AACCCGACAG GACTATAAAG ATACCAGGCG TTTCCCCCTG GAAGCTCCCT CGTGCGCTCT 6421 CCTGTTCCGA CCCTGCCGCT TACCGGATAC CTGTCCGCCT TTCTCCCTTC GGGAAGCGTG 6481 GCGCTTTCTC ATAGCTCACG CTGTAGGTAT CTCAGTTCGG TGTAGGTCGT TCGCTCCAAG 6541 CTGGGCTGTG TGCACGAACC CCCCGTTCAG CCCGACCGCT GCGCCTTATC CGGTAACTAT 6601 CGTCTTGAGT CCAACCCGGT AAGACACGAC TTATCGCCAC TGGCAGCAGC CACTGGTAAC 6661 AGGATTAGCA GAGCGAGGTA TGTAGGCGGT GCTACAGAGT TCTTGAAGTG GTGGCCTAAC 6721 TACGGCTACA CTAGAAGGAC AGTATTTGGT ATCTGCGCTC TGCTGAAGCC AGTTACCTTC 6781 GGAAAAAGAG TTGGTAGCTC TTGATCCGGC AAACAAACCA CCGCTGGTAG CGGTGGTTTT 6841 TTTGTTTGCA AGCAGCAGAT TACGCGCAGA AAAAAAGGAT CTCAAGAAGA TCCTTTGATC 6901 TTTTCTACGG GGTCTGACGC TCAGTGGAAC GAAAACTCAC GTTAAGGGAT TTTGGTCATG 6961 AGATTATCAA AAAGGATCTT CACCTAGATC CTTTTAAATT AAAAATGAAG TTTTAAATCA 7021 ATCTAAAGTA TATATGAGTA AACTTGGTCT GACAGTTACC AATGCTTAAT CAGTGAGGCA 7081 CCTATCTCAG CGATCTGTCT ATTTCGTTCA TCCATAGTTG CCTGACTCCC CGTCGTGTAG 7141 ATAACTACGA TACGGGAGGG CTTACCATCT GGCCCCAGTG CTGCAATGAT ACCGCGAGAC 7201 CCACGCTCAC CGGCTCCAGA TTTATCAGCA ATAAACCAGC CAGCCGGAAG GGCCGAGCGC 7261 AGAAGTGGTC CTGCAACTTT ATCCGCCTCC ATCCAGTCTA TTAATTGTTG CCGGGAAGCT 7321 AGAGTAAGTA GTTCGCCAGT TAATAGTTTG CGCAACGTTG TTGCCATTGC TACAGGCATC 7381 GTGGTGTCAC GCTCGTCGTT TGGTATGGCT TCATTCAGCT CCGGTTCCCA ACGATCAAGG 7441 CGAGTTACAT GATCCCCCAT GTTGTGCAAA AAAGCGGTTA GCTCCTTCGG TCCTCCGATC 7501 GTTGTCAGAA GTAAGTTGGC CGCAGTGTTA TCACTCATGG TTATGGCAGC ACTGCATAAT 7561 TCTCTTACTG TCATGCCATC CGTAAGATGC TTTTCTGTGA CTGGTGAGTA CTCAACCAAG 7621 TCATTCTGAG AATAGTGTAT GCGGCGACCG AGTTGCTCTT GCCCGGCGTC AATACGGGAT 7681 AATACCGCGC CACATAGCAG AACTTTAAAA GTGCTCATCA TTGGAAAACG TTCTTCGGGG 7741 CGAAAACTCT CAAGGATCTT ACCGCTGTTG AGATCCAGTT CGATGTAACC CACTCGTGCA 7801 CCCAACTGAT CTTCAGCATC TTTTACTTTC ACCAGCGTTT CTGGGTGAGC AAAAACAGGA 7861 AGGCAAAATG CCGCAAAAAA GGGAATAAGG GCGACACGGA AATGTTGAAT ACTCATACTC 7921 TTCCTTTTTC AATATTATTG AAGCATTTAT CAGGGTTATT GTCTCATGAG CGGATACATA 7981 TTTGAATGTA TTTAGAAAAA TAAACAAATA GGGGTTCCGC GCACATTTCC CCGAAAAGTG 8041 CCACCTAAAT TGTAAGCGTT AATATTTTGT TAAAATTCGC GTTAAATTTT TGTTAAATCA 8101 GCTCATTTTT TAACCAATAG GCCGAAATCG GCAAAATCCC TTATAAATCA AAAGAATAGA 8161 CCGAGATAGG GTTGAGTGTT GTTCCAGTTT GGAACAAGAG TCCACTATTA AAGAACGTGG 8221 ACTCCAACGT CAAAGGGCGA AAAACCGTCT ATCAGGGCGA TGGCCCACTA CGTGAACCAT 8281 CACCCTAATC AAGTTTTTTG GGGTCGAGGT GCCGTAAAGC ACTAAATCGG AACCCTAAAG 8341 GGAGCCCCCG ATTTAGAGCT TGACGGGGAA AGCCGGCGAA CGTGGCGAGA AAGGAAGGGA 8401 AGAAAGCGAA AGGAGCGGGC GCTAGGGCGC TGGCAAGTGT AGCGGTCACG CTGCGCGTAA 8461 CCACCACACC CGCCGCGCTT AATGCGCCGC TACAGGGCGC GTCCCATTCG CCATTCAGGC 8521 TGCGCAACTG TTGGGAAGGG CGATCGGTGC GGGCCTCTTC GCTATTACGC CAGTCGACCA 8581 TAGCCAATTC AATATGGCGT ATATGGACTC ATGCCAATTC AATATGGTGG ATCTGGACCT 8641 GTGCCAATTC AATATGGCGT ATATGGACTC GTGCCAATTC AATATGGTGG ATCTGGACCC 8701 CAGCCAATTC AATATGGCGG ACTTGGCACC ATGCCAATTC AATATGGCGG ACTTGGCACT 8761 GTGCCAACTG GGGAGGGGTC TACTTGGCAC GGTGCCAAGT TTGAGGAGGG GTCTTGGCCC 8821 TGTGCCAAGT CCGCCATATT GAATTGGCAT GGTGCCAATA ATGGCGGCCA TATTGGCTAT 8881 ATGCCAGGAT CAATATATAG GCAATATCCA ATATGGCCCT ATGCCAATAT GGCTATTGGC 8941 CAGGTTCAAT ACTATGTATT GGCCCTATGC CATATAGTAT TCCATATATG GGTTTTCCTA 9001 TTGACGTAGA TAGCCCCTCC CAATGGGCGG TCCCATATAC CATATATGGG GCTTCCTAAT 9061 ACCGCCCATA GCCACTCCCC CATTGACGTC AATGGTCTCT ATATATGGTC TTTCCTATTG 9121 ACGTCATATG GGCGGTCCTA TTGACGTATA TGGCGCCTCC CCCATTGACG TCAATTACGG 9181 TAAATGGCCC GCCTGGCTCA ATGCCCATTG ACGTCAATAG GACCACCCAC CATTGACGTC 9241 AATGGGATGG CTCATTGCCC ATTCATATCC GTTCTCACGC CCCCTATTGA CGTCAATGAC 9301 GGTAAATGGC CCACTTGGCA GTACATCAAT ATCTATTAAT AGTAACTTGG CAAGTACATT 9361 ACTATTGGAA GGACGCCAGG GTACATTGGC AGTACTCCCA TTGACGTCAA TGGCGGTAAA 9421 TGGCCCGCGA TGGCTGCCAA GTACATCCCC ATTGACGTCA ATGGGGAGGG GCAATGACGC 9481 AAATGGGCGT TCCATTGACG TAAATGGGCG GTAGGCGTGC CTAATGGGAG GTCTATATAA 9541 GCAATGCTCG TTTAGGGAAC

[0227] Vector backbone sequences are represented by uppercase letters. Underlined segments of the sequence are as follows:

[0228] 35-51: SP6 promoter

[0229] 64-78: β-globin translational leader sequence

[0230] 91-1329: zebrafish psip1a

[0231] 1330-1374: (GGS).sub.5 linker (SEQ ID NO:17) (not underlined)

[0232] 1381-5484: dCas 9

[0233] 5539-5559: nuclear localization sequence from SV40 large T-antigen

[0234] 5609-5804: SV40 polyadenylation signal

[0235] 7056-7916: AmpR gene. A map of this vector is shown in FIG. 24.

[0236] Additional vectors are constructed with different linker sequences between the Cas9-encoding and psip1a-encoding sequences. In these constructs, the (GGS).sub.5 linker (SEQ ID NO:17) is replaced by the more rigid (EAAAK).sub.n linker (in which n=1-4) (SEQ ID NO:18) and the flexible (GGGGS).sub.n linker (in which n=1-4) (SEQ ID NO:19).

Example 9: pLTRB-CMV-tdTomato Transgene Vector

[0237] This plasmid was constructed by gateway cloning using p5E-CMV, pME-tdTomato, and the two-way Gateway cloning vector pLTRB-R4R2. The nucleotide sequence of this vector is:

TABLE-US-00014 (SEQ ID NO: 10) 1 TATAGTGAGT CGTATTACAA TTCACTGGCC GTCGTTTTAC AACGTCGTGA CTGGGAAAAC 61 CCTGGCGTTA CCCAACTTAA TCGCCTTGCA GCACATCCCC CTTTCGCCAG CTGGCGTAAT 121 AGCGAAGAGG CCCGCACCGA TCGCCCTTCC CAACAGTTGC GCAGCCTGAA TGGCGAATGG 181 ACGCGCCCTG TAGCGGCGCA TTAAGCGCGG CGGGTGTGGT GGTTACGCGC AGCGTGACCG 241 CTACACTTGC CAGCGCCCTA GCGCCCGCTC CTTTCGCTTT CTTCCCTTCC TTTCTCGCCA 301 CGTTCGCCGG CTTTCCCCGT CAAGCTCTAA ATCGGGGGCT CCCTTTAGGG TTCCGATTTA 361 GTGCTTTACG GCACCTCGAC CCCAAAAAAC TTGATTAGGG TGATGGTTCA CGTAGTGGGC 421 CATCGCCCTG ATAGACGGTT TTTCGCCCTT TGACGTTGGA GTCCACGTTC TTTAATAGTG 481 GACTCTTGTT CCAAACTGGA ACAACACTCA ACCCTATCTC GGTCTATTCT TTTGATTTAT 541 AAGGGATTTT GCCGATTTCG GCCTATTGGT TAAAAAATGA GCTGATTTAA CAAAAATTTA 601 ACGCGAATTT TAACAAAATA TTAACGCTTA CAATTTCCTG ATGCGGTATT TTCTCCTTAC 661 GCATCTGTGC GGTATTTCAC ACCGCATCAG GTGGCACTTT TCGGGGAAAT GTGCGCGGAA 721 CCCCTATTTG TTTATTTTTC TAAATACATT CAAATATGTA TCCGCTCATG AGACAATAAC 781 CCTGATAAAT GCTTCAATAA TATTGAAAAA GGAAGAGTAT GAGTATTCAA CATTTCCGTG 841 TCGCCCTTAT TCCCTTTTTT GCGGCATTTT GCCTTCCTGT TTTTGCTCAC CCAGAAACGC 901 TGGTGAAAGT AAAAGATGCT GAAGATCAGT TGGGTGCACG AGTGGGTTAC ATCGAACTGG 961 ATCTCAACAG CGGTAAGATC CTTGAGAGTT TTCGCCCCGA AGAACGTTTT CCAATGATGA 1021 GCACTTTTAA AGTTCTGCTA TGTGGCGCGG TATTATCCCG TATTGACGCC GGGCAAGAGC 1081 AACTCGGTCG CCGCATACAC TATTCTCAGA ATGACTTGGT TGAGTACTCA CCAGTCACAG 1141 AAAAGCATCT TACGGATGGC ATGACAGTAA GAGAATTATG CAGTGCTGCC ATAACCATGA 1201 GTGATAACAC TGCGGCCAAC TTACTTCTGA CAACGATCGG AGGACCGAAG GAGCTAACCG 1261 CTTTTTTGCA CAACATGGGG GATCATGTAA CTCGCCTTGA TCGTTGGGAA CCGGAGCTGA 1321 ATGAAGCCAT ACCAAACGAC GAGCGTGACA CCACGATGCC TGTAGCAATG GCAACAACGT 1381 TGCGCAAACT ATTAACTGGC GAACTACTTA CTCTAGCTTC CCGGCAACAA TTAATAGACT 1441 GGATGGAGGC GGATAAAGTT GCAGGACCAC TTCTGCGCTC GGCCCTTCCG GCTGGCTGGT 1501 TTATTGCTGA TAAATCTGGA GCCGGTGAGC GTGGGTCTCG CGGTATCATT GCAGCACTGG 1561 GGCCAGATGG TAAGCCCTCC CGTATCGTAG TTATCTACAC GACGGGGAGT CAGGCAACTA 1621 TGGATGAACG AAATAGACAG ATCGCTGAGA TAGGTGCCTC ACTGATTAAG CATTGGTAAC 1681 TGTCAGACCA AGTTTACTCA TATATACTTT AGATTGATTT AAAACTTCAT TTTTAATTTA 1741 AAAGGATCTA GGTGAAGATC CTTTTTGATA ATCTCATGAC CAAAATCCCT TAACGTGAGT 1801 TTTCGTTCCA CTGAGCGTCA GACCCCGTAG AAAAGATCAA AGGATCTTCT TGAGATCCTT 1861 TTTTTCTGCG CGTAATCTGC TGCTTGCAAA CAAAAAAACC ACCGCTACCA GCGGTGGTTT 1921 GTTTGCCGGA TCAAGAGCTA CCAACTCTTT TTCCGAAGGT AACTGGCTTC AGCAGAGCGC 1981 AGATACCAAA TACTGTTCTT CTAGTGTAGC CGTAGTTAGG CCACCACTTC AAGAACTCTG 2041 TAGCACCGCC TACATACCTC GCTCTGCTAA TCCTGTTACC AGTGGCTGCT GCCAGTGGCG 2101 ATAAGTCGTG TCTTACCGGG TTGGACTCAA GACGATAGTT ACCGGATAAG GCGCAGCGGT 2161 CGGGCTGAAC GGGGGGTTCG TGCACACAGC CCAGCTTGGA GCGAACGACC TACACCGAAC 2221 TGAGATACCT ACAGCGTGAG CTATGAGAAA GCGCCACGCT TCCCGAAGGG AGAAAGGCGG 2281 ACAGGTATCC GGTAAGCGGC AGGGTCGGAA CAGGAGAGCG CACGAGGGAG CTTCCAGGGG 2341 GAAACGCCTG GTATCTTTAT AGTCCTGTCG GGTTTCGCCA CCTCTGACTT GAGCGTCGAT 2401 TTTTGTGATG CTCGTCAGGG GGGCGGAGCC TATGGAAAAA CGCCAGCAAC GCGGCCTTTT 2461 TACGGTTCCT GGCCTTTTGC TGGCCTTTTG CTCACATGTT CTTTCCTGCG TTATCCCCTG 2521 ATTCTGTGGA TAACCGTATT ACCGCCTTTG AGTGAGCTGA TACCGCTCGC CGCAGCCGAA 2581 CGACCGAGCG CAGCGAGTCA GTGAGCGAGG AAGCGGAAGA GCGCCCAATA CGCAAACCGC 2641 CTCTCCCCGC GCGTTGGCCG ATTCATTAAT GCAGCTGGCA CGACAGGTTT CCCGACTGGA 2701 AAGCGGGCAG TGAGCGCAAC GCAATTAATG TGAGTTAGCT CACTCATTAG GCACCCCAGG 2761 CTTTACACTT TATGCTTCCG GCTCGTATGT TGTGTGGAAT TGTGAGCGGA TAACAATTTC 2821 ACACAGGAAA CAGCTATGAC CATGATTACG CCAAGCTATT TAGGTGACAC TATAGAATAC 2881 TCAAGCTATG CATCCAACGC GTTGGGAGCT CTCCCATATG TATACTGGGT CTCTCTGGTT 2941 AGACCAGATC TGAGCCTGGG AGCTCTCTGG CTAACTAGGG AACCCACTGC TTAAGCCTCA 3001 ATAAAGCTTG CCTTGAGTGC TTCAAGTAGT GTGTGCCCGT CTGTTGTGTG ACTCTGGTAA 3061 CTAGAGATCC CTCAGACCCT TTTAGTCAGT GTGGAAAATC TCTAGCATAG GGATAACAGG 3121 GTAATCTCGA GTTGACGTCA GGAAACAGCT ATGACCATGA TTACGCCAAG CTATCAACTT 3181 TGTATAGAAA AGTTGAAGGC CTCTTCGCTA TTACGCCAGT CGACCGCCAA TTCAATATGG 3241 CGTATATGGA CTCATGCCAA TTCAATATGG TGGATCTGGA CCTGTGCCAA TTCAATATGG 3301 CGTATATGGA CTCGTGCCAA TTCAATATGG TGGATCTGGA CCCCAGCCAA TTCAATATGG 3361 CGGACTTGGC ACCATGCCAA TTCAATATGG CGGACCTGGC ACTGTGCCAA CTGGGGAGGG 3421 GTCTACTTGG CACGGTGCCA AGTTTGAGGA GGGGTCTTGG CCCTGTGCCA AGTCCGCCAT 3481 ATTGAATTGG CATGGTGCCA ATAATGGCGG CCATATTGGC TATATGCCAG GATCAATATA 3541 TAGGCAATAT CCAATATGGC CCTATGCCAA TATGGCTATT GGCCAGGTTC AATACTATGT 3601 ATTGGCCCTA TGCCATATAG TATTCCATAT ATGGGTTTTC CTATTGACGT AGATAGCCCC 3661 TCCCAATGGG CGGTCCCATA TACCATATAT GGGGCTTCCT AATACCGCCC ATAGCCACTC 3721 CCCCATTGAC GTCAATGGTC TCTATATATG GTCTTTCCTA TTGACGTCAT ATGGGCGGTC 3781 CTATTGACGT ATATGGCGCC TCCCCCATTG ACGTCAATTA CGGTAAATGG CCCGCCTGGC 3841 TCAATGCCCA TTGACGTCAA TAGGACCACC CACCATTGAC GTCAATGGGA TGGCTCATTG 3901 CCCATTCATA TCCGTTCTCA CGCCCCCTAT TGACGTCAAT GACGGTAAAT GGCCCACTTG 3961 GCAGTACATC AATATCTATT AATAGTAACT TGGCAAGTAC ATTACTATTG GAAGTACGCC 4021 AGGGTACATT GGCAGTACTC CCATTGACGT CAATGGCGGT AAATGGCCCG CGATGGCTGC 4081 CAAGTACATC CCCATTGACG TCAATGGGGA GGGGCAATGA CGCAAATGGG CGTTCCATTG 4141 ACGTAAATGG GCGGTAGGCG TGCCTAATGG GAGGTCTATA TAAGCAATGC TCGTTTAGGG 4201 AACCGCCATT CTGCCTGGGG ACGTCGGAGC AAGCTTGATT TAGGTGACAC TATAGAAAGT 4261 TTGTACAAAA AAGCAGGCTT GGTGAGCAAG GGCGAGGAGG TCATCAAAGA GTTCATGCGC 4321 TTCAAGGTGC GCATGGAGGG CTCCATGAAC GGCCACGAGT TCGAGATCGA GGGCGAGGGC 4381 GAGGGCCGCC CCTACGAGGG CACCCAGACC GCCAAGCTGA AGGTGACCAA GGGCGGCCCC 4441 CTGCCCTTCG CCTGGGACAT CCTGTCCCCC CAGTTCATGT ACGGCTCCAA GGCGTACGTG 4501 AAGCACCCCG CCGACATCCC CGATTACAAG AAGCTGTCCT TCCCCGAGGG CTTCAAGTGG 4561 GAGCGCGTGA TGAACTTCGA GGACGGCGGT CTGGTGACCG TGACCCAGGA CTCCTCCCTG 4621 CAGGACGGCA CGCTGATCTA CAAGGTGAAG ATGCGCGGCA CCAACTTCCC CCCCGACGGC 4681 CCCGTAATGC AGAAGAAGAC CATGGGCTGG GAGGCCTCCA CCGAGCGCCT GTACCCCCGC 4741 GACGGCGTGC TGAAGGGCGA GATCCACCAG GCCCTGAAGC TGAAGGACGG CGGCCACTAC 4801 CTGGTGGAGT TCAAGACCAT CTACATGGCC AAGAAGCCCG TGCAACTGCC CGGCTACTAC 4861 TACGTGGACA CCAAGCTGGA CATCACCTCC CACAACGAGG ACTACACCAT CGTGGAACAG 4921 TACGAGCGCT CCGAGGGCCG CCACCACCTG TTCCTGGGGC ATGGCACCGG CAGCACCGGC 4981 AGCGGCAGCT CCGGCACCGC CTCCTCCGAG GACAACAACA TGGCCGTCAT CAAAGAGTTC 5041 ATGCGCTTCA AGGTGCGCAT GGAGGGCTCC ATGAACGGCC ACGAGTTCGA GATCGAGGGC 5101 GAGGGCGAGG GCCGCCCCTA CGAGGGCACC CAGACCGCCA AGCTGAAGGT GACCAAGGGC 5161 GGCCCCCTGC CCTTCGCCTG GGACATCCTG TCCCCCCAGT TCATGTACGG CTCCAAGGCG 5221 TACGTGAAGC ACCCCGCCGA CATCCCCGAT TACAAGAAGC TGTCCTTCCC CGAGGGCTTC 5281 AAGTGGGAGC GCGTGATGAA CTTCGAGGAC GGCGGTCTGG TGACCGTGAC CCAGGACTCC 5341 TCCCTGCAGG ACGGCACGCT GATCTACAAG GTGAAGATGC GCGGCACCAA CTTCCCCCCC 5401 GACGGCCCCG TAATGCAGAA GAAGACCATG GGCTGGGAGG CCTCCACCGA GCGCCTGTAC 5461 CCCCGCGACG GCGTGCTGAA GGGCGAGATC CACCAGGCCC TGAAGCTGAA GGACGGCGGC 5521 CACTACCTGG TGGAGTTCAA GACCATCTAC ATGGCCAAGA AGCCCGTGCA ACTGCCCGGC 5581 TACTACTACG TGGACACCAA GCTGGACATC ACCTCCCACA ACGAGGACTA CACCATCGTG 5641 GAACAGTACG AGCGCTCCGA GGGCCGCCAC CACCTGTTCC TGTACGGCAT GGACGAGCTG 5701 TACAAGTAAC ACCCAGCTTT CTTGTACAAA GTGGTGTACC ATCGATGATG ATCCAGACAT 5761 GATAAGATAC ATTGATGAGT TTGGACAAAC CACAACTAGA ATGCAGTGAA AAAAATGCTT 5821 TATTTGTGAA ATTTGTGATG CTATTGCTTT ATTTGTAACC ATTATAAGCT GCAATAAACA 5881 AGTTAACAAC AACAATTGCA TTCATTTTAT GTTTCAGGTT CAGGGGGAGG TGTGGGAGGT 5941 TTTTTAAAGC AAGTAAAACC TCTACAAATG TGGTATGGCT GATTATGATC CTCTAGATCG 6001 TGCATGCTTC CGCGGATTAC CCTGTTATCC CTATGGAAGG GCTAATTCAC TCCCAACGAA 6061 GACAAGATCT GCTTTTTGCT TGTACTGGGT CTCTCTGGTT AGACCAGATC TGAGCCTGGG 6121 AGCTCTCTGG CTAACTAGGG AACCCACTGC TTAAGCCTCA ATAAAGCTTG CCTTGAGTGC 6181 TTCAAGTAGT GTGTGCCCGT CTGTTGTGTG ACTCTGGTAA CTAGAGATCC CTCAGACCCT 6241 TTTAGTCAGT GTGGAAAATC TCTAGCAGTA TACGGGCCCA ATTCGCCC

[0238] Underlined segments of the sequence are as follows: [0239] 714-1679: β-lactamase promoter and coding sequence 2928-3107: truncated HIV-1 LTR containing R and U5 sequences (SEQ ID NO:4) 3175-3195: attR4 sequences 3226-4203: CMV IE94 promoter 4238-4254: SP6 promoter 4257-4279: attB1 sequences 4280-5706: td-Tomato 5710-5734: attB2 sequences 5750-5884: SV40 polyadenylation signal 6034-6267: truncated HIV-1 LTR containing dU3, R and U5 sequences (SEQ ID NO:5).

[0240] A map of this vector is shown in FIG. 25.

Example 10: Targeted Integration in Zebrafish Embryos

[0241] This example describes targeted integration of a td-Tomato transgene in zebrafish. Transgenic zebrafish embryos (pTol2-CMV:EGFP-pA) that contained an integrated EGFP gene were constructed by Tol2-mediated transgenesis as described in Example 4. One-cell embryos obtained from adult zebrafish containing an exogenous EGFP gene that had been introduced by Tol2-mediated transgenesis of embryos (as described in Example 4) were used as target organisms. For each experiment, approximately 200 embryos were injected with a mixture of: [0242] (a) 6.25 pg/embryo of a transgene cassette containing a td-Tomato coding region (as described in Example 9), [0243] (b) 6.25 pg/embryo of integrase-encoding RNA (prepared as described in Example 3), [0244] (c) 6.25 pg/embryo of RNA encoding the psip1a-Cas9 fusion protein (as described in Example 8), prepared by in vitro transcription with SP6 RNA polymerase, and [0245] (d) 6.25 pg/embryo of guide RNA complementary to a portion of the EGFP coding region having the sequence:

TABLE-US-00015 (SEQ ID NO: 11) 5′-GTAGGTCAGGGTGGTCACGAGGG-3′
in which the GGG sequence at the 3′ end is the protospacer adjacent motif (PAM) sequence.

[0246] Because the target embryos are transgenic for EGFP, they exhibit green fluorescence. However, if the td-Tomato-encoding transgene cassette is integrated at the target sequence, the EGFP gene will be disrupted and the cell will exhibit red fluorescence, due to the integrated td-Tomato transgene.

[0247] Injected embryos were cultured in egg water (60 μg/ml Instant Ocean® sea salt) at 28.5° C. Five hours after injection, embryos were analyzed by confocal fluorescence microscopy. The results, shown in FIG. 26, indicate that several cells emitted red fluorescence, indicative of targeted integration of the td-Tomato transgene into the target site in the EGFP gene in those cells.

Example 11: Test System

[0248] Transgenic zebrafish (made, e.g., by I-SceI-mediated methods, Tol2-mediated methods, or the methods disclosed herein) containing an integrated EGFP gene (or any other gene providing a fluorescent readout) are selected in which a single exogenous EGFP gene is integrated at a locus that does not contain a coding region or regulatory element. This is achieved, for example, by outcrossing transgenic fish until a strain is obtained that contains a single EGFP insertion in a non-coding, non-regulatory region (confirmed, e.g., by determining the DNA sequence of the insertion site). Such a strain is used as a test system, e.g., for optimizing the methods and compositions disclosed herein. For example, targeted integration, into the EGFP sequences of such strains, of transgene cassettes containing sequences encoding a non-green fluorescent molecule, such as td-Tomato, results in loss of green fluorescence and acquisition of red fluorescence.

Example 12: Integrase Proteins with Additional Nuclear Localization Signals

[0249] This example provides results of an experiment to determine the effect of additional NLS sequences, in the integrase protein, on the efficiency of integration. The pFLi1ep:EGF P-pA transgene cassette (see Example 5) was co-injected into one-cell embryos with mRNA encoding one of three different integrase proteins: wild-type HIV-1 integrase, HIV-1 integrase with a c-myc NLS attached to the N-terminus, and HIV-1 integrase with a c-myc NLS attached to the C-terminus.

[0250] Six days post-fertilization, embryos were analyzed by confocal fluorescence microscopy and sorted into Groups (0 through 4) as described in Examples 3 and 5. The results, shown in FIG. 27, indicate that the presence of the c-myc NLS at the N-terminus of the integrase protein increases the efficiency of integration.