COMPOSITIONS AND METHODS FOR IDENTIFYING REGULATORS OF CELL TYPE FATE SPECIFICATION
20220307015 · 2022-09-29
Inventors
- Charles A. Gersbach (Chapel Hill, NC, US)
- Joshua B. Black (Durham, NC)
- Jennifer Kwon (Durham, NC, US)
- Shaunak Adkar (Durham, NC, US)
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N2506/45
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N2740/16043
CHEMISTRY; METALLURGY
C12N2800/80
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
C07K14/4705
CHEMISTRY; METALLURGY
C40B40/02
CHEMISTRY; METALLURGY
C12N15/1086
CHEMISTRY; METALLURGY
International classification
C12N15/10
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
Abstract
Disclosed herein are compositions, methods, and systems for selecting a polynucleotide for activity as a neuronal-specific transcription factor. The system may include a polynucleotide encoding a reporter protein and a pan-neuronal marker, a Gas protein, and a library of guide RNAs (gRNAs) targeting putative transcription factors. Further provided are methods of screening for a neuronal-specific transcription factor.
Claims
1. A polynucleotide encoding: (1) a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; or (2) a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and a second neuronal-specific transcription factor selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1, FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3; (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLF5, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, IRF5, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCL1, GATA6, SPIB, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX, LHXB, GFI1, KLF17, OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, E2F7; (iv) ZIC2, SP11, GRHL2, TFAP2C, KLF8, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3; (v) HES2, SREBF1, GIC, WHSC1, VDR, HES1, ID2, TCF21, SNAI1, RREB1, GCM2, IRF3, FOXA1, GATA5, GRHL1, SOX5, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HES7, ZBED4, SALL4, GLIS3. TBX22, ZNF331, EGR4, ZIC5, ZNF710. ZNF697, ZFP36L2, ELMSAN1, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HES5, ZIM2, ZNF579, BMP2, CRAMP1L, TOX3, FEZF2, HES3, ZNF791; (vi) ETV1, ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1, IRF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1, ZNF160, ETV5, MYBLI, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HESS, BMP2, CRAMP1L ZNF821, KMT2A, HES3, and BSX.
2. A system for increasing expression of a neuronal-specific gene, the system comprising: (a) a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; or (b) a first gRNA targeting a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and a second gRNA targeting a second neuronal-specific transcription factor selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HICI SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLII, FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFFI HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3; (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLFS, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, IRF5, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCL1, GATA6, SPIE, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX, LHX8, GFI1, KLF17, OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, E2F7; (iv) ZIC2, SPI1, GRHL2, TFAP2C, KLF8, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3; (v) HES2, SREBF1, CIC, WHSC1, VDR, HES1, ID2, TCF21, SNAI1, RREB1, GCM2, IRF3, FOXA1, GATA5, GRHL1, SOX5, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HEST, ZBED4, SALL4, GLIS3, TBX22, ZNF331, EGR4, ZIC5, ZNF710, ZNF697, ZFP36L2, ELMSAN1, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HESS, ZIM2, ZNF579, BMP2, CRAMP1L, TOX3, FEZF2, HES3, ZNF791; (vi) ETV1, ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1, IRF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1, ZNF160, ETV5, MYBL1, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HESS, BMP2, CRAMP1L, ZNF821, KMT2A, HES3, and BSX; and a Cas protein or a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has an activity selected from transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, nucleic acid association activity, methylase activity, and demethylase activity.
3. The polynucleotide of claim 1 or the system of claim 2, wherein the second neuronal-specific transcription factor is selected from LHX8, LHX6, E2F7, RUNX3, FOXH1, SOX2, HMX2, NKX2-2, HES3, and ZFP36L1.
4. The polynucleotide or system of claim 3, wherein the second neuronal-specific transcription factor is selected from LHX8, LHX6, E2F7, RUNX3, FOXH1, SOX2, HMX2, and NKX2-2.
5. The polynucleotide or system of claim 3, wherein the second neuronal-specific transcription factor is selected from HES3 and ZFP36L1.
6. The system of claim 2, wherein the second neuronal-specific transcription factor is selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1 , FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3; (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLF5, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, IRF5, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCL1, GATA6, SPIB, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, 0.sup.1101_2, FOXJ1, PRDM14, VENTX, LHX8, GFI1, KLF17, OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, and E2F7, and wherein the second polypeptide domain has transcription activation activity.
7. The system of claim 6, wherein the fusion protein comprises .sup.VP64dCas9.sup.VP64 or dCas9-p300.
8. The system of claim 2, wherein the second neuronal-specific transcription factor is selected from: (i) ZIC2, SPI1, GRHL2, TFAP2C, KLF8, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3; (ii) HES2, SREBF1, CIC, WHSC1, UDR, HES1, ID2, TCF21, SNAI1, RREB1, GCM2, IRF3, FOXA1. GATA5, GRHL1, SOX5, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HES7, ZBED4, SALL4, GLIS3, TBX22, ZNF331, EGR4, ZIC5, ZNF710, ZNF697, ZFP36L2, ELMSAN1, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HES5, ZIM2, ZNF579, BMP2, CRAMP1L, TOX3, FEZF2, HES3, ZNF791; (iii) ETV1, ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1, IRF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1, ZNF160, ETV5, MYBL1, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HES5, BMP2, CRAMPIL, ZNF821, KMT2A, HES3, and BSX, and wherein the second polypeptide domain has transcription repression activity.
9. The system of claim 8, wherein the fusion protein comprises dCas9-KRAB.
10. The system of any one of claims 2-9, wherein the first gRNA and the second gRNA each individually comprise a 12-22 base pair complementary polynucleotide sequence of the target DNA sequence followed by a protospacer-adjacent motif, and optionally wherein the gRNA binds and targets and/or comprises a polynucleotide comprising a sequence selected from SEQ ID NOs: 38-97, and optionally wherein the first and/or second gRNA comprises a crRNA, a tracrRNA, or a combination thereof.
11. An isolated polynucleotide encoding the system of any one of claims 2-10.
12. A vector comprising the isolated polynucleotide of claim 11.
13. A cell comprising the isolated polynucleotide of claim 11 or the vector of claim 12.
14. A method of increasing maturation of a stem cell-derived neuron, the method comprising: (a) increasing in the stern cell the level of a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2, or (b) increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and increasing in the stem cell the level of a second neuronal-specific transcription factor selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1 , FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3; (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLF5, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, IRF5, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCL1, GATA6, SPIB, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX, LHX8, GFI1, KLF17, OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, and E2F7.
15. A method of increasing maturation of a stern cell-derived neuron, the method comprising: increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and decreasing in the stem cell the level of a second neuronal-specific transcription factor selected from: (i) ZIC2, SPI1, GRHL2, TFAP2C, KLF8, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3; (ii) HES2, SREBF1, CIC, WHSC1, VDR, HES1, ID2, TCF21, SNAI1, RREB1, GCM2, IRF3, FOXA1, GATA5, GRHL1, SOX5, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HES7, ZBED4, SALL4, GLIS3, TBX22, ZNF33 EGR4, ZIC5, ZNF710, ZNF697, ZFP36L2, ELMSANI, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HES5, ZIM2, ZNF579, BMP2, CRAMP1L, TOX3, FEZF2, HES3, ZNF791; (iii) ETV1. ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1, IRF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1, ZNF160, ETV5, MYBL1, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HES5, BMP2, CRAMP1L, ZNF821, KMT2A, HES3, and BSX.
16. A method of increasing the conversion of a stem cell to a neuron, the method comprising: (a) increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2, or (b) increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and increasing in the stem cell the level of a second neuronal-specific transcription factor selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SPS, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1, FOXH1, FEV, SOX17, FOS, INSM1, SOX2, VVT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3; (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLF5, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, !RFS, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCLI, GATA6, SPIB, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX, LHXB, GFl1, KLF17, OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, and E2F7.
17. A method of increasing the conversion of a stem cell to a neuron, the method comprising: increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and decreasing in the stem cell the level of a second neuronal-specific transcription factor selected from: (i) ZIC2, SPl1, GRHL2, TFAP2C, KLF8, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3; (ii) HES2, SREBF1, CIC, WHSC1, VDR, HES1, ID2, TCF21, SNAI1, RREB1, GCM2, IRF3, FOXA1, GATA5, GRHL1, SOX5, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HES7, ZBED4, SALL4, GLIS3, TBX22, ZNF331, EGR4, ZIC5, ZNF710, ZNF697, ZFP36L2, ELMSAN1, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HES5, ZIM2, ZNF579, BMP2, CRAMP1L, TOX3, FEZF2, HES3, ZNF791: (iii) ETV1, ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1, lRF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1 ZNF160, ETV5, MYBL1 NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HES5, BMP2, CRAMP1L, ZNF821, KMT2A, HES3, and BSX.
18. A method of treating a subject in need thereof, the method comprising: (a) increasing in a stem cell in the subject the level of a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SPS, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2, or (b) increasing in a stem cell in the subject the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and increasing in a stem cell in the subject the level of a second neuronal-specific transcription factor selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HlC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1, FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3: (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLF5, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, lRF5, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCL1, GATA6, SPIB, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX, LHX8, GFI1, KLF17, OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, and E2F7.
19. A method of treating a subject in need thereof, the method comprising: increasing in a stem cell in the subject the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and decreasing in a stem cell in the subject the level of a second neuronal-specific transcription factor selected from: (i) ZIC2, SPI1, GRHL2, TFAP2C, KLF8, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3; (ii) HES2, SREBF1, CIC, WHSC1, VDR, HES1, ID2, TCF21, SNAI1, RREB1, GCM2, IRF3, FOXA1, GATA5, GRHL1, SOX5, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HES7, ZBED4, SALL4, GLIS3, TBX22, ZNF331, EGR4, ZIC5, ZNF710, ZNF697, ZFP36L2, ELMSAN1, ZNF296. ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HES5, ZIM2, ZNF579, BMP2, CRAMP1L, TOX3, FEZF2, HES3, ZNF791: (iii) ETV1, ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1, IRF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1, ZNF160, ETV5, MYBL1, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HES5, BMP2, CRAMP1L, ZNF821, KMT2A, HES3, and BSX.
20. The method of any one of claims 14-19, wherein increasing the level of the first neuronal-specific transcription factor comprises at least one of: (a) administering to the stem cell a polynucleotide encoding the first neuronal-specific transcription factor; (b) administering to the stem cell a polypeptide comprising the first neuronal-specific transcription factor; and (c) administering to the stern cell a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein targeting the first neuronal-specific transcription factor, or a TALE protein targeting the first neuronal-specific transcription factor, and the second polypeptide domain has transcription activation activity, and wherein a gRNA targeting the first neuronal-specific transcription factor is additionally administered to the stem cell when the first polypeptide domain comprises a Cas protein.
21. The method of any one of claims 14, 16, and 18, wherein increasing the level of the second neuronal-specific transcription factor comprises at least one of: (a) administering to the stem cell a polynucleotide encoding the second neuronal-specific transcription factor; (b) administering to the stem cell a polypeptide comprising the second neuronal-specific transcription factor; and (c) administering to the stem cell a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein targeting the second neuronal-specific transcription factor, or a TALE protein targeting the second neuronal-specific transcription factor, and the second polypeptide domain has transcription activation activity, and wherein a gRNA targeting the second neuronal-specific transcription factor is additionally administered to the stem cell when the first polypeptide domain comprises a Cas protein.
22. The method of any one of claims 15, 17, and 19, wherein decreasing the level of the second neuronal-specific transcription factor comprises administering to the stem cell a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein targeting the second neuronal-specific transcription factor, or a TALE protein targeting the second neuronal-specific transcription factor, and the second polypeptide domain has transcription repression activity, and wherein a gRNA targeting the second neuronal-specific transcription factor is additionally administered to the stem cell when the first polypeptide domain comprises a Cas protein.
23. The method of any one of claims 14-22, wherein the stem cell is directly converted to a neuron without a pluripotent stage.
24. The cell of claim 13 or the method of any one of claims 14-23, wherein the stem cell is a pluripotent stem cell, an induced pluripotent stem cell, or an embryonic stem cell.
25. A system for selecting a polynucleotide for activity as a cell type-specific transcription factor, the system comprising: a polynucleotide encoding a reporter protein and a cell type marker; a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, and the second polypeptide domain has transcription activation activity; and a library of guide RNAs (gRNAs), each gRNA targeting a different putative cell type-specific transcription factor.
26. The system of claim 25, wherein the cell-type specific transcription factor is a neuronal-specific transcription factor, wherein the cell type marker is a neuronal marker, and wherein the neuronal marker comprises TUBB3.
27. The system of claim 25, wherein the cell-type specific transcription factor is a muscle-specific transcription factor, wherein the cell type marker is a myogenic marker, and wherein the myogenic marker comprises PAX7.
28. The system of claim 25, wherein the cell-type specific transcription factor is a chondrocyte-specific transcription factor, wherein the cell type marker is a collagen marker, and wherein the collagen marker comprises COL2A1.
29. The system of any one of claims 25-28, wherein the reporter protein comprises mCherry.
30. An isolated polynucleotide sequence encoding the system of any one of claims 25-29.
31. A vector comprising the isolated polynucleotide sequence of claim 30.
32. A cell comprising the system of any one of claims 25-29, the isolated polynucleotide sequence of claim 30, or the vector of claim 31, or a combination thereof.
33. A method of screening for a cell type-specific transcription factor, the method comprising: transducing a population of cells with the system of any one of claims 25-29 at a multiplicity of infection (MOD of about 0.2, such that a majority of the cells each independently includes one gRNA and targets one putative transcription factor; determining a level of expression of the reporter protein in each cell; determining a level of the gRNA in each cell having a high expression of the reporter protein, wherein high expression of the reporter protein is defined as being in the top 5% among the population of cells; and selecting the putative transcription factor as a cell-type-specific transcription factor when the putative transcription factor corresponds to at least two gRNAs enriched in the cell having a high expression of the reporter protein.
34. A method of screening for a pair of cell-type-specific transcription factors, the method comprising: transducing a population of cells with the system of any one of claims 25-29 at a multiplicity of infection (MOI) of about 0.2, such that a majority of the cells each independently includes two gRNAs and targets two putative transcription factors; determining a level of expression of the reporter protein in each cell; determining a level of the two gRNAs in each cell having a high expression of the reporter protein, wherein high expression of the reporter protein is defined as being in the top 5% among the population of cells; and selecting the two putative transcription factors as a pair of cell type-specific transcription factors when the putative transcription factors correspond to at least two gRNAs enriched in the cell having a high expression of the reporter protein.
35. The method of claim 33 or 34, wherein the level of expression of the reporter protein in each cell is determined after about four days from transduction.
36. The method of any one of claims 33-35, wherein the level of expression of the reporter protein in each cell is determined by flow cytometry.
37. The method of any one of claims 33-36, wherein the level of the gRNA in each cell having a high expression of the reporter protein is determined by deep sequencing.
38. The method of any one of claims 33-37, wherein the gRNA increases the expression of the reporter protein in the cell by about 2-50% relative to a non-targeting gRNA.
39. A polynucleotide encoding a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1.
40. A system for increasing expression of a muscle-specific gene, the system comprising: (a) a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1; or (b) a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein targeting a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1, or a TALE protein targeting a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1, wherein the second polypeptide domain has an activity selected from transcription activation activity, transcription release factor activity, histone modification activity, nucleic acid association activity, methylase activity, and demethylase activity, and wherein the system further includes a gRNA targeting a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1 when the first polypeptide domain comprises a Cas protein.
41. The system of claim 40, wherein the fusion protein comprises .sup.VP64dCas9.sup.VP54 or dCas9-p300.
42. An isolated polynucleotide encoding the system of any one of claims 40-41.
43. A vector comprising the isolated polynucleotide of claim 42.
44. A cell comprising the isolated polynucleotide of claim 42 or the vector of claim 43.
45. A method of increasing differentiation of a stem cell into a myoblast, the method comprising: increasing in the stem cell the level of a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1.
46. A method of treating a subject in need thereof, the method comprising: increasing in a stem cell from the subject the level of a muscle-specific transcription factor selected from TWISTI, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1.
47. The method of claim 45 or 46, wherein increasing the level of the muscle-specific transcription factor comprises at least one of; (a) administering to the stem cell a polynucleotide encoding the muscle-specific transcription factor; (b) administering to he stem cell a polypeptide comprising the muscle-specific transcription factor; and (c) administering to the stem cell a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein targeting the muscle-specific transcription factor, or a TALE protein targeting the muscle-specific transcription factor, wherein the second polypeptide domain has transcription activation activity, and wherein a gRNA targeting the muscle-specific transcription factor is additionally administered when the first polypeptide domain comprises a Cas protein.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
DETAILED DESCRIPTION
[0051] Detailed herein are cell type-specific transcription factors and methods of using the same to increase expression of a cell type-specific gene, increase maturation of a stem cell-derived neuron, increase the conversion efficiency of a stem cell to a neuron, and treat a subject in need thereof, Further detailed herein is a high-throughput pooled CRISPR activation (CRISPRa) screen to map human cell-fate regulators and profile the contribution of putative human transcription factors for neuronal cell-fate specification of pluripotent stem cells. CRISPRa screens were used in a high-throughput approach to profile thousands of putative transcription factors in the human genome. CRISPR-based gRNA libraries are more easily designed and scaled, and are more amenable to testing combinatorial gene interactions and interrogating the non-coding genome than conventional methods. Using a reporter of neuronal commitment, the neurogenic activity of all transcription factors in human pluripotent stem cells was profiled. A single-factor screen was performed to identify master regulators of human neuronal fate, and many known and previously uncharacterized TFs were identified, Combinatorial screens were performed, and synergistic and antagonistic TF interactions that enhance or diminish neuronal differentiation were identified, respectively. TFs were uncovered that increase conversion efficiency, influence subtype specification, and improve maturation of in vitro-derived human neurons.
[0052] Collectively, this work highlights the utility of DNA targeting systems such as CRISPR-based technologies for regulating endogenous gene expression and provides a framework for identifying the causal role of cell-fate regulators in defining any cell type of interest. The set of candidate proneural transcription factors curated from the study detailed herein can serve as a resource for establishing protocols to generate every cell type in the human brain.
1. DEFINITIONS
[0053] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. In case of conflict, the present document, including definitions, will control. Preferred methods and materials are described below, although methods and materials similar or equivalent to those described herein can be used in practice or testing of the present invention. All publications, patent applications, patents and other references mentioned herein are incorporated by reference in their entirety. The materials, methods, and examples disclosed herein are illustrative only and not intended to be limiting.
[0054] The terms “comprise(s),” “include(s),” “having,” “has,” “can,” “contain(s),” and variants thereof, as used herein, are intended to be open-ended transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures. The singular forms “a,” “and” and “the” include plural references unless the context clearly dictates otherwise. The present disclosure also contemplates other embodiments “comprising,” “consisting of” and “consisting essentially of,” the embodiments or elements presented herein, whether explicitly set forth or not.
[0055] For the recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
[0056] The term “about” as used herein as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain aspects, the term “about” refers to a range of values that fall within 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
[0057] “Adeno-associated virus” or “AAV” as used interchangeably herein refers to a small virus belonging to the genus Dependovirus of the Parvoviridae family that infects humans and some other primate species. AAV is not currently known to cause disease and consequently the virus causes a very mild immune response.
[0058] “Amino acid” as used herein refers to naturally occurring and non-natural synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code. Amino acids can be referred to herein by either their commonly known three-letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Amino acids include the side chain and polypeptide backbone portions.
[0059] “Binding region” as used herein refers to the region within a nuclease target region that is recognized and bound by the nuclease.
[0060] “Coding sequence” or “encoding nucleic acid” as used herein means the nucleic acids (RNA or DNA molecule) that comprise a nucleotide sequence which encodes a protein. The coding sequence can further include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to which the nucleic acid is administered. The coding sequence may be codon optimize.
[0061] “Complement” or “complementary” as used herein means a nucleic acid can mean Watson-Crick (e.g., A-T/U and C-G) or Hoogsteen base pairing between nucleotides or nucleotide analogs of nucleic acid molecules. “Complementarity” refers to a property shared between two nucleic acid sequences, such that when they are aligned antiparallel to each other, the nucleotide bases at each position will be complementary.
[0062] The terms “control,” “reference level,” and “reference” are used herein interchangeably. The reference level may be a predetermined value or range, which is employed as a benchmark against which to assess the measured result. “Control group” as used herein refers to a group of control subjects. The predetermined level may be a cutoff value from a control group. The predetermined level may be an average from a control group. Cutoff values (or predetermined cutoff values) may be determined by Adaptive Index Model (AIM) methodology. Cutoff values (or predetermined cutoff values) may be determined by a receiver operating curve (ROC) analysis from biological samples of the patient group. ROC analysis, as generally known in the biological arts, is a determination of the ability of a test to discriminate one condition from another, e.g., to determine the performance of each marker in identifying a patient having CRC. A description of ROC analysis is provided in P. J. Heagerty et al. (Biometrics 2000, 56, 337-44), the disclosure of which is hereby incorporated by reference in its entirety. Alternatively, cutoff values may be determined by a quartile analysis of biological samples of a patient group. For example, a cutoff value may be determined by selecting a value that corresponds to any value in the 25th-75th percentile range, preferably a value that corresponds to the 25th percentile, the 50th percentile or the 75th percentile, and more preferably the 75th percentile. Such statistical analyses may be performed using any method known in the art and can be implemented through any number of commercially available software packages (e,g., from Analyse-it Software Ltd., Leeds, UK; StataCorp LP, College Station, Tex.; SAS Institute Inc., Cary, N.C.), The healthy or normal levels or ranges for a target or for a protein activity may be defined in accordance with standard practice. A control may be an subject or cell without an agonist as detailed herein. A control may be a subject, or a sample therefrom, whose disease state is known. The subject, or sample therefrom, may be healthy, diseased, diseased prior to treatment, diseased during treatment, or diseased after treatment, or a combination thereof.
[0063] “Fusion protein” as used herein refers to a chimeric protein created through the translation of two or more joined genes that originally coded for separate proteins. The translation of the fusion gene results in a single polypeptide with functional properties derived from each of the original separate proteins.
[0064] “Genetic construct” as used herein refers to the DNA or RNA molecules that comprise a polynucleotide that encodes a protein. The coding sequence includes initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of the individual to whom the nucleic acid molecule is administered. As used herein, the term “expressible form” refers to gene constructs that contain the necessary regulatory elements operable linked to a coding sequence that encodes a protein such that when present in the cell of the individual, the coding sequence will be expressed.
[0065] “Genome editing” as used herein refers to changing a gene. Genome editing may include correcting or restoring a mutant gene. Genome editing may include knocking out a gene, such as a mutant gene or a normal gene. Genome editing may be used to treat disease or enhance muscle repair by changing the gene of interest.
[0066] “Identical” or “identity” as used herein in the context of two or more nucleic acids or polypeptide sequences means that the sequences have a specified percentage of residues that are the same over a specified region. The percentage may be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity. In cases where the two sequences are of different lengths or the alignment produces one or more staggered ends and the specified region of comparison includes only a single sequence, the residues of single sequence are included in the denominator but not the numerator of the calculation. When comparing DNA and RNA, thyrnine (T) and uracil (U) may be considered equivalent. Identity may be performed manually or by using a computer sequence algorithm such as BLAST or BLAST 2.0.
[0067] “Mutant gene” or “mutated gene” as used interchangeably herein refers to a gene that has undergone a detectable mutation. A mutant gene has undergone a change, such as the loss, gain, or exchange of genetic material, which affects the normal transmission and expression of the gene. A “disrupted gene” as used herein refers to a mutant gene that has a mutation that causes a premature stop codon. The disrupted gene product is truncated relative to a full-length undisrupted gene product.
[0068] “Normal gene” as used herein refers to a gene that has not undergone a change, such as a loss, gain, or exchange of genetic material. The normal gene undergoes normal gene transmission and gene expression. For example, a normal gene may be a wild-type gene.
[0069] “Nucleic acid” or “oligonucleotide” or “polynucleotide” as used herein means at least two nucleotides covalently linked together. The depiction of a single strand also defines the sequence of the complementary strand. Thus, a polynucleotide also encompasses the complementary strand of a depicted single strand. Many variants of a polynucleotide may be used for the same purpose as a given polynucleotide. Thus, a polynucleotide also encompasses substantially identical polynucleotides and complements thereof. A single strand provides a probe that may hybridize to a target sequence under stringent hybridization conditions. Thus, a polynucleotide also encompasses a probe that hybridizes under stringent hybridization conditions. Polynucleotides may be single stranded or double stranded, or may contain portions of both double stranded and single stranded sequence. The polynucleotide can be nucleic acid, natural or synthetic, DNA, genomic DNA, cDNA, RNA, or a hybrid, where the polynucleotide can contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including, for example, uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, and isoguanine. Polynucleotides can be obtained by chemical synthesis methods or by recombinant methods.
[0070] “Operably linked” as used herein means that expression of a gene is under the control of a promoter with which it is spatially connected. A promoter may be positioned 5′ (upstream) or 3′ (downstream) of a gene under its control. The distance between the promoter and a gene may be approximately the same as the distance between that promoter and the gene it controls in the gene from which the promoter is derived. As is known in the art, variation in this distance may be accommodated without loss of promoter function.
[0071] “Partially-functional” as used herein describes a protein that is encoded by a mutant gene and has less biological activity than a functional protein but more than a non-functional protein.
[0072] A “peptide” or “polypeptide” is a linked sequence of two or more amino acids linked by peptide bonds. The polypeptide can be natural, synthetic, or a modification or combination of natural and synthetic. Peptides and polypeptides include proteins such as binding proteins, receptors, and antibodies. The terms “polypeptide”, “protein,” and “peptide” are used interchangeably herein. “Primary structure” refers to the amino acid sequence of a particular peptide. “Secondary structure” refers to locally ordered, three dimensional structures within a polypeptide. These structures are commonly known as domains, e.g., enzymatic domains, extracellular domains, transmembrane domains, pore domains, and cytoplasmic tail domains. “Domains” are portions of a polypeptide that form a compact unit of the polypeptide and are typically 15 to 350 amino acids long. Exemplary domains include domains with enzymatic activity or ligand binding activity. Typical domains are made up of sections of lesser organization such as stretches of beta-sheet and alpha-helices. “Tertiary structure” refers to the complete three dimensional structure of a polypeptide monomer. “Quaternary structure” refers to the three dimensional structure formed by the noncovalent association of independent tertiary units. A “motif” is a portion of a polypeptide sequence and includes at least two amino acids. A motif may be 2 to 20, 2 to 15, or 2 to 10 amino acids in length. In some embodiments, a motif includes 3, 4, 5, 6, or 7 sequential amino acids. A domain may be comprised of a series of the same type of motif.
[0073] “Premature stop codon” or “out-of-frame stop codon” as used interchangeably herein refers to nonsense mutation in a sequence of DNA, which results in a stop codon at location not normally found in the wild-type gene. A premature stop codon may cause a protein to be truncated or shorter compared to the full-length version of the protein.
[0074] “Promoter” as used herein means a synthetic or naturally-derived molecule which is capable of conferring, activating or enhancing expression of a nucleic acid in a cell. A promoter may comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of same. A promoter may also comprise distal enhancer or repressor elements, which may be located as much as several thousand base pairs from the start site of transcription. A promoter may be derived from sources including viral, bacterial, fungal, plants, insects, and animals. A promoter may regulate the expression of a gene component constitutively, or differentially with respect to cell, the tissue or organ in which expression occurs or, with respect to the developmental stage at which expression occurs, or in response to external stimuli such as physiological stresses, pathogens, metal ions, or inducing agents. Representative examples of promoters include the bacteriophage T7 promoter, bacteriophage T3 promoter, SP6 promoter, lac operator-promoter, tac promoter, SV40 late promoter, SV40 early promoter, RSV-LTR promoter, CMV IE promoter, SV40 early promoter or SV40 late promoter, human U6 (hU6) promoter, and CMV IE promoter.
[0075] “Sample” or “test sample” as used herein can mean any sample in which the presence and/or level of a target is to be detected or determined or any sample comprising a DNA targeting system or component thereof as detailed herein. Samples may include liquids, solutions, emulsions, or suspensions. Samples may include a medical sample. Samples may include any biological fluid or tissue, such as blood, whole blood, fractions of blood such as plasma and serum, muscle, interstitial fluid, sweat, saliva, urine, tears, synovial fluid, bone marrow, cerebrospinal fluid, nasal secretions, sputum, amniotic fluid, bronchoalveolar lavage fluid, gastric lavage, emesis, fecal matter, lung tissue, peripheral blood mononuclear cells, total white blood cells, lymph node cells, spleen cells, tonsil cells, cancer cells, tumor cells, bile, digestive fluid, skin, or combinations thereof. In some embodiments, the sample comprises an aliquot. In other embodiments, the sample comprises a biological fluid. Samples can be obtained by any means known in the art. The sample can be used directly as obtained from a patient or can be pre-treated, such as by filtration, distillation, extraction, concentration, centrifugation, inactivation of interfering components, addition of reagents, and the like, to modify the character of the sample in some manner as discussed herein or otherwise as is known in the art.
[0076] “Spacers” and “spacer region” as used interchangeably herein refers to the region within a TALE or zinc finger target region that is between, but not a part of, the binding regions for two TALEsor zinc finger proteins,
[0077] “Subject” or “patient” as used herein can mean an animal that wants or is in need of the herein described compositions or methods. The subject may be a human or a non-human. The subject may be any vertebrate. The subject may be a mammal. The mammal may be a primate or a non-primate. The mammal can be a non-primate such as, for example, dog, cat, horse, cow, pig, mouse, rat, mouse, camel, llama, goat, rabbit, sheep, hamster, and guinea pig. The mammal can be a primate such as a human. The mammal can be a non-human primate such as, for example, monkey, cynomolgous monkey, rhesus monkey, chimpanzee, gorilla, orangutan, and gibbon, The subject may be of any age or stage of development, such as, for example, an adult, an adolescent, or an infant, The subject may be male. The subject may be female. In some embodiments, the subject has a specific genetic marker. The subject may be undergoing other forms of treatment.
[0078] “Substantially identical” can mean that a first and second amino acid or polynucleotide sequence are at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% over a region of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100 amino acids Of' nucleotides, respectively,
[0079] “Transcription activator-like effector” or “TALE” refers to a protein structure that recognizes and binds to a particular DNA sequence. The “TALE DNA-binding domain” refers to a DNA-binding domain that includes an array of tandem 33-35 amino acid repeats, also known as RVD modules, each of which specifically recognizes a single base pair of DNA. RVD modules may be arranged in any order to assemble an array that recognizes a defined sequence, A binding specificity of a TALE DNA-binding domain is determined by the RVD array followed by a single truncated repeat of 20 amino acids. “Repeat variable diresidue” or “RVD” refers to a pair of adjacent amino acid residues within a DNA recognition motif (also known as “RVD module”), which includes 33-35 amino acids, of a TALE DNA-binding domain, The RVD determines the nucleotide specificity of the RVD module. RVD modules may be combined to produce an RVD array. The “RVD array length” as used herein refers to the number of RVD modules that corresponds to the length of the nucleotide sequence within the TALEN target region that is recognized by a TALEN, i.e., the binding region A TALE DNA-binding domain may have 12 to 27 RVD modules, each of which contains an RVD and recognizes a single base pair of DNA, Specific RVDs have been identified that recognize each of the four possible DNA nucleotides (A, T, C, and G). Because the TALE DNA-binding domains are modular, repeats that recognize the four different DNA nucleotides may be linked together to recognize any particular' DNA sequence. These targeted DNA-binding domains may then be combined with catalytic domains to create functional enzymes, including artificial transcription factors, methyltransferases, integrases, nucleases, and recombinases.
[0080] “Target gene” as used herein refers to any nucleotide sequence encoding a known or putative gene product. The target gene may be a mutated gene involved in a genetic disease. In certain embodiments, the target gene is a gene encoding a transcription factor.
[0081] “Target region” as used herein refers to the region of the target gene to which the CRISPR/Cas9-based gene editing system is designed to bind.
[0082] “Transgene” as used herein refers to a gene or genetic material containing a gene sequence that has been isolated from one organism and is introduced into a different organism. This non-native segment of DNA may retain the ability to produce RNA or protein in the transgenic organism, or it may alter the normal function of the transgenic organism's genetic code. The introduction of a transgene has the potential to change the phenotype of an organism.
[0083] “Treatment” or “treating,” when referring to protection of a subject from a disease, means suppressing, repressing, ameliorating, or completely eliminating the disease. Preventing the disease involves administering a composition of the present invention to a subject prior to onset of the disease. Suppressing the disease involves administering a composition of the present invention to a subject after induction of the disease but before its clinical appearance. Repressing or ameliorating the disease involves administering a composition of the present invention to a subject after clinical appearance of the disease.
[0084] “Variant” used herein with respect to a polynucleotide means (i) a portion or fragment of a referenced nucleotide sequence; (ii) the complement of a referenced nucleotide sequence or portion thereof; (iii) a nucleic acid that is substantially identical to a referenced nucleic acid or the complement thereof; or (iv) a nucleic acid that hybridizes under stringent conditions to the referenced nucleic acid, complement thereof, or a sequences substantially identical thereto.
[0085] “Variant” with respect to a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity. Variant may also mean a protein with an amino acid sequence that is substantially identical to a referenced protein with an amino acid sequence that retains at least one biological activity. Representative examples of “biological activity” include the ability to be bound by a specific antibody or polypeptide or to promote an immune response. Variant can mean a functional fragment thereof. Variant can also mean multiple copies of a polypeptide. The multiple copies can be in tandem or separated by a linker. A conservative substitution of an amino acid, i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes may be identified, in part, by considering the hydropathic index of amino acids, as understood in the art. Kyte et al., J. Mol. Biol. 157:105-132 (1982). The hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. It is known in the art that amino acids of similar hydropathic indexes may be substituted and still retain protein function. In one aspect, amino acids having hydropathic indexes of ±2 are substituted. The hydrophilicity of amino acids may also be used to reveal substitutions that would result in proteins retaining biological function. A consideration of the hydrophilicity of amino acids in the context of a peptide permits calculation of the greatest local average hydrophilicity of that peptide. Substitutions may be performed with amino acids having hydrophilicity values within ±2 of each other. Both the hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.
[0086] “Vector” as used herein means a nucleic acid sequence containing an origin of replication. A vector may be a viral vector, bacteriophage, bacterial artificial chromosome or yeast artificial chromosome. A vector may be a DNA or RNA vector. A vector may be a self-replicating extrachromosomal vector, and preferably, is a DNA plasmid. For example, the vector may encode a Cas9 protein and at least one gRNA molecule.
[0087] “Zinc finger” as used herein refers to a protein that recognizes and binds to DNA sequences. The zinc finger domain is the most common DNA-binding motif in the human proteome. A single zinc finger contains approximately 30 amino acids, and the domain typically functions by binding 3 consecutive base pairs of DNA via interactions of a single amino acid side chain per base pair.
[0088] Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. For example, any nomenclatures used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics and protein and nucleic acid chemistry and hybridization described herein are those that are well known and commonly used in the art. The meaning and scope of the terms should be clear; in the event however of any latent ambiguity, definitions provided herein take precedent over any dictionary or extrinsic definition. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.
2. TRANSCRIPTION FACTOR
[0089] Provided herein are cell type-specific transcription factors. A transcription factor (TF) is a protein that controls the rate of transcription of genetic information from DNA to messenger RNA, by binding to a specific DNA sequence. TFs regulate genes to ensure they are expressed in the right cell at the right time and in the right amount throughout the life of the cell and the organism. TFs transmit complex patterns of intrinsic and extrinsic signals into dynamic gene expression programs that define cell-type identity. Groups of TFs may function in a coordinated fashion to direct, for example, cell division, cell growth, and cell death throughout life; cell migration and organization (body plan) during embryonic development; and intermittently in response to signals from outside the cell, such as a hormone, TFs may work alone or with other proteins in a complex, by, for example, promoting or blocking the recruitment of RNA polymerase. The TF may be specific for a particular cell type. The TF may be neuronal-specific. The TF may be muscle-specific. The TF may be chondrocyte-specific. The TF may be specific for any cell type, such as, for example, cells from a tissue selected from bone marrow, skin, skeletal muscle, fat tissue, and peripheral blood. The cells may be muscle cells (such as smooth muscle cells, skeletal muscle cells, and cardiac muscle cells, for example), epithelial cells, endothelial cells, urothelial cells, fibroblasts, hepatocytes, myoblasts, neurons, osteoblasts, osteoclasts, T-cells, keratinocyte cells, hair follicle cells, human umbilical vein endothelial cells (HUVEC), cord blood cells, neural progenitor cells, chondrocytes, chondroblasts, bile duct cells, pancreatic islet cells, thyroid cells, parathyroid cells, adrenal cells, hypothalamic cells, pituitary cells, ovarian cells, testicular cells, salivary gland cells, adipocytes, precursor cells, hematopoietic stem cells (HSC), mesenchymal stem cells (MSC) of adipose, mesenchymal stem cells (MSC) of bone marrow, oligodendrocytes, oligodendrocyte precursors, neutrophils, basophils, eosinophils, lymphocytes, monocytes, or cardiomyocytes. The TF may be a member of, for example, the C2H2 ZF, bHLH, or HMG/Sox DNA-binding domain families. The TF may be an activating TF (which activates or increases expression of a gene), or the TF may be a repressing TF (which represses or reduced the expression of a gene).
[0090] TFs may use a variety of mechanisms to regulate gene expression. For example, TFs may stabilize or block the binding of RNA polymerase to DNA. TFs may recruit coactivator or corepressor proteins to the transcription factor DNA complex. TFs may directly or indirectly catalyze the acetylation or deacetylation of historic proteins. Histone acetyltransferase (HAT) activity acetylates histone proteins, which weakens the association of DNA with histones, which may make the DNA more accessible to transcription, thereby up-regulating transcription. Histone deacetylase (HDAC) activity deacetylates histone proteins, which strengthens the association of DNA with histones, which may make the DNA less accessible to transcription, thereby down-regulating transcription. TFs may influence the three dimensional looping of DNA, which can in turn affect gene expression.
[0091] Provided herein are polynucleotides encoding at least one transcription factor, or the transcription factor polypeptides themselves. In some embodiments, the transcription factor is an endogenous transcription factor. “Endogenous” here refers to the copy of the gene that encodes the TF in its natural position in the subject's genome in chromosomal DNA. The transcription factor may direct expression of genes in neurons. The transcription factor may direct differentiation of a cell into a neuron. In some embodiments, a first transcription factor may work with a second transcription factor. The transcription factor may be putative. The transcription factor may be selected or identified as a neuronal-specific transcription factor. A neuronal-specific transcription factor may be referred to as a neurogenic factor.
[0092] The cell type-specific transcription factor may be activating or repressing. For example, an activating or positive neuronal-specific transcription factor increases the differentiation of a cell into a neuron or increases expression of genes in neurons. Increased expression of a positive neuronal-specific transcription factor may improve or increase differentiation of a cell into a neuron or increase expression of genes in neurons. A repressing or negative neuronal-specific transcription factor inhibits the differentiation of a cell into a neuron or inhibits expression of genes in neurons. Knockdown or inhibition of expression of a negative neuronal-specific transcription factor may improve or increase differentiation of a cell into a neuron or increase expression of genes in neurons. Modulation of expression or protein levels of the neuronal-specific transcription factor may directly convert a stem cell to a neuron without a pluripotent stage.
[0093] Provided herein is a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2. Further provided is a polynucleotide encoding the first neuronal-specific transcription factor. In some embodiments, the first neuronal-specific transcription factor is selected from NGN3 and ASCL1, or a combination thereof.
[0094] In some embodiments, also provided herein is a second neuronal-specific transcription factor or a polynucleotide encoding the second neuronal-specific transcription factor. A first neuronal-specific transcription factor may be combined with a second neuronal-specific transcription factor. In such embodiments, the first neuronal-specific transcription factor may be selected from NGN3 and ASCL1, or a combination thereof. The second neuronal-specific transcription factor may be selected from (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, PLAGL2 (selected from “Positive Single Factor CRa-TF” in TABLE 1); (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1, FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3 (selected from “Positive sgNGN3 + CRa-TF” in TABLE 1); (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLF5, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, IRF5, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCU GATA6, SPIB, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX, LHX8, GFI1, KLF17, OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, E2F7 (selected from “Positive sgASCL1 + CRa-TF” in TABLE 1); (iv) ZIC2, SPI1, GRHL2, TFAP2C, KLFS, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3 (selected from “Negative Single Factor CRa-TF” in TABLE 2); (v) HES2, SREBF1, CIC, WHSC1, VDR, HES1, ID2, TCF21, SNAII, RREB1, GCM2, IRF3, FOXA1, GATA5, GRHL1, SOX5, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HEST, ZBED4, SALL4, GLIS3, TBX22, ZNF331, EGR4, Z105, ZNF710, ZNF697, ZFP36L2, ELMSAN1, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HESS, ZIM2, ZNF579, BMP2, CRAMP1 L, TOX3, FEZF2, HES3, ZNF791 (selected from “Negative sgNGN3+ CRa-TF” in TABLE 2); and (vi) ETV1, ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1, IRF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1, ZNF160, ETV5, MYBL1, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HESS, BMP2, CRAMPI L, ZNF821, KMT2A, HES3, BSX (selected from “Negative sgASCL1 CRa-TF” in TABLE 2).
[0095] In some embodiments, the second neuronal-specific transcription factor is selected from NEUROG3, SOX4, and SOX9. In some embodiments, the second neuronal-specific transcription factor is selected from LHX8, LHX6, E2F7, RUNX3, FOXH1, SOX2, HMX2, NKX2-2, HES3, and ZFP36L1. In some embodiments, the second neuronal-specific transcription factor is an activating transcription factor selected from LHX8, LHX6, E2F7, RUNX3, FOXH1, SOX2, HMX2, NKX2-2. In some embodiments, the second neuronal-specific transcription factor is a repressing transcription factor selected from HES3 and ZFP36L1.
[0096] Further provided herein is a muscle-specific transcription factor. The muscle-specific transcription factor may be selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1. Further provided is a polynucleotide encoding the muscle-specific transcription factor.
3. CRISPR/CAS-BASED GENE EDITING SYSTEM
[0097] The system may be a CRISPR/Cas-based gene editing system. The CRISPR/Cas-based gene editing system can include a nuclease-inactive Cas protein (dCas) or a dCas fusion protein to target regions in a TF gene, or a promoter or regulatory element of the TF gene or a portion thereof, causing activation or repression of endogenous expression of the TF. The system may be a CRISPR/Cas9-based gene editing system. “Clustered Regularly Interspaced Short Palindromic Repeats” and “CRISPRs”, as used interchangeably herein, refers to loci containing multiple short direct repeats that are found in the genomes of approximately 40% of sequenced bacteria and 90% of sequenced archaea. The CRISPR system is a microbial nuclease system involved in defense against invading phages and plasmids that provides a form of acquired immunity. The CRISPR loci in microbial hosts contain a combination of CRISPR-associated (Cas) genes as well as non-coding RNA elements capable of programming the specificity of the CRISPR-mediated nucleic acid cleavage. Short segments of foreign DNA, called spacers, are incorporated into the genome between CRISPR repeats, and serve as a ‘memory’ of past exposures. A Cas protein, such as a Cas9 protein, forms a complex with the 3′ end of the sgRNA (also referred interchangeably herein as “gRNA”), and the protein-RNA pair recognizes its genomic target by complementary base pairing between the 5′ end of the sgRNA sequence and a predefined 20 bp DNA sequence, known as the protospacer. This complex is directed to homologous loci of pathogen DNA via regions encoded within the crRNA, i.e., the protospacers, and protospacer-adjacent motifs (PAMs) within the pathogen genome. The non-coding CRISPR array is transcribed and cleaved within direct repeats into short crRNAs containing individual spacer sequences, which direct Cas nucleases to the target site (protospacer). By simply exchanging the 20 bp recognition sequence of the expressed sgRNA, the Cas9 nuclease can be directed to new genomic targets. CRISPR spacers are used to recognize and silence exogenous genetic elements in a manner analogous to RNAi in eukaryotic organisms.
[0098] Three classes of CRISPR systems (Types I, II, and III effector systems) are known. The Type II effector system carries out targeted DNA double-strand break in four sequential steps, using a single effector enzyme, such as Cas9, to cleave dsDNA. Compared to the Type I and Type III effector systems, which require multiple distinct effectors acting as a complex, the Type II effector system may function in alternative contexts such as eukaryotic cells. The Type II effector system consists of a long pre-crRNA, which is transcribed from the spacer-containing CRISPR locus, the Cas9 protein, and a tracrRNA, which is involved in pre-crRNA processing. The tracrRNAs hybridize to the repeat regions separating the spacers of the pre-crRNA, thus initiating dsRNA cleavage by endogenous RNase III. This cleavage is followed by a second cleavage event within each spacer by Cas9, producing mature crRNAs that remain associated with the tracrRNA and Cas9, forming a Cas9:crRNA-tracrRNA complex.
[0099] The Cas9:crRNA-tracrRNA complex unwinds the DNA duplex and searches for sequences matching the crRNA to cleave. Target recognition occurs upon detection of complementarity between a “protospacer” sequence in the target DNA and the remaining spacer sequence in the crRNA. Cas9 mediates cleavage of target DNA if a correct protospacer-adjacent motif (PAM) is also present at the 3′ end of the protospacer. For protospacer targeting, the sequence must be immediately followed by the protospacer-adjacent motif (PAM), a shod sequence recognized by the Cas9 nuclease that is required for DNA cleavage. Different Type II systems have differing PAM requirements. The Streptococcus pyogenes CRISPR system may have the PAM sequence for this Cas9 (SpCas9) as 5′-NRG-3′, where R is either A or G, and characterized the specificity of this system in human cells. A unique capability of the CRISPR/Cas9-based gene editing system is the straightforward ability to simultaneously target multiple distinct genomic loci by co-expressing a single Cas9 protein with two or more sgRNAs. For example, the S. pyogenes Type II system naturally prefers to use an “NGG” sequence, where “N” can be any nucleotide, but also accepts other PAM sequences, such as “NAG” in engineered systems (Hsu et al., Nature Biotechnology 2013 doi:10.1038/nbt.2647). Similarly, the Cas9 derived from Neisseria meningitidis (NmCas9) normally has a native PAM of NNNNGATT (SEQ ID NO: 12), but has activity across a variety of PAMs, including a highly degenerate NNNNGNNN PAM (SEQ ID NO: 13) (Esvelt et al. Nature Methods 2013 doi:10.1038/nmeth.2681).
[0100] A Cas9 molecule of S. aureus recognizes the sequence motif NNGRR (R=A or G) (SEQ ID NO: 8) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, by upstream from that sequence. In certain embodiments, a Cas9 molecule of S. aureus recognizes the sequence motif NNGRRN (R=A or G) (SEQ ID NO: 9) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, bp upstream from that sequence. In certain embodiments, a Cas9 molecule of S. aureus recognizes the sequence motif NNGRRT (R=A or G) (SEQ ID NO: 10) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, bp upstream from that sequence. In certain embodiments, a Cas9 molecule of S. aureus recognizes the sequence motif NNGRRV (R=A or G) (SEQ ID NO: 11) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, bp upstream from that sequence. In the aforementioned embodiments, N can be any nucleotide residue, e.g., any of A, G, C, or T. Cas9 molecules can be engineered to alter the PAM specificity of the Cas9 molecule.
[0101] An engineered form of the Type II effector system of S. pyogenes was shown to function in human cells for genome engineering. In this system, the Cas9 protein was directed to genomic target sites by a synthetically reconstituted “guide RNA” (“gRNA”, also used interchangeably herein as a chimeric single guide RNA (“sgRNA”)), which is a crRNA-tracrRNA fusion that obviates the need for RNase III and crRNA processing in general. Provided herein are CRISPR/Cas9-based engineered systems for use in genome editing and treating genetic diseases, The CRISPR/Cas9-based engineered systems can be designed to target any gene, including genes involved in a genetic disease, aging, tissue regeneration, or wound healing, The CRISPR/Cas9-based gene editing systems can include a Cas9 protein or Cas9 fusion protein and at least one gRNA. In certain embodiments, the system comprises two gRNA molecules. The Cas9 fusion protein may, for example, include a domain that has a different activity that what is endogenous to Cas9, such as a transactivation domain.
[0102] The target gene can be involved in differentiation of a cell or any other process in which activation of a gene can be desired, or can have a mutation such as a frameshift mutation or a nonsense mutation. In some embodiments, the target or target gene includes a gene, or portion thereof, for a putative transcription factor. The CRISPR/Cas9-based gene editing system may or may not mediate off-target changes to protein-coding regions of the genome. The CRISPR/Cas9-based gene editing system may bind and recognize a target region.
[0103] a. Cas Protein
[0104] The CRISPR/Cas9-based gene editing system can include a Cas9 protein or a Cas fusion protein, In some embodiments, the Cas protein is a Cas12 protein (also referred to as Cpf1), such as a Cas12a protein. The Cas12 protein can be from any bacterial or archaea species, including, but not limited to, Francisella novicida, Acidaminococcus sp., Lachnospiraceae sp., and Prevotella sp. In some embodiments, the Cas protein is a Cas9 protein. Cas9 protein is an endonuclease that cleaves nucleic acid and is encoded by the CRISPR loci and is involved in the Type II CRISPR system. The Cas9 protein can be from any bacterial or archaea species, including, but not limited to, Streptococcus pyogenes, Staphylococcus aureus (S. aureus), Acidovorax avenae, Actinobacillus pleuropneumoniae, Actinobacillus succinogenes, Actinobacillus suis, Actinomyces sp., Cycliphilus denitrificans, Aminomonas paucivorans, Bacillus cereus, Bacillus smithii, Bacillus thuringiensis, Bacteroides sp., Blastopirellula marina, Bradyrhizobium sp., Brevibacillus laterosporus, Campylobacter coli, Campylobacterjejuni, Campylobacter lari, Candidatus Puniceispirillum, Clostridium cellulolyticum, Clostridium perfringens, Corynebactenurn accolens, Corynebacterium diphtheria, Corynebacterium matruchotii, Dinoroseobacter shibae, Eubactedurn dolichum, gamma proteobacteriurn, Gluconacetobacter diazotrophicus, Haemophilus parainfluenzae, Haemophilus sputorum, Helicobacter canadensis, Helicobacter cinaedi, Helicobacter mustelae, ilyobacter polytropus, Kingella kingae, Lactobacillus crispatus, Listeria ivanovii, Listeria monocytogenes, Listeriaceae bacterium, Methylocystis sp., Methylosinus trichosporium, Mobiluncus mulieris, Neisseria bacilliformis, Neisseria cinerea, Neisseria flavescens, Neisseria lactamica, Neisseria sp., Neisseria wadsworthii, Nitrosomonas sp., Parvibaculum lavamentivorans, Pasteurella multocida, Phascolarctobacterium succinatulens, Ralstonia syzygii, Rhodopseudomonas palustris, Rhodovulum sp,, Simonsiella muelleeri, Sphingomonas sp., Spomlactobacillus vineae, Staphylococcus lugdunensis, Streptococcus sp., Subdoligranulum sp., Tistrella mobillis Treponema sp., or Verminephrobacter eiseniae. In certain embodiments, the Cas9 molecule is a Streptococcus pyogenes Cas9 molecule (also referred herein as “SpCas9”). In certain embodiments, the Cas9 molecule is a Staphylococcus aureus Cas9 molecule (also referred herein as “SaCas9”).
[0105] A Cas molecule or a Cas fusion protein can interact with one or more gRNA molecule and, in concert with the gRNA molecule(s), can localize to a site which comprises a target domain, and in certain embodiments, a PAM sequence. The ability of a Cas molecule or a Cas fusion protein to recognize a PAM sequence can be determined, e.g., using a transformation assay as known in the art.
[0106] In certain embodiments, the ability of a Cas molecule or a Cas fusion protein to interact with and cleave a target nucleic acid is protospacer-adjacent motif (PAM) sequence dependent. A PAM sequence is a sequence in the target nucleic acid. In certain embodiments, cleavage of the target nucleic acid occurs upstream from the PAM sequence. Cas molecules from different bacterial species can recognize different sequence motifs (e.g., PAM sequences). In certain embodiments, a Cas12 molecule of Francisella novicida recognizes the sequence motif TTTN (SEQ ID NO: 35). In certain embodiments, a Cas9 molecule of S. pyogenes recognizes the sequence motif NGG (SEQ ID NO: 1) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, bp upstream from that sequence. In certain embodiments, a Cas9 molecule of S. thermophilus recognizes the sequence motif NGGNG (SEQ ID NO: 5) and/or NNAGAAW (W=A or T) (SEQ ID NO: 6) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, by upstream from these sequences. In certain embodiments, a Cas9 molecule of S. mutans recognizes the sequence motif NGG (SEQ ID NO: 1) and/or NAAR (R=A or G) (SEQ ID NO: 7) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5 bp, upstream from this sequence. In certain embodiments, a Cas9 molecule of S. aureus recognizes the sequence motif NNGRR (R=A or G) (SEQ ID NO: 8) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, bp upstream from that sequence. In certain embodiments, a Cas9 molecule of S. aureus recognizes the sequence motif NNGRRN (R=A or G) (SEQ ID NO: 9) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, by upstream from that sequence, In certain embodiments, a Cas9 molecule of S. aureus recognizes the sequence motif NNGRRT (R=A or G) (SEQ ID NO: 10) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, bp upstream from that sequence. In certain embodiments, a Cas9 molecule of S. aureus recognizes the sequence motif NNGRRV (R=A or G; V=A or C or G) (SEQ ID NO: 11) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, bp upstream from that sequence. In the aforementioned embodiments, N can be any nucleotide residue, e.g., any of A, G, C, or T. Cas9 molecules can be engineered to alter the PAM specificity of the Cas9 molecule.
[0107] In certain embodiments, the vector encodes at least one Cas9 molecule that recognizes a Protospacer Adjacent Motif (PAM) of either NNGRRT (SEQ ID NO: 10) or NNGRRV (SEQ ID NO: 11). In certain embodiments, the at least one Cas9 molecule is an S. aureus Cas9 molecule. In certain embodiments, the at least one Cas9 molecule is a mutant S. aureus Cas9 molecule.
[0108] The Cas protein can be mutated so that the nuclease activity is inactivated. An inactivated Cas9 protein (“iCas9”, also referred to as “dCas9”) with no endonuclease activity has been targeted to genes in bacteria, yeast, and human cells by gRNAs to silence gene expression through steric hindrance. Exemplary mutations with reference to the S. pyogenes Cas9 sequence include; D10A, E762A, H840A, N854A, N863A, and/or D986A. Exemplary mutations with reference to the S. aureus Cas9 sequence include D10A and N580A. In certain embodiments, the Cas9 molecule is a mutant S. aureus Cas9 molecule. In some embodiments, the dCas9 is a Cas9 molecule that includes at least two mutations selected from D10A, E762A, H840A, N854A, N863A, and/or D986A, with reference to the S. pyogenes Cas9 sequence. In some embodiments, the Cas protein is a dCas9 protein. In some embodiments, the Cas protein is a dCas12 protein.
[0109] In certain embodiments, the mutant S. aureus Cas9 molecule comprises a D10A mutation. The nucleotide sequence encoding this mutant S. aureus Cas9 is set forth in SEQ ID NO: 22.
[0110] In certain embodiments, the mutant S. aureus Cas9 molecule comprises a N580A mutation. The nucleotide sequence encoding this mutant S. aureus Cas9 molecule is set forth in SEQ ID NO: 23.
[0111] A polynucleotide encoding a Cas9 molecule can be a synthetic polynucleotide. For example, the synthetic polynucleotide can be chemically modified. The synthetic polynucleotide can be codon optimized, e.g., at least one non-common codon or less-common codon has been replaced by a common codon. For example, the synthetic polynucleotide can direct the synthesis of an optimized messenger mRNA, e.g., optimized for expression in a mammalian expression system, e.g., described herein.
[0112] Additionally or alternatively, a nucleic acid encoding a Cas9 molecule or Cas9 polypeptide may comprise a nuclear localization sequence (NLS). Nuclear localization sequences are known in the art. An exemplary codon optimized nucleic acid sequence encoding a Cas9 molecule of S. pyogenes is set forth in SEQ ID NO: 14. The corresponding amino acid sequence of an S. pyogenes Cas9 molecule is set forth in SEQ ID NO: 15.
[0113] Exemplary codon optimized nucleic acid sequences encoding a Cas9 molecule of S. aureus, and optionally containing nuclear localization sequences (NLSs), are set forth in SEQ ID NOs: 16-20 and 24-25. Another exemplary codon optimized nucleic acid sequence encoding a Cas9 molecule of S. aureus comprises the nucleotides 1293-4451 of SEQ ID NO: 27. An amino acid sequence of an S. aureus Cas9 molecule is set forth in SEQ ID NO: 21. An amino acid sequence of an S. aureus Cas9 molecule is set forth in SEQ ID NO: 26.
[0114] b. Fusion Protein
[0115] Alternatively or additionally, the CRISPR/Cas-based gene editing system can include a fusion protein. The fusion protein can comprise two heterologous polypeptide domains, wherein the first polypeptide domain comprises a DNA binding protein such as a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has an activity such as transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, nucleic acid association activity, methylase activity, or demethylase activity. The fusion protein can include a first polypeptide domain such as a Cas9 protein or a mutated Cas9 protein, fused to a second polypeptide domain that has an activity such as transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, nucleic acid association activity, methylase activity, or demethylase activity. In some embodiments, the second polypeptide domain has transcription activation activity. In some embodiments, the second polypeptide domain has transcription repression activity. In some embodiments, the second polypeptide domain comprises a synthetic transcription factor. The second polypeptide domain may be at the C-terminal end of the first polypeptide domain, or at the N-terminal end of the first polypeptide domain, or a combination thereof. The fusion protein may include one second polypeptide domain. The fusion protein may include two of the second polypeptide domains. For example, the fusion protein may include a second polypeptide domain at the N-terminal end of the first polypeptide domain as well as a second polypeptide domain at the C-terminal end of the first polypeptide domain. In other embodiments, the fusion protein may include a single first polypeptide domain and more than one (for example, two or three) second polypeptide domains in tandem.
[0116] i) Transcription Activation Activity
[0117] The second polypeptide domain can have transcription activation activity, i.e., a transactivation domain. For example, gene expression of endogenous mammalian genes, such as human genes, can be achieved by targeting a fusion protein of a first polypeptide domain, such as dCas9 or dCas12 and a transactivation domain to mammalian promoters via combinations of gRNAs. The transactivation domain can include a VP16 protein, multiple VP16 proteins, such as a VP48 domain or VP64 domain, p65 domain of NF kappa B transcription activator activity, or p300. For example, the fusion protein may be dCas9-VP64. In other embodiments, the Cas9 protein may be VP64-dCas9-VP64 (SEQ ID NO: 36, encoded by polynucleotide of SEQ ID NO: 37). In other embodiments, the fusion protein that activates transcription may be dCas9-p300. In some embodiments, p300 may comprise a polypeptide of SEQ ID NO: 159 or SEQ ID NO:160.
[0118] ii) Transcription Repression Activity
[0119] The second polypeptide domain can have transcription repression activity. The second polypeptide domain can have a Kruppel associated box activity, such as a KRAB domain, ERF repressor domain activity, Mxil repressor domain activity, SID4X repressor domain activity, Mad-SID repressor domain activity, or TATA box binding protein activity. For example, the fusion protein may be dCas9-KRAB.
[0120] iii) Transcription Release Factor Activity
[0121] The second polypeptide domain can have transcription release factor activity. The second polypeptide domain can have eukaryotic release factor 1 (ERF1) activity or eukaryotic release factor 3 (ERF3) activity.
[0122] iv) Histone Modification Activity
[0123] The second polypeptide domain can have histone modification activity. The second polypeptide domain can have histone deacetylase, histone acetyltransferase, histone demethylase, or histone methyltransferase activity. The histone acetyltransferase may be p300 or CREB-binding protein (CBP) protein, or fragments thereof. For example, the fusion protein may be dCas9-p300. In some embodiments, p300 may comprise a polypeptide of SEQ ID NO: 159 or SEQ ID NO: 160.
[0124] v) Nuclease Activity
[0125] The second polypeptide domain can have nuclease activity that is different from the nuclease activity of the Cas9 protein. A nuclease, ora protein having nuclease activity, is an enzyme capable of cleaving the phosphodiester bonds between the nucleotide subunits of nucleic acids. Nucleases are usually further divided into endonucleases and exonucleases, although some of the enzymes may fall in both categories. Well known nucleases include deoxyribonuclease and ribonuclease,
[0126] vi) Nucleic Acid Association Activity
[0127] The second polypeptide domain can have nucleic acid association activity or nucleic acid binding protein-DNA-binding domain (DBD). A DBD is an independently folded protein domain that contains at least one motif that recognizes double- or single-stranded DNA. A DBD can recognize a specific DNA sequence (a recognition sequence) or have a general affinity to DNA. A nucleic acid association region may be selected from helix-tun-helix region, leucine zipper region, winged helix region, winged helix-turn-helix region, helix-loop-helix region, immunoglobulin fold, B3 domain, Zinc finger, HMG-box, Wor3 domain, TAL effector DNA-binding domain.
[0128] vii) Methylase Activity
[0129] The second polypeptide domain can have rnethylase activity, which involves transferring a methyl group to DNA, RNA, protein, small molecule, cytosine or adenine. In some embodiments, the second polypeptide domain includes a DNA methyltransferase.
[0130] viii) Demethylase Activity
[0131] The second polypeptide domain can have demethylase activity. The second polypeptide domain can include an enzyme that removes methyl (CH3-) groups from nucleic acids, proteins (in particular histones), and other molecules. Alternatively, the second polypeptide can convert the methyl group to hydroxymethylcytosine in a mechanism for demethylating DNA. The second polypeptide can catalyze this reaction. For example, the second polypeptide that catalyzes this reaction can be Tet1.
[0132] c. gRNA
[0133] The CRISPR/Cas-based gene editing system includes at least one gRNA molecule. For example, the CRISPR/Cas-based gene editing system may include two gRNA molecules. The gRNA provides the targeting of a CRISPR/Cas-based gene editing system. The gRNA is a fusion of two noncoding RNAs: a crRNA and a tracrRNA. In some embodiments, the polynucleotide includes a crRNA and/or a tracrRNA. The sgRNA may target any desired DNA sequence by exchanging the sequence encoding a 20 bp protospacer which confers targeting specificity through complementary base pairing with the desired DNA target. gRNA mimics the naturally occurring crRNA:tracrRNA duplex involved in the Type II Effector system. This duplex, which may include, for example, a 42-nucleotide crRNA and a 75-nucleotide tracrRNA, acts as a guide for the Cas9 to cleave the target nucleic acid. The “target region”, “target sequence” or “protospacer” refers to the region of the target gene to which the CRISPR/Cas9-based gene editing system targets and binds. The portion of the gRNA that targets the target sequence in the genome may be referred to as the “targeting sequence” or “targeting portion” or “targeting domain.” “Protospacer” or “gRNA spacer” may refer to the region of the target gene to which the CRISPRICas9-based gene editing system targets and binds; “protospacer” or “gRNA spacer” may also refer to the portion of the gRNA that is complementary to the targeted sequence in the genome. The gRNA may include a gRNA scaffold. A gRNA scaffold facilitates Cas9 binding to the gRNA and may facilitate endonuclease activity. The gRNA scaffold is a polynucleotide sequence that follows the portion of the gRNA corresponding to sequence that the gRNA targets. Together, the gRNA targeting portion and gRNA scaffold form one polynucleotide. The scaffold may comprise a polynucleotide sequence of SEQ ID NO: 158. The CRISPR/Cas9-based gene editing system may include at least one gRNA, wherein the gRNAs target different DNA sequences. The target DNA sequences may be overlapping. The target sequence or protospacer is followed by a PAM sequence at the 3′ end of the protospacer in the genome. Different Type II systems have differing PAM requirements. For example, the Streptococcus pyogenes Type II system uses an “NGG” sequence (SEQ ID NO: 1), where “N” can be any nucleotide. In some embodiments, the PAM sequence may be “NGG”, where “N” can be any nucleotide. In some embodiments, the PAM sequence may be NNGRRT (SEQ ID NO: 10) or NNGRRV (SEQ ID NO: 11). The at least one gRNA molecule can bind and recognize a target region.
[0134] The number of gRNA molecule encoded by a genetic construct (e.g., an AAV vector) can be at least 1 gRNA, at least 2 different gRNA, at least 3 different gRNA at least 4 different gRNA, at least 5 different gRNA, at least 6 different gRNA, at least 7 different gRNA, at least 8 different gRNA, at least 9 different gRNA, at least 10 different gRNAs, at least 11 different gRNAs, at least 12 different gRNAs, at least 13 different gRNAs, at least 14 different gRNAs, at least 15 different gRNAs, at least 16 different gRNAs, at least 17 different gRNAs, at least 18 different gRNAs, at least 18 different gRNAs, at least 20 different gRNAs, at least 25 different gRNAs, at least 30 different gRNAs, at least 35 different gRNAs, at least 40 different gRNAs, at least 45 different gRNAs, or at least 50 different gRNAs. The number of gRNAs encoded by a presently disclosed vector can be between at least 1 gRNA to at least 50 different gRNAs, at least 1 gRNA to at least 45 different gRNAs, at least 1 gRNA to at least 40 different gRNAs, at least 1 gRNA to at least 35 different gRNAs, at least 1 gRNA to at least 30 different gRNAs, at least 1 gRNA to at least 25 different gRNAs, at least 1 gRNA to at least 20 different gRNAs, at least 1 gRNA to at least 16 different gRNAs, at least 1 gRNA to at least 12 different gRNAs, at least 1 gRNA to at least 8 different gRNAs, at least 1 gRNA to at least 4 different gRNAs, at least 4 gRNAs to at least 50 different gRNAs, at least 4 different gRNAs to at least 45 different gRNAs, at least 4 different gRNAs to at least 40 different gRNAs, at least 4 different gRNAs to at least 35 different gRNAs, at least 4 different gRNAs to at least 30 different gRNAs, at least 4 different gRNAs to at least 25 different gRNAs, at least 4 different gRNAs to at least 20 different gRNAs, at least 4 different gRNAs to at least 16 different gRNAs, at least 4 different gRNAs to at least 12 different gRNAs, at least 4 different gRNAs to at least 8 different gRNAs, at least 8 different gRNAs to at least 50 different gRNAs, at least 8 different gRNAs to at least 45 different gRNAs, at least 8 different gRNAs to at least 40 different gRNAs, at least 8 different gRNAs to at least 35 different gRNAs, 8 different gRNAs to at least 30 different gRNAs, at least 8 different gRNAs to at least 25 different gRNAs, 8 different gRNAs to at least 20 different gRNAs, at least 8 different gRNAs to at least 16 different gRNAs, or 8 different gRNAs to at least 12 different gRNAs. In certain embodiments, the genetic construct (e.g., an AAV vector) encodes one gRNA molecule, i.e., a first gRNA molecule, and optionally a Cas9 molecule. In certain embodiments, a first genetic construct (e.g., a first AAV vector) encodes one gRNA molecule, i.e,, a first gRNA molecule, and optionally a Cas9 molecule, and a second genetic construct (e.g., a second AAV vector) encodes one gRNA molecule, i.e., a second gRNA molecule, and optionally a Cas9 molecule.
[0135] The gRNA molecule comprises a targeting domain, which is a polynucleotide sequence complementary to the target DNA sequence followed by a PAM sequence. The gRNA may comprise a “G” at the 5′ end of the targeting domain or complementary polynucleotide sequence. The targeting domain of a gRNA molecule may comprise at least a 10 base pair, at least a 11 base pair, at least a 12 base pair, at least a 13 base pair, at least a 14 base pair, at least a 15 base pair, at least a 16 base pair, at least a 17 base pair, at least a 18 base pair, at least a 19 base pair, at least a 20 base pair, at least a 21 base pair, at least a 22 base pair, at least a 23 base pair, at least a 24 base pair, at least a 25 base pair, at least a 30 base pair, or at least a 35 base pair complementary polynucleotide sequence of the target DNA sequence followed by a PAM sequence. In certain embodiments, the targeting domain of a gRNA molecule has 19-25 nucleotides in length. In certain embodiments, the targeting domain of a gRNA molecule is 20 nucleotides in length. In certain embodiments, the targeting domain of a gRNA molecule is 21 nucleotides in length. In certain embodiments, the targeting domain of a gRNA molecule is 22 nucleotides in length. In certain embodiments, the targeting domain of a gRNA molecule is 23 nucleotides in length.
[0136] The gRNA may target a region within or near a gene encoding a transcription factor. In certain embodiments, the gRNA can target at least one of exons, introns, the promoter region, the enhancer region, or the transcribed region of the gene.
[0137] In some embodiments, the gRNA targets a neuronal-specific transcription factor. The gRNA may include a targeting domain that comprises a polynucleotide sequence corresponding to at least one of SEQ ID NOs: 38-97, as shown in TABLE 3, or a complement thereof or a variant thereof. The gRNA may target a polynucleotide comprising a sequence selected from SEQ ID NOs: 38-97, or a complement, a portion, or a variant thereof. The gRNA may be encoded by a polynucleotide comprising a sequence selected from SEQ ID NOs: 38-97, or a complement, a portion, or a variant thereof. The gRNA may comprise a polynucleotide sequence corresponding to (for example, a RNA version thereof) at least one of SEQ ID NOs: 38-97, or a complement, a portion, or a variant thereof.
TABLE-US-00001 TABLE 3 Exemplary gRNAs targeting putative neuronal- specific transcription factors. Gene sgRNA Sequence SEQ ID NO Scrambled 1 TGTCGTGATGCGTAGACGG 38 Scrambled 2 TCATCAAGGAGCATTCCGT 39 NEUROG3 CTCGAGAGAGCAAACAGAG 40 RFX4 ATAGAAGGGGGAAGTCGGA 41 SOX4 CATGCCAAACCCCTCCCCC 42 NEUROD1 TGAGGGGAGCGGTTGTCGG 43 INSM1 CGCCGGGCGGGGCGACCAG 44 KLF7 AGCGCGAGCGCAAGGGACA 45 SOX9 CTGGGTGACGAGGCGGGAG 46 SOX17 CAAGGCTACACCTGCCCCC 47 NEUROG1 TAGCCCGAGCCGACTCCCG 48 SP8 GCGCGCGCCGTGAGGTCAT 49 KLF4 CTCCCTTCCATCGTTGCTA 50 SMAD1 CCGGGCCGGGAATTTGGAG 51 OVOL1 CGACAGGTAACAAATAGGT 52 NR5A1 AATACCCCTATCTATCTGG 53 ATOH1 GCCTGCCCGCGCCCTCCAT 54 NEUROG2-1 GCAGCGAGGACGAAGGCGG 55 NEUROG2-2 GGAAAGGCGGTGAAGAAAG 56 SOX18 GCCTCAGCGGAATCCCGCC 57 ASCL1 GAGGAGGAGGGGGAGTTTA 58 ASCL1 AATGGAGAGTTTGCAAGGAG 59 (sublibrary) ATOH7 ACTAACACACCATCTGGAG 60 ATOH8 CGGGGCGGTTGTGCAGGAG 61 ATOH1-2 GGCTGAGAAGACACGCGAC 62 ATOH1-3 CACTCGGAGATCACACACC 63 ATOH1-4 CACGCGACCGGCGCGAGGA 64 ATOH1-5 TGCGGAGCCGGCTCTCGGC 65 NR5A1-2 AGAGAAACACCAACAAAGA 66 NR5A1-3 GGCCTGCAGAGTCACGTGG 67 NR5A1-4 TGCCCCCACGTGACTCTGC 68 NR5A1-5 GGGCCACCGGAGGCCCAAT 69 LHX6 AGGAGGAGGACTACCMGA 70 LHX8 CGGGGAACACCGGGCTAAA 71 E2F7 GCGCCAAGACTCCGAGGGG 72 RUNX3 CCTGCCGGAGGCCGCCCAA 73 FOXH1 CCACCCAAAGGCAACTCAG 74 SOX2 GGATACAAAGGTTTCTCAG 75 HMX2 AGGCCCTCGGCGCGCTCTG 76 NKX22 CCCTCTAGAGCAAGATGAG 77 ELMSAN1 GGCGTCCTTAAACCTCAGG 78 GCM2 ACAGTCCCAGGAACGGAGG 79 HES1 GTGGACCGCGCCCCCCCAT 80 HES7 CCCTCTAGGACCCGGCACG 81 TOX3 AGAAGAGGGGCCCCGGAGA 82 DMRT GGACCCTGCAGCAAAGCCC 83 BMP2 CCGCCCGCTCGGGGATCCC 84 ZFP36L1 CTTCCCTACCCGGCGCTTC 85 ERF GAGCGTGTGTGTGAGTGCGC 86 PRDM1 CGGCTGTGCTAGCAATCTGG 87 OL1G3 GAGCCCTCCTATCTATCCT 88 HIC1 GCTGTGCGCCGTGCCCGCCC 89 SOX3 CGGAGGACCCGTGATTGAC 90 FOXJ1 GCTCGGCTCATTCCCGCCCG 91 SOX10 CCCTGAGTGTTGGGGATGA 92 KLF6 TCCCGTGGCTCCCGGCCCGG 93 PLAGL2 GCCCCGGCCGCTCTAGCCCG 94 S. aureus TCATCAAGGAGCATTCCGT 95 Scrambled S. aureus ATGACAACAAGAACCCCGGA 96 ZFP36L1 S. aureus CCCTTCCCCGGGAGGTGTGG 97 HES3
[0138] In some embodiments, the gRNA targets a muscle-specific transcription factor. The muscle-specific transcription factor may be selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1. The gRNA may include a targeting domain that comprises a polynucleotide sequence corresponding to at least one of SEQ ID NOs: 98-104, as shown in TABLE 5, or a complement thereof or a variant thereof. The gRNA may target a polynucleotide comprising a sequence selected from SEQ ID NOs: 98-104, or a complement, a portion, or a variant thereof. The gRNA may be encoded by a polynucleotide comprising a sequence selected from SEQ ID NOs: 98-104, or a complement, a portion, or a variant thereof. The gRNA may comprise a polynucleotide sequence corresponding to (for example, a RNA version thereof) at least one of SEQ ID NOs: 98-104, or a complement, a portion, or a variant thereof.
TABLE-US-00002 TABLE 5 Exemplary gRNAs targeting muscle-specific transcription factors. Gene gRNA Target Sequence SEQ ID NO TWIST1 CGGCTAGGAGGCGGGTGGA 98 PAX3 CGGGCCAACCTTCTCTCCT 99 MYOD CGCGCACGCCAGTGTGGAG 100 MYOG GGGCCATGCGGGAGAAAGA 101 SOX9 GGAGGGGATCGCAGCCAAA 102 SOX10 GGAGGAGCCCTGAGTGTTG 103 DMRT1 GCAAGCAGCTGGAGAGCGG 104
[0139] A cell transformed or transcribed with the system as detailed herein may express at least one gRNA. The cells may each independently include one gRNA and target one putative transcription factor. The level of the at least one gRNA in a cell may be determined by any suitable means known in the art, such as, for example, deep sequencing. At least one gRNA may be enriched in a cell. For example, at least one gRNA may be enriched in a cell, the cell having high expression of a reporter protein. “Enriched” may refer to a statistically significant (p<0.05) increase in gRNA abundance in cells with high reporter gene expression. This may be calculated using the differential expression analysis package DESeq2 in R. The gRNA, or at least one gRNA in a cell, may increase the expression of the reporter protein in the cell by about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, or about 90% relative to a control. A control may be cell with a non-targeting gRNA. In some embodiments, the gRNA increases the expression of the reporter protein in the cell by about 2-50% relative to a non-targeting gRNA.
[0140] d. Genetic Constructs
[0141] The system for identifying a cell type-specific transcription factor, or for increasing expression of a cell type-specific gene, or one or more components thereof, may be encoded by or comprised within a genetic construct. Genetic constructs may include polynucleotides such as vectors and plasmids. The construct may be recombinant. In some embodiments, the genetic construct comprises a promoter that is operably linked to the polynucleotide encoding at least one gRNA molecule and/or a Cas molecule or fusion protein. In some embodiments, the genetic construct comprises a promoter that is operably linked to the polynucleotide encoding at least one gRNA molecule and/or a dCas molecule or fusion protein. In some embodiments, the genetic construct comprises a promoter that is operably linked to the polynucleotide encoding at least one gRNA molecule and/or a Cas9 molecule or fusion protein. In some embodiments, the promoter is operably linked to the polynucleotide encoding a gRNA molecule, reporter protein, neuronal marker, and/or a Cas9 molecule. In some embodiments, the promoter is operably linked to the polynucleotide encoding a first gRNA molecule, a second gRNA molecule, reporter protein, neuronal marker, and/or a Cas9 molecule. The genetic construct may be present in the cell as a functioning extrachromosomal molecule. The genetic construct may be a linear minichromosome including centromere, telomeres, or plasmids or cosmids. The genetic construct may be transformed or transduced into a cell. The genetic construct may be formulated into any suitable type of delivery vehicle including, for example, a viral vector, lentiviral expression, mRNA electroporation, and lipid-mediated transfection. Further provided herein is a cell transformed or transduced with a system or component thereof' as detailed herein. In some embodiments, the cell is a stem cell. The stem cell may be a human stem cell. In some embodiments, the cell is an embryonic stem cell. The stem cell may be a human pluripotent stem cell (iPSCs). Further provided are stem cell-derived neurons, such as neurons derived from iPSCs transformed or transduced with a DNA targeting system or component thereof as detailed herein.
[0142] Further provided herein is a viral delivery system. Viral delivery systems may include, for example, lentivirus, retrovirus, mRNA electroporation, or nanoparticles. In some embodiments, the vector is an adeno-associated virus (AAV) vector. The AAV vector is a small virus belonging to the genus Dependovirus of the Parvoviridae family that infects humans and some other primate species. AAV vectors may be used to deliver CRISPRICas9-based gene editing systems using various construct configurations. For example, AAV vectors may deliver Cas9 and gRNA expression cassettes on separate vectors or on the same vector. Alternatively, if the small Cas9 proteins, derived from species such as Staphylococcus aureus or Neisseria meningitidis, are used then both the Cas9 and up to two gRNA expression cassettes may be combined in a single AAV vector within the 4.7 kb packaging limit.
[0143] In some embodiments, the AAV vector is a modified AAV vector. The modified AAV vector may have enhanced cardiac and/or skeletal muscle tissue tropism. The modified AAV vector may be capable of delivering and expressing the CRISPR/Cas9-based gene editing system in the cell of a mammal. For example, the modified AAV vector may be an AAV-SASTG vector (Piacentino et al. Human Gene Therapy 2012, 23, 635-646). The modified AAV vector may be based on one or more of several capsid types, including AAV1, AAV2, AAV5, AAV6, AAV8, and AAV9. The modified AAV vector may be based on AAV2 pseudotype with alternative muscle-tropic AAV capsids, such as AAV2/1, AAV2i6, AAV2/7, AAV218, AAV2/9, AAV2.5, and AAV/SASTG vectors that efficiently transduce skeletal muscle or cardiac muscle by systemic and local delivery (Seto et al. Current Gene Therapy 2012, 12, 139-151). The modified AAV vector may be AAV2i8G9 (Shen et al. J. Biol. Chem. 2013, 288, 28814-28823).
4. SYSTEM FOR INCREASING NEURONAL-SPECIFIC TRANSCRIPTION OF A GENE
[0144] Provided herein is a system for increasing neuronal-specific transcription of a gene, or for increasing expression of a neuronal-specific gene. The system may include a first gRNA targeting a first neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof; and a Cas protein or a fusion protein, as detailed above. The system may include a first gRNA targeting a first neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof; a second gRNA targeting a second neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof; and a Cas protein ora fusion protein, as detailed above. In some embodiments, the second neuronal-specific transcription factor is a positive or activating transcription factor, and the second polypeptide domain of the fusion protein has transcription activation activity. In some embodiments, the second neuronal-specific transcription factor is a negative or repressing transcription factor, and the second polypeptide domain of the fusion protein has transcription repression activity.
5. SYSTEM FOR IDENTIFYING A CELL TYPE-SPECIFIC TRANSCRIPTION FACTOR
[0145] Provided herein are compositions and methods for selecting or identifying a cell type-specific transcription factor, such as, for example, a neuronal-specific transcription factor or a muscle-specific transcription factor or a chondrocyte-specific transcription factor. The system includes a polynucleotide encoding a reporter protein and a cell type marker; a Cas protein or fusion protein as detailed above; and a library of gRNAs that targets putative transcription factors. Further provided herein is a cell type-specific transcription factor, or a polynucleotide sequence encoding the cell type-specific transcription factor, or a polynucleotide sequence encoding a gRNA targeting the cell type-specific transcription factor, as selected or identified by the compositions and methods detailed herein.
[0146] a. Reporter Protein
[0147] The polynucleotide may encode a reporter protein. A reporter protein is encoded by a reporter gene and causes some determinable or detectable characteristic in a recombinant system simultaneously with the expression of another gene to indicate the expression of that other gene. The reporter protein is capable of generating a detectable signal. A variety of reporter proteins can be used, differing in the physical nature of signal transduction (e.g., fluorescence, electrochemical, nuclear magnetic resonance (NMR), and electron paramagnetic resonance (EPR)) and in the chemical nature of the reporter protein. In some embodiments, the signal from the reporter protein is a fluorescent signal.
[0148] In some embodiments, the reporter protein is a fluorescent protein. Fluorescent proteins include, for example, luciferase, enhanced blue fluorescent protein (EBFP), enhanced blue fluorescent protein-2 (EBFP2), mKATE, iRFP (infrared fluorescent protein), enhanced yellow fluorescent protein (EYFP), yellow fluorescent protein (YFP), Katushka, Ds-Red express, red fluorescent protein, red fluorescent protein turbo, TurboRFP, TagRFP, green fluorescent protein (GFP), blue fluorescent protein (BFP), cyan fluorescent protein(CFP), enhanced green fluorescent protein (EGFP), AcGFP, TurboGFP, Emerald, Azami Green, ZsGreen, Sapphire, T-Sapphire, enhanced cyan fluorescent protein (ECFP), mCFP, Cerulean, CyPet, AmCyanl, Midori-Ishi Cyan, mTFPI (Teal), Topaz, Venus, mCitrine, YPet, PhiYFP, ZsYellowI, mBanana, Kusabira Orange, mOrange, dTomato, dTomato-Tandem, DsRed, DsRed2, DsRed-Express (TI), DsRed-Monomer, mTangerine, mStrawberry, AsRed2, rnRFPI, JRed, rnCherry, HcRedI, mRaspberry, HcRedI, HcRed-Tandem, mPlum, and AQ143, or a combination thereof. In some embodiments, the reporter protein comprises mCherry. mCherry may comprise a polypeptide having an amino acid sequence of SEQ ID NO: 28 and may be encoded by a polynucleotide comprising SEQ ID NO: 29, In some embodiments, the reporter protein is any polypeptide that may be identified by irnmunohistochemistry or antibody staining
[0149] A cell transfected or transformed with the polynucleotide may express the reporter protein. The level of expression of the reporter protein, in a cell for example, may be determined. The level of expression of the reporter protein may be determined at various time points after transfection of the cell with the system detailed herein. For example, the level of expression of the reporter protein in a cell maybe determined after about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 days from transduction. In some embodiments, the level of expression of the reporter protein in a cell is determined after about 4 days from transduction. Fluorescent proteins can be assayed by any suitable means known in the art, for example, by FACS or flow cytometry or fluorescence microscopy. In some embodiments, a cell transfected or transformed with the polynucleotide has a high expression of the reporter protein relative to a control. The control may be another cell or cells transfected or transformed with a polynucleotide including a different gRNA. “High expression” of the reporter protein may be defined as being in the top 5% expression levels among the population of cells.
[0150] b. Cell Type Marker
[0151] The polynucleotide may encode a marker indicating expression in a certain cell type or state or stage. For example, the polynucleotide may encode a neuronal marker. A neuronal marker is a gene that is expressed only in or predominantly in neuronal cells. The neuronal marker may be a subtype-specific marker that is only expressed in certain subtypes of neurons. The neuronal marker may be a pan-neuronal marker. A pan-neuronal marker is a gene that is expressed only in or predominantly in neuronal cells and in most of the neuronal cells. The pan-neuronal marker may also be referred to as a neuronal lineage marker. The neuronal marker may be expressed at any point in neurogenesis and in cells that have differentiated into a neuron. Neuronal markers may be selected from, for example, TUBB3, NEUROD1, NEUROG1, NEUROG2, ASCU, SYN1, NCAM, and MAP2. In some embodiments, the pan-neuronal marker is TUBB3. TUBB3 is a gene that encodes the polypeptide beta-3-tubulin (also referred to as beta-tubulin III), which is a microtubule element of the tubulin family found almost exclusively in neurons. In some embodiments, the cell-type specific transcription factor is a neuronal-specific transcription factor, the cell type marker is a neuronal marker, and the neuronal marker comprises TUBB3.
[0152] In other embodiments, the cell type marker is a muscle or myogenic marker. A muscle or rnyogenic marker is a gene that is expressed only in or predominantly in muscle cells. The muscle or myogenic marker may be a subtype-specific marker that is only expressed in certain subtypes of muscle cells. The muscle or rnyogenic marker may be a pan-muscle or pan-myogenic marker. A pan-muscle or pan-myogenic marker is a gene that is expressed only in or predominantly in muscle cells and in most of the muscle cells. The myogenic marker may comprise PAX7. In some embodiments, the cell-type specific transcription factor is a muscle-specific transcription factor, the cell type marker is a myogenic marker, and the myogenic marker comprises PAX7.
[0153] In other embodiments, the cell type marker is a collagen marker. A collagen marker is a gene that is expressed only in or predominantly in chondrocytes. The collagen marker may be a subtype-specific marker that is only expressed in certain subtypes of chondrocytes. The collagen marker may be a pan-collagen marker. A pan-collagen marker is a gene that is expressed only in or predominantly in chondrocytes and in most of the chondrocytes. The collagen marker may comprise COL2A1. In some embodiments, the cell-type specific transcription factor is a chondrocyte-specific transcription factor, the cell type marker is a collagen marker, and the collagen marker comprises COL2A1.
[0154] The polynucleotide encoding the reporter protein may be operably linked to a polynucleotide encoding a cell type marker, as detailed below. The polynucleotide encoding the reporter protein may be in the same reading frame as the polynucleotide encoding the cell type marker. As such, the reporter protein may serve as an expression or translational reporter of the cell type marker.
[0155] A cell transfected or transformed with the polynucleotide may express the cell type marker. The level of expression of the cell type marker, in a cell for example, may be determined. The level of expression of the cell type marker may be determined at various time points after transfection of the cell with the system detailed herein. For example, the level of expression of the cell type marker in a cell maybe determined after about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 days from transduction. Cell type markers can be assayed by any suitable means known in the art, for example, by immunohistochemistry, qRT-PCR, and RNA sequencing.
[0156] c. Library of gRNAs
[0157] The system for selecting or identifying a transcription factor may further include a library of gRNAs. The library of gRNAs may target putative transcription factors. For example, a gRNA may target the promoter of a gene encoding a transcription factor. Each gRNA may be different. The library of gRNAs may include a plurality of gRNAs, each gRNA targeting a putative transcription factor. In some embodiments, each gRNA targets a different putative transcription factor. Some gRNAs may target the same putative transcription factor, with each gRNA targeting a different portion of the gene encoding the transcription factor. In some embodiments, the different portions may overlap. In some embodiments, the gRNA library may include 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 gRNAs for each transcription start site of a transcription factor. The gRNA library may include at least about 1000, at least about 2000, at least about 3000, at least about 4000, at least about 5000, at least about 6000, at least about 7000, at least about 8000, or at least about 9000 gRNAs.
6. PHARMACEUTICAL COMPOSITIONS
[0158] Further provided herein are pharmaceutical compositions comprising the above-described genetic constructs or systems. The systems, or at least one component thereof, as detailed herein may be formulated into pharmaceutical compositions in accordance with standard techniques well known to those skilled in the pharmaceutical art. The pharmaceutical compositions can be formulated according to the mode of administration to be used. In cases where pharmaceutical compositions are injectable pharmaceutical compositions, they are sterile, pyrogen free, and particulate free. An isotonic formulation is preferably used. Generally, additives for isotonicity may include sodium chloride, dextrose, mannitol, sorbitol and lactose. In some cases, isotonic solutions such as phosphate buffered saline are preferred. Stabilizer's include gelatin and albumin. In some embodiments, a vasoconstriction agent is added to the formulation.
[0159] The composition may further comprise a pharmaceutically acceptable excipient. The pharmaceutically acceptable excipient may be functional molecules as vehicles, adjuvants, carriers, or diluents. The term “pharmaceutically acceptable carrier,” may be a non-toxic, inert solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type. Pharmaceutically acceptable carriers include, for example, diluents, lubricants, binders, disintegrants, colorants, flavors, sweeteners, antioxidants, preservatives, glidants, solvents, suspending agents, wetting agents, surfactants, emollients, propellants, humectants, powder's, pH adjusting agents, and combinations thereof. The pharmaceutically acceptable excipient may be a transfection facilitating agent, which may include surface active agents, such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs, vesicles such as squalene and squalene, hyaluronic acid, lipids, liposomes, calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents.
[0160] The transfection facilitating agent may be a polyanion, polycation, including poly-L-glutamate (LGS), or lipid. The transfection facilitating agent is poly-L-glutamate, and more preferably, the poly-L-glutamate is present in the composition for genome editing in skeletal muscle or cardiac muscle at a concentration less than 6 mg/mL. The transfection facilitating agent may also include surface active agents such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs and vesicles such as squalene and squalene, and hyaluronic acid may also be used administered in conjunction with the genetic construct. In some embodiments, the DNA vector encoding the composition may also include a transfection facilitating agent such as lipids, liposomes, including lecithin liposomes or other liposomes known in the art, as a DNA-liposome mixture (see for example International Patent Publication No. W09324640), calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents. In some embodiments, the transfection facilitating agent is a polyanion, polycation, including poly-L-glutamate (LGS), or lipid.
7. ADMINISTRATION
[0161] The systems, or at least one component thereof, as detailed herein, or the pharmaceutical compositions comprising the same, may be administered to a subject. Such compositions can be administered in dosages and by techniques well known to those skilled in the medical arts taking into consideration such factors as the age, sex, weight, and condition of the particular subject, and the route of administration. The presently disclosed systems, or at least one component thereof, genetic constructs, or compositions comprising the same, may be administered to a subject by different routes including orally, parenterally, sublingually, transdermally, rectally, transmucosally, topically, intranasal, intravaginal, via inhalation, via buccal administration, intrapleurally, intravenous, intraarterial, intraperitoneal, subcutaneous, intradermally, epidermally, intramuscular, intranasal, intrathecal, intracranial, and intraarticular or combinations thereof. In certain embodiments, the system, genetic construct, or composition comprising the same, is administered to a subject intramuscularly, intravenously, or a combination thereof. For veterinary use, the DNA targeting systems, genetic constructs, or compositions comprising the same may be administered as a suitably acceptable formulation in accordance with normal veterinary practice. The veterinarian may readily determine the dosing regimen and route of administration that is most appropriate for a particular animal. The systems, genetic constructs, or compositions comprising the same may be administered by traditional syringes, needleless injection devices, “microprojectile bombardment gone guns,” or other physical methods such as electroporation (“EP”), “hydrodynamic method”, or ultrasound.
[0162] The systems, genetic constructs, or compositions comprising the same may be delivered to a subject by several technologies including DNA injection (also referred to as DNA vaccination) with and without in vivo electroporation, liposome mediated, nanoparticle facilitated, recombinant vectors such as recombinant lentivirus, recombinant adenovirus, and recombinant adenovirus associated virus. The composition may be injected into the brain or other component of the central nervous system.
8. METHODS
[0163] a. Methods of increasing Neuronal Maturation of a Stem Cell
[0164] Provided herein are methods of increasing neuronal maturation of a stem cell, or methods of increasing maturation of a stern cell-derived neuron. The method may include (a) increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; or (b) increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof, and increasing in the stem cell the level of a second neuronal-specific transcription factor, wherein the second neuronal-specific transcription factor is an activating or positive neuronal-specific transcription factor, In other embodiments, the method may include increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and decreasing in the stem cell the level of a second neuronal-specific transcription factor, wherein the second neuronal-specific transcription factor is a repressing or negative neuronal-specific transcription factor.
[0165] In some embodiments, increasing the level of the first neuronal-specific transcription factor comprises at least one of: (a) administering to a stern cell a polynucleotide encoding the first neuronal-specific transcription factor; (b) administering to a stem cell a polypeptide comprising the first neuronal-specific transcription factor; and (c) administering to a stem cell a gRNA targeting the first neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof, and a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a DNA binding protein such as a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has transcription activation activity.
[0166] In some embodiments, increasing the level of the second neuronal-specific transcription factor comprises at least one of: (a) administering to a stern cell a polynucleotide encoding the second neuronal-specific transcription factor; (b) administering to a stem cell a polypeptide comprising the second neuronal-specific transcription factor; and (c) administering to a stem cell a gRNA targeting the second neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof, and a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a DNA binding protein such as a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has transcription activation activity.
[0167] In some embodiments,decreasing the level of the second neuronal-specific transcription factor comprises administering to a stem cell a gRNA targeting the second neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof, and a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a DNA binding protein such as a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has transcription repression activity.
[0168] b. Methods of Increasing the Conversion of a Stem Cell to a Neuron
[0169] Provided herein are methods of increasing the conversion of a stem cell to a neuron. The method may include (a) increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SF8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; or (b) increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof, and increasing in the stem cell the level of a second neuronal-specific transcription factor, wherein the second neuronal-specific transcription factor is an activating or positive neuronal-specific transcription factor. In other embodiments, the method may include increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and decreasing in the stem cell the level of a second neuronal-specific transcription factor, wherein the second neuronal-specific transcription factor is a repressing or negative neuronal-specific transcription factor.
[0170] In some embodiments, increasing the level of the first neuronal-specific transcription factor comprises at least one of; (a) administering to a stem cell a polynucleotide encoding the first neuronal-specific transcription factor; (b) administering to a stem cell a polypeptide comprising the first neuronal-specific transcription factor; and (c) administering to a stem cell a gRNA targeting the first neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof, and a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a DNA binding protein such as a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has transcription activation activity.
[0171] In some embodiments, increasing the level of the second neuronal-specific transcription factor comprises at least one of: (a) administering to a stem cell a polynucleotide encoding the second neuronal-specific transcription factor; (b) administering to a stem cell a polypeptide comprising the second neuronal-specific transcription factor; and (c) administering to a stem cell a gRNA targeting the second neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof, and a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a DNA binding protein such as a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has transcription activation activity.
[0172] In some embodiments,decreasing the level of the second neuronal-specific transcription factor comprises administering to a stem cell a gRNA targeting the second neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof and a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a DNA binding protein such as a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has transcription repression activity.
[0173] c. Methods of Treating a Subject
[0174] Provided herein are methods of treating a subject in need thereof. The method may include (a) increasing in the stern cell the level of a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SPB, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; or (b) increasing in the stem cell in the subject the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof, and increasing in the stem cell in the subject the level of a second neuronal-specific transcription factor, wherein the second neuronal-specific transcription factor is an activating or positive neuronal-specific transcription factor. In other embodiments, the method may include increasing in the stem cell in the subject the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and decreasing in the stem cell in the subject the level of a second neuronal-specific transcription factor, wherein the second neuronal-specific transcription factor is a repressing or negative neuronal-specific transcription factor.
[0175] In some embodiments, increasing the level of the first neuronal-specific transcription factor comprises at least one of: (a) administering to a stem cell a polynucleotide encoding the first neuronal-specific transcription factor; (b) administering to a stem cell a polypeptide comprising the first neuronal-specific transcription factor; and (c) administering to a stem cell a gRNA targeting the first neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof, and a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a DNA binding protein such as a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has transcription activation activity.
[0176] In some embodiments, increasing the level of the second neuronal-specific transcription factor comprises at least one of: (a) administering to a stem cell a polynucleotide encoding the second neuronal-specific transcription factor; (b) administering to a stern cell a polypeptide comprising the second neuronal-specific transcription factor; and (c) administering to a stern cell a gRNA targeting the second neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof, and a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a DNA binding protein such as a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has transcription activation activity.
[0177] In some embodiments,decreasing the level of the second neuronal-specific transcription factor comprises administering to a stem cell a gRNA targeting the second neuronal-specific transcription factor, regulatory region, promoter region, or portion thereof, and a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a DNA binding protein such as a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has transcription repression activity.
[0178] d. Methods of Screening for a Neuronal-Specific Transcription Factor
[0179] Provided herein are methods of screening for a neuronal-specific transcription factor. The method may include transducing a population of cells with the system of any one of claims 1-3 at a multiplicity of infection (MOI) of about 0.2, such that a majority of the cells each independently includes one gRNA and targets one putative transcription factor; determining a level of expression of the reporter protein in each cell; determining a level of the gRNA in each cell having a high expression of the reporter protein, wherein high expression of the reporter protein is defined as being in the top 5% among the population of cells; and selecting the putative transcription factor as a neuronal-specific transcription factor when the putative transcription factor corresponds to at least two gRNAs enriched in the cell having a high expression of the reporter protein. “Enriched” may be a statistically significant (p<0,05) increase in gRNA abundance in cells with high reporter gene expression.
[0180] In some embodiments, the level of expression of the reporter protein in each cell is determined after about four days from transduction. In some embodiments, the level of expression of the reporter protein in each cell is determined by flow cytometry. In some embodiments, the level of the gRNA in each cell having a high expression of the reporter protein is determined by deep sequencing. In some embodiments, the gRNA increases the expression of the reporter protein in the cell by about 2-50% relative to a non-targeting gRNA.
[0181] e. Methods of Screening for a Pair of Neuronal-Specific Transcription Factors
[0182] Provided herein are methods of screening for a pair of neuronal-specific transcription factors. The methods may include transducing a population of cells with the system of any one of claims 1-3 at a multiplicity of infection (MOI) of about 0.2, such that a majority of the cells each independently includes two gRNAs and targets two putative transcription factors; determining a level of expression of the reporter protein in each cell; determining a level of the two gRNAs in each cell having a high expression of the reporter protein, wherein high expression of the reporter protein is defined as being in the top 5% among the population of cells; and selecting the two putative transcription factors as a pair of neuronal-specific transcription factors when the putative transcription factors correspond to at least two gRNAs enriched in the cell having a high expression of the reporter protein.
[0183] In some embodiments, the level of expression of the reporter protein in each cell is determined after about four days from transduction. In some embodiments, the level of expression of the reporter protein in each cell is determined by flow cytometry. In some embodiments, the level of the gRNA in each cell having a high expression of the reporter protein is determined by deep sequencing. In some embodiments, the gRNA increases the expression of the reporter protein in the cell by about 2-50% relative to a non-targeting gRNA.
9. EXAMPLES
Example 1
Materials and Methods
[0184] Construction of a TUBB3-2A-mCherry pluripotent stem cell line. A human iPS cell line (RVR-iPSCs) was used to construct the TUBB3-2A-mCherry reporter line. RVR-iPSCs were retrovirally reprogrammed from BJ fibroblasts and characterized as previously done (Lee et al. Cell 2012, 51, 547-558). To generate the TUBB3-2A-mCherry reporter line, 3×10.sup.6 cells were dissociated with Accutase (Stemcell Tech, 7920) and electroporated with 6 μg of gRNA-Cas9 expression vector and 3 μg of TUBB3 targeting vector using the P3 Primary Cell 4D-Nucleofector Kit (Lonza, V4XP-3032). Transfected cells were plated into a 10 cm dish coated with Matrigel (Corning, 354230) in compete mTesR (Stemcell Tech, 85850) supplemented with 10 μM Rock Inhibitor (Y-27632, Stemcell Tech, 72304). 24 hours after transfection, positive selection began with 1 μg/mL puromycin for 7 days. Following selection, cells were transfected with a CMV-CRE recombinase expression vector to remove the foxed puromycin selection cassette. Transfected cells were expanded and plated at low density for clonal isolation (180 cells/cm.sup.2). Resulting clones were mechanically picked and expanded and gDNA was extracted using QuickExtract DNA Extraction Solution (Lucigen, QE09050) for PCR screening of targeting vector integration. A second round of clonal isolation was performed using the same protocol following lentiviral transduction of .sup.VP64dCas9.sup.VP54.
[0185] Plasmid construction. The lentiviral .sup.VP64dCas9.sup.VP64 plasmid was generated by modifying Addgene plasmid #59791 to replace GFP with the BSD blasticidin resistance gene. The lentiviral dSaCas9.sup.KRAB plasmid was generated by modifying Addgene plasmid #106249 to insert a S. aureus gRNA cassette with a ZFP36L1. HES3 or scrambled non-targeting gRNA. The gRNA expression plasmid for the single CAS-TF screen was generated by modifying Addgene plasmid #83925 to contain an optimized gRNA scaffold (Chen et al, Cell 2013, 155, 1479-149) and a puromycin resistance gene in place of Bsr. The gRNA expression plasmids for the paired CAS-TF screens were generated by further modification of the single gRNA expression plasmid to contain an additional gRNA cassette expressing either sgNGN3 or sgASCL1 under control of the mU6 Pol III promoter with a modified gRNA scaffold described previously (Adamson et al. Cell 2016, 167, 1867-1882 e1821). Individual gRNAs were ordered as oligonucleotides (Integrated DNA Technologies), phosphorylated, hybridized, and cloned into the gRNA expression plasmids using BsmBI sites. Protospacers used for individual gRNA cloning are listed in TABLE 3, above.
[0186] The TUBB3 targeting vector was cloned by inserting ˜700 bp homology arms (surrounding the TUBB3 stop codon), amplified by PCR from genomic DNA of RVR-iPS cells, surrounding a P2A-mCherry sequence with a floxed puromycin resistance cassette.
[0187] cDNAs encoding TFs were either PCR amplified from cDNA pools or synthesized as gBlocks (Integrative DNA Technologies) and cloned into Addgene plasmid #52047 using EcoRI and XbaI restriction sites. TetO gene expression was achieved by co-delivery of M2rtTA (Addgene #20342).
[0188] Lentiviral production and titration. HEK293T cells were acquired from the American Tissue Collection Center (ATCC) and purchased through the Duke University Cell Culture Facility, The cells were maintained in DMEM High Glucose supplemented with 10% FBS and 1% penicillin-streptomycin and cultured at 37° C. with 5% CO2. For lentiviral production of the gRNA libraries, .sup.VP64dCas9.sup.VP64 and dSaCas9.sup.KRAB, 4.5×10.sup.6 cells were transfected using the calcium phosphate precipitation method (Salmon and Trono, 2007 Curr. Proloc. Hum. Genet. Chapter 12, Unit 12 10) with 6 μg pMD2.G (Addgene #12259), 15 μg psPAX2 (Addgene #12260), and 20 μg of the transfer vector. The medium was exchanged 12-14 hours after transfection, and the viral supernatant was harvested 24 and 48 hours after this medium change, The viral supernatant was pooled and centrifuged at 600 g for 10 min, passed through a PVDF 0.45 μm filter (Millipore, SLHV033RB) and concentrated to 50× in 1× PBS using Lenti-X Concentrator (Clontech, 631232) in accordance with the manufacturer's protocol.
[0189] To produce lentivirus for gRNA and cDNA validations, 0.4×10.sup.6 cells were transfected using Lipofectamine 3000 (Invitrogen, L3000008) according to the manufacturer's instructions with 200 ng pMD2.G, 600 ng psPAX2, and 200 ng of the transfer vector. The medium was exchanged 12-14 hours after transfection, and the viral supernatant was harvested 24 and 48 hours after this medium change. The viral supernatant was pooled and centrifuged at 600 g for 10 min and concentrated to 50× in 1× PBS using Lenti-X Concentrator (Clontech, 631232) in accordance with the manufacturer's protocol.
[0190] The titer of the lentiviral gRNA library pools for the single or paired CAS-TF libraries was determined by transducing 6×10.sup.4 cells with serial dilutions of lentivirus and measuring the percent GFP expression 4 days after transduction with an Accuri C6 flow cytometer (BD). All lentiviral titrations were performed in the TUBB3-2A-mCherry cell line used in the CAS-TF single and paired gRNA screens.
[0191] CAS-TF gRNA library design and cloning. Putative TFs were selected from a previous catalog of human transcription factors (Vaquerizas et al. Nat. Rev. Genet 2009, 10, 252-263). A gRNA library consisting of 5 gRNAs per TSS targeting 1,496 TFs was extracted from a previous genorne-wide CRISPRa library (Horlbeck, 2016 Compact and highly active next-generation libraries. eLife). The library included a set of 100 scrambled non-targeting gRNAs extracted from the same genome-wide library for a total of 8,505 gRNAs. The oligonucleotide pool (Custom Array) was PCR amplified and cloned using Gibson assembly into the single gRNA expression plasmid for the single CAS-TF screen or the dual gRNA expression plasmid for the paired CAS-TF screens with sgASCL1 or sgNGN3.
[0192] The sub-library was designed by extracting additional gRNAs from several previously published CRISPRa genome-wide libraries (Gilbert et al. Cell 2014, 159, 647-66; Horlbeck, 2016 Compact and highly active next-generation libraries, eLife; Konermann et al. Nature 2015, 517, 583-588; Sanson et al. Nat. Commun, 2018, 9, 5416) to obtain an average of 33 gRNAs per gene targeting 109 TFs. The library included a set of 300 scrambled non-targeting gRNAs for a total of 3,874 gRNAs. The oligonucleotide pool (Twist Bioscience) was PCR amplified and cloned into the single gRNA expression plasmid as done with the original CAS-TF library.
[0193] Single and paired CAS-TF neuronal differentiation screens. Each CAS-TF screen was performed in triplicate with independent transductions. For each replicate, 24×10.sup.6 TUBB3-2A-mCherry .sup.VP64dCas9.sup.VP64iPSCs were dissociated using Accutase (Stemcell Tech, 7920) and transduced in suspension across five matrigel-coated 15-cm dishes in mTesR (Stemcell Tech 85850) supplemented with 10 μM Rock Inhibitor (Y-27632, Stemcell Tech, 72304). Cells were transduced at a MOI of 0.2 to obtain one gRNA per cell and ˜550-fold coverage of the CAS-TF gRNA library. The medium was changed to fresh mTesR without Rock Inhibitor 18-20 hours after transduction. Antibiotic selection was started 30 hours after transduction by adding 1 μg/mL puromycin (Sigma, P8833) directly to the plates without changing the medium. 48 hours after transduction the medium was changed to neurogenic medium (DMEM/F-12 Nutrient Mix (Gibco, 11320), 1× B-27 serum-free supplement (Gibco, 17504), 1× N-2 supplement (Gibco, 17502), and 25 μg/mL gentamicin (Sigma, G1397) supplemented with 1 μg/mL puromycin for the remainder of the experiment with daily medium changes.
[0194] Cells were harvested for sorting 5 days after transduction of the gRNA library for the single factor CAS-TF screen and the sgASCL1 paired screen. Cells were harvested 4 days after transduction for the sgNGN3 paired screen. Cells were washed once with 1× PBS, dissociated using Accutase, filtered through a 30 μm CellTrics filter (Sysmex, 04-004-2326) and resuspended in FACS Buffer (0.5% BSA (Sigma, A7906), 2 mM EDTA (Sigma, E7889) in PBS). Before sorting, an aliquot of 4.8×10.sup.6 cells was taken to represent a bulk unsorted population. The highest and lowest 5% of cells were sorted based on mCherry expression and 4.8×10.sup.6 cells were sorted into each bin. Sorting was done with a SH800 FACS Cell Sorter (Sony Biotechnology). After sorting, genomic DNA was harvested with the DNeasy Blood and Tissue Kit (Qiagen, 69506).
[0195] Sub-library screen. The CAS-TF sub-library screen was performed in triplicate with independent transductions. For each replicate, 9.6×10.sup.6 TUBB3-2A-mCherry .sup.VP64dCas9.sup.VP64iPSCs were dissociated using Accutase (Stemcell Tech, 7920) and transduced in suspension across two matrigel-coated 15-cm dishes in mTesR (Stemcell Tech 85850) supplemented with 10 μM Rock Inhibitor (Y-27632, Stemcell Tech, 72304). Cells were transduced at a MOI of 0.2 to obtain one gRNA per cell and ˜495-fold coverage of the CAS-TF gRNA sub-library. The medium was changed to fresh mTesR without Rock Inhibitor 18-20 hours after transduction. Antibiotic selection was started 30 hours after transduction by adding 1 μg/mL purornycin (Sigma, P8833) directly to the plates without changing the medium. 48 hours after transduction the medium was changed to neurogenic medium (DMEM/F-12 Nutrient Mix (Gibco, 11320), 1× B-27 serum-free supplement (Gibco, 17504), 1× N-2 supplement (Gibco, 17502), and 25 μg/mL gentamicin (Sigma, G1397)) supplemented with 1 μg/mL puromycin for the remainder of the experiment with daily medium changes.
[0196] Cells were harvested for sorting 5 days after transduction of the gRNA library. Cells were washed once with 1× PBS, dissociated using Accutase, filtered through a 30 μm CellTrics filter (Sysmex, 04-004-2326) and resuspended in FACS Buffer (0.5% BSA (Sigma, A7906), 2 mM EDTA (Sigma, E7889) in PBS). Before sorting, an aliquot of 2×10.sup.6 cells was taken to represent a bulk unsorted population. The highest and lowest 5% of cells were sorted based on mCherry expression and 2×10.sup.6 cells were sorted into each bin. Sorting was done with a SH800 FACS Cell Sorter (Sony Biotechnology). After sorting, genomic DNA was harvested with the DNeasy Blood and Tissue Kit (Qiagen, 69506).
[0197] gRNA library sequencing. The gRNA libraries were amplified from each genomic DNA sample across 100 μL PCR reactions using Q5 hot start polymerase (NEB, M0493) with 1 μg of genomic DNA per reaction. The PCR amplification was done according to the manufacturer's instructions, using 25 cycles at an annealing temperature of 60° C. with the following primers:
TABLE-US-00003 Fwd: 5′-AATGATACGGCGACCACCGAGATCTACACAATTTCTTGGGTAGTTT GCAGTT Rev: 5′-CAAGCAGAAGACGGCATACGAGAT-(6-bp index sequence)- GACTCGGTGCCACTTTTTCAA
[0198] The amplified libraries were purified with Agencourt AMPure XP beads (Beckman Coulter, A63881) using double size selection of 0.65× and then 1× the original volume to purify the 282 by amplicon. Each sample was quantified after purification with the Qubit dsDNA High Sensitivity assay kit (Thermo Fisher, Q32854). Samples were pooled and sequenced on a MiSeq (Illumina) with 20-bp paired-end sequencing using the following custom read and index primers:
TABLE-US-00004 Read1: (SEQ ID NO: 32) 5′-GATTTCTTGGCTTTATATATCTTGTGGAAAGGACGAAACACCG. Index: (SEQ ID NO: 33) 5′-GCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTC. Read2: (SEQ ID NO: 34) 5′-GTTGATAACGGACTAGCCTTATTTAAACTTGCTATGCTGTTTCCAG CATAGCTCTTAAAC.
[0199] Data processing and enrichment analysis. FASTQ files were aligned to custom indexes of the 8,505 protospacers (generated from the bowtie2-build function) using Bowtie 2 (Langmead and Salzberg Nat. Methods 2012, 9, 357-359). Counts for each gRNA were extracted and used for further analysis. All enrichment analysis was done with R. Individual gRNA enrichment was determined using the DESeq2 (Love et al. Genome Biol. 2014, 15, 550) package to compare gRNA abundance between high and low, unsorted and low, or unsorted and high conditions for each screen. TFs were selected as hits if two or more gRNAs were significantly enriched (FDR<0.01) in the mCherry-high cell bin relative to both the unsorted and the mCherry-low cell bins.
[0200] In vivo expression comparison. RNA-sequencing data generated as part of the Brainspan Developmental Transcriptome Atlas was downloaded (Miller et al. Nature 2014, 508, 199-206). The average expression for the 17 TFs identified in the single-factor CAS-TF screen was calculated for each developmental time point and anatomical region listed between 8 and 13 post conception weeks. A random set of 17 TFs was identically analyzed, and a representative comparison is shown in
[0201] gRNA and cDNA validations. The top enriched gRNAs from the screens were cloned into the appropriate gRNA expression vector as described previously. The gRNA validations were performed similarly as done with the screens, except the transductions were performed in 24-well plates and the virus was delivered at high MOI. Cells were harvested for flow cytometry or qRT-PCR 4 days after gRNA transduction.
[0202] For immunofluorescence staining experiments, the cDNAs encoding the top enriched TFs were PCR amplified and cloned into a doxycycline inducible expression vector as described previously. Cells were co-transduced in suspension with the indicated TFs along with a separate lentivirus encoding the M2rtTA (Addgene #20342) in mTesR supplemented with 10 pM Rock Inhibitor. Unmodified iPSCs were used for these experiments to enable staining with red fluorophores without interference from the mCherry reporter. 18-20 hours after transduction, the medium was changed to neurogenic medium supplemented with 0.1 μg/mL doxycycline (Sigma, D9891). Staining was done 4 days after transduction as described previously. For a subset of the TFs, the TUBB3-2A-mCherry cell line was used to sort off the highest mCherry expressing cells 3 days after transduction. The cells were replated onto a pre-established monolayer of human astrocytes (Lonza, CC-2565) and cultured for an additional 8 days in neurogenic medium before staining, gRNA and cDNA validations in H9 human embryonic stem cells were performed similarly to those described for iPSCs. A polyclonal .sup.VP64dCas9.sup.VP64H9 ESC line was established via lentiviral transductions, and gRNAs were delivered with a separate lentivirus.
[0203] Quantitative RT-PCR. Cells were dissociated with Accutase (StemCell Tech, 7920) and centrifuged at 300 g for 5 min. Total RNA was isolated using RNeasy Plus (Qiagen, 74136) and QIAshredder kits (Qiagen, 79656). Reverse transcription was carried out on 0.1 μg total RNA per sample in a 10 μL reaction using the SuperScript VILO Reverse Transcription Kit (Invitrogen, 11754). 1.0 μL of cDNA was used per PCR reaction with Perfecta SYBR Green Fastmix (Quanta BioSciences, 95072) using the CFX96 Real-Time PCR Detection System (Bio-Rad). The amplification efficiencies over the appropriate dynamic range of all primers were optimized using dilutions of purified amplicon. All amplicon products were verified by gel electrophoresis and melting curve analysis. All qRT-PCR results are presented as fold change in RNA normalized to GAPDH expression. Primers used in this study can be found in TABLE 4.
TABLE-US-00005 TABLE 4 All qRT-PCR primers used in this study. Gene Primer Sequence SEQ ID NO NCAM Fwd AACCCAGTGCACCTAAGCTC 105 NCAM Rev GGACTTCAGCATGACGTGGT 106 MAP2 Fwd CAGCTTGTCTCTAACCGAGGA 107 MAP2 Rev TGTGTCGTGTTCTCAAAGGGT 108 TUBB3 Fwd TTTGGACATCTCTTCAGGCC 109 TUBB3 Rev TTTCACACTCCTTCCGCAC 110 ZFP36L1 Fwd CCGAGTCCCCTCACATGTTT 111 ZFP36L1 Rev TTGAGTTGTCCAAGGTCGGG 112 HES3 Fwd GAAAGTCTCCCTGGCTCGTC 113 HES3 Rev CCAAATAGGGAGCGCCTTCA 114 NEUROG3 Fwd TTTTCTCCTTTGGGGCTGGG 115 NEUROG3 Rev AGGCGTCATCCTTTCTACCG 116 RFX4 Fwd GACGAGCGGCCATTCATCAG 117 RFX4 Rev CACTCAGTAATCCAGCCGGG 118 SOX4 Fwd AACAGGGCGGCTGGTTAATA 119 SOX4 Rev ACACTGGTGGCAGGTTAAGG 120 NEUROD1 Fwd GATGACTAAGGCTCGCCTGG 121 NEUROD1 Rev AGAATAGCAAGGCACCACCT 122 INSM1 Fwd TACGCGTTTGTCTCGTGGTT 123 INSM1 Rev CAGAGATTGGTAGGCGAGGC 124 KLF7 Fwd TTGCATTAGGAGCGAACAGC 125 KLF7 Rev AAAAGGGGACTTCTCCACGG 126 SOX9 Fwd TAAAACGGTGCTGCTGGGAA 127 SOX9 Rev AGTGTGCTCGGGCACTTATT 128 SOX17 Fwd GACATGAAGGTGAAGGGCGA 129 SOX17 Rev CGTTGTGCAGGTCTGGATTC 130 NEUROG1 Fwd AATATCTCCCGGGCGTCTGA 131 NEUROG1 Rev GTTCAAGTTGTGCATGCGGT 132 SP8 Fwd CTTCTAGGGGAAGAACCGAGG 133 SP8 Rev AAGAGGACGAGGAGCGTTTC 134 KLF4 Fwd CACCGGACCTACTTACTCGC 135 KLF4 Rev AACCCCAAATTGGCCGAGAT 136 SMAD1 Fwd GGAGAAAGGAGAGGCCGAGC 137 SMAD1 Rev AAAAGTAACCCAGTCAGCACCG 138 OVOL1 Fwd GTCCGGCTCGCACTTTAAGA 139 OVOL1 Rev CTGAGAACGAGGTCCCTTGC 140 NR5A1 Fwd GTGGTGTGAGGGGGTTTCTG 141 NR5A1 Rev TACGAATAGTCCATGCCCGC 142 ATOH1 Fwd AGGATGCATGGGCTGAACC 143 ATOH1 Rev TTGTAGCAGCTCGGACAAGG 144 NEUROG2 Fwd CAGGCCAAAGTCACAGCAAC 145 NEUROG2 Rev CGATCCGAGCAGCACTAACA 146 SOX18 Fwd GCAAAGGACGAGCGCAAG 147 SOX18 Rev CTTGTAGTTGGGGTGGTCGC 148 SOX11 Fwd AGCGGAGGAGGTTTTCAGTG 149 SOX11 Rev TTCCATTCGGTCTCGCCAAA 150
[0204] Immunofluorescence staining. Cells were washed briefly with PBS and then fixed with 4% paraformaldehyde (Santa Cruz, sc-281692) for 20 minutes at room temperature. Cells were washed twice with PBS and then incubated with blocking buffer (10% goat serum (Sigma, G6767), 2% BSA (Sigma, A7906) in PBS) for 30 min at room temperature. Cells were permeabilized with 0.2% Triton-X 100 (Sigma, T8787) for 10 min at room temperature. The following primary antibodies were used with incubations for 2 hours at room temperature: Mouse anti-TUBB3 (1:1000 dilution, BioLegend, 801201); Rabbit anti-MAP2 (1:500 dilution, Sigma, AB5622). Cells were washed three times with PBS and then incubated with secondary antibody and DAPI (Invitrogen, D3571) in blocking solution for 1 hour at room temperature. The following secondary antibodies were used: Alexa Fluor 488 goat anti-mouse (1:500 dilution, Invitrogen, A-11001); Alexa Fluor 594 goat anti-rabbit (1:500 dilution, Invitrogen, A-11012). Cells were washed three times with PBS and imaged with a Zeiss 780 upright confocal microscope.
[0205] For NCAM staining of live cells for gRNA validations, cells were dissociated with Accutase (Sterncell Tech, 7920), centrifuged at 300g for 5 min, and resuspended in staining buffer (0.5% BSA (Sigma, A7906) and 2 mM EDTA (Sigma, E7889) in PBS) at 10×10.sup.6 cells per mL. Mouse anti-CD56 (NCAM, Invitrogen, 12-0567) was added at 0.6 pg per 1×10.sup.6 cells and incubated for 30 min at 4° C. Cells were washed with 1 mL staining buffer, centrifuged at 300 g for 5 min and resuspended in staining buffer for analysis on the SH800 FACS Cell Sorter (Sony Biotechnology).
[0206] RNA-sequencing with tetO cDNA expression. TUBB3-2A-mCherry iPSCs were co-transduced with a lentivirus encoding M2rtTA and the indicated tetO-cDNA. Cells were transduced in mTesR with 10 μM Rock Inhibitor. The following day, the medium was changed to neurogenic medium (DMEM/F-12 Nutrient Mix (Gibco, 11320), 1× B-27 serum-free supplement (Gibco, 17504), 1× N-2 supplement (Gibco, 17502), and 25 μg/mL gentamicin (Sigma, G1397)) supplemented with 0.1 μg/mL doxycycline. Cells were sorted after 2 or 3 days of transgene expression using a SH800 FACS Cell Sorter in semi-purity mode. Sorted cells were replated onto matrigel-coated 24-well plates and cultured in neurogenic medium supplemented with 10 ng/mL each of BDNF, GDNF and NT-3 (PeproTech) until harvest after 6 or 7 days.
[0207] Total RNA was extracted using RNeasy Mini Kit (Qiagen) and 100 ng of RNA was used to develop RNA-seq libraries. RNA-sequencing libraries were prepared using the Truseq Stranded mRNA kit (Illumina) according to the manufacturer's protocol. The libraries were sequenced on a NextSeq 500 on High Output Mode with 75 bp paired-end reads. Reads were first trimmed using Trimmomatic v0.32 to remove adapters and then aligned to GRCh38 using STAR aligner (Langmead et al. Nat. Methods 2012, 9, 357-359). Gene counts were obtained with featureCounts from the subread package (version 1.4.6-p4) using the comprehensive gene annotation in Gencode v22. Differential expression analysis was determined with DESeq2 where gene counts are fitted into negative binomial generalized linear models (GLMs) and Wald statistics determine significant hits. Genes were included for analysis if at least three samples across all conditions tested had a TPM>1. Gene Ontology analyses were performed using the Gene Ontology Consortium database (Ashburner at al., 2000, The Gene Ontology Consortium, 2017) and Synaptic Gene Ontology Consortium database (Koopmans et al. Neuron 2019, 103, 217-234 e214).
[0208] Electrophysiology. TUBB3-2A-mCherry iPSCs were co-transduced with a lentivirus encoding M2rtTA and either tetO-NEUROG3 alone or in combination with tetO-LHX8. Cells were transduced in mTesR with 10 μM Rock Inhibitor. The following day, the medium was changed to neurogenic medium supplemented with 0.1 μg/mL doxycycline. Cells were sorted after 3 days of transgene expression using a SH800 FACS Cell Sorter in semi-purity mode. Sorted cells were replated onto rnatrigel-coated coverslips and cultured in neurogenic medium supplemented with 10 ng/mL each of BDNF, GDNF and NT-3 (PeproTech) for the remainder of the experiment.
[0209] Whole-cell patch-clamp recordings were performed on cultured cells 7 days post-induction of transgene expression under a Zeiss Axio Examiner.D1 microscope. To avoid osmotic shock, culture media was gradually changed to artificial CSF (aCSF) in a step-wise manner over approximately 5 minutes, and then the coverslip was moved to the recording chamber, aCSF contained 124 mM NaCl, 26 mM NaHCO.sub.3, 10 mM D-glucose, 2 mM CaCl.sub.2, 3 mM KCl, 1.3 mM MgSO.sub.4, and 1.25 mM NaH.sub.2PO.sub.4 (310 mOsm/L) and was continuously bubbled at room temperature with 95% O.sub.2 and 5% CO.sub.2. Cells were inspected under a 20× water-immersion objective using infrared illumination and differential interference contrast optics (IR-DIC). The experimenter was blinded to the condition and chose the most morphologically complex neurons for recording. Electrodes (4-7 MΩ) were pulled from borosilicate glass capillaries using a P-97 puller (Sutter Instrument) and filled with an intracellular solution containing 135 mM K-methanesulfonate, 8 mM NaCl, 10 mM HEPES, 0.3 mM EGTA, 4 mM MgATP, and 0.3 mM Na.sub.2GTP (pH 7.3 with KOH, adjusted to 295 mOsm/L with sucrose), Alter gigaohm seals were ruptured, membrane resistance was measured in voltage-clamp mode with a brief hyperpolarizing pulse, and membrane capacitance was estimated from the capacitance compensation circuitry of the amplifier. Then, resting membrane potential was recorded in current-clamp mode. Finally, a small holding current was applied to adjust the membrane potential to around −60 mV, and input-output curves were generated by injecting increasing amounts of current. Data were recorded with a Multiclamp 700B amplifier (Molecular Devices) and digitized at 50 kHz with a Digidata 1550 (Molecular Devices). Action potential properties were calculated based on the first action potential generated using custom MATLAB scripts. Action potentials were counted by visual inspection if they had the characteristic two-component rising phase, regardless of peak amplitude. All experiments were analyzed blinded to the condition, and only recordings which remained stable over the entire period of data collection were used.
[0210] Orthogonal CRISPR-based gene regulation. TUBB3-2A-mCherry .sup.VP64dCas9.sup.VP64iPSCs were transduced with an all-in-one dSaCas9.sup.KRAB lentivirus (Thankore et al. Nat, Commun. 2018, 9, 1674) containing either a ZFP36L1, HES3 or scrambled S. aureus gRNA. After 2 days, antibiotic selection was started with 0.5 μg/mL puromycin, and cells were cultured for an additional 7 days in mTesR. After 9 days following transduction with dSaCas9.sup.KRAB and S. aureus gRNAs, cells were transduced with a lentivirus encoding either sgNGN3 or sgASCL1 and switched to neurogenic medium. Cells were harvested 3 days after gRNA transduction for mRNA-sequencing and 4 days after gRNA transduction for flow cytometry.
[0211] Total RNA was isolated using RNeasy Plus (Qiagen, 74136) and QIAshredder kits (Qiagen, 79656). Libraries were prepped and sequenced by Genewiz on an Illumina Hiseq with 2×150 bp paired-end reads. The mean quality score for the sequencing run was 39.03 with 94.48% reads 30. The average number of reads per sample was ˜50,000,000 reads. mRNA-sequencing analysis was done as described previously for the tetO cDNA experiments. GFP transgene expression was quantified using bowtie2 to align trimmed reads to a custom GFP index generated with the bowtie2-build function. Raw counts were normalized for sequencing depth and displayed as relative counts across the three conditions analyzed.
[0212] Statistical methods. Statistical analysis was done using GraphPad Prism 7. See figure legends for details on specific statistical tests run for each experiment. Statistical significance is represented by a star (*) and indicates a computed p value<0.05.
Example 2
Generation of a Human Pluripotent Stem Cell Line for CRISPRa Screening of Neuronal Cell Fate
[0213] To enable the enrichment of neuronal cells within a CRISPRa screening framework, we inserted a 2A-mCherry sequence into exon 4 of the pan-neuronal marker TUBB3 in a human pluripotent stem cell line (
[0214] To enable efficient and robust targeted gene activation in our TUBB3-P2A-mCherry cell line, we used a lentiviral vector to establish a clonal cell line expressing dCas9 fused to a VP64 transactivation domain at both its N- and C-termini (.sup.VP64dCas9.sup.VP64) under the control of the human ubiquitin C promoter (Kabadi et al. Nucleic Acids Res. 2014, 42, e147). .sup.VP64dCas9.sup.VP64 has been used previously to achieve robust endogenous gene activation sufficient for cell fate reprogramming.
[0215] To evaluate a CRISPRa approach for neuronal differentiation in our .sup.VP64dCas9.sup.VP64 TUBB3-2A-mCherry cell line, we delivered a pool of four lentiviral gRNAs targeting the proximal promoter of NEUROG2, a master regulator of neurogenesis sufficient to generate neurons from pluripotent stem cells when overexpressed ectopically or when activated endogenously with CRISPRa (Chavez et al. Nat. Methods 2015, 12, 326-328; Zhang et al. Neuron 2013, 78, 785-798). After five days of gRNA expression, we detected upregulation of the target gene NEUROG2, as well as of the early pan-neuronal markers NCAM and MAP2 (
[0216] Following delivery of NEUROG2 gRNAs, we detected 15% mCherry-positive cells relative to untreated control cells six days after transduction (
Example 3
CRISPRa Screen for Master Regulators of Neuronal Cell Fate
[0217] To identify a set of neuronal cell fate regulators in an unbiased manner, we performed a CRISPRa pooled gRNA screen in the TUBB3-2A-mChetry cell line (
[0218] The CRISPRa-TF gRNA lentiviral library (named CRISPR-Activation Screen TF, or CAS-TF) was transduced at a multiplicity of infection (MOI) of 0.2 and at 550-fold coverage of the library to ensure that most cells activated a single TF and to account for the stochastic and often inefficient nature of in vitro cell differentiations (
[0219] Compared to a bulk unsorted population of cells, there were gRNAs significantly enriched in the mCherry-high expressing cell bin (FDR<0.01;
[0220] The degree of transcriptional activation achieved with dCas9-based activators can vary across a set of gRNAs for a given target gene. As a consequence, we expected to observe a mixture of active and inactive gRNAs for most target genes. Additionally, off-target gRNA activity could promote false positives by modulating reporter gene expression independent of the predicted TF target. To ensure we did not over-interpret the results of a single gRNA, TFs were selected as high-confidence hits if they had at least two gRNAs significantly enriched in the mCherry-high expressing cell bin relative to both the unsorted and the mCherry-low cell bins (FDR<0.01). This approach yielded a list of 17 TFs as candidate neurogenic factors (
[0221] We analyzed the expression of the 17 candidate neurogenic factors with publicly available gene expression data in the developing human brain curated as part of BrainSpan (Miller et al. Nature 2014, 508, 199-206)(http://brainspan.org). We observed that the mean expression of the 17 factors, calculated across several anatomical regions and developmental time points of the human brain (see Example 1), was higher than that of a randomly generated set of 17 TFs (
[0222] As a further demonstration of the fidelity of the CAS-TF screen, we observed that three well-characterized proneural factors, NEUROD1, NEUROG1, and NEUROG2, each had several gRNAs enriched in mCherry-high expressing cells, while a random set of five scrambled non-targeting gRNAs was unchanged (
Example 4
Validations of Candidate Neurogenic Transcription Factors
[0223] To validate the activity of the candidate neurogenic IFs, we individually tested the most enriched gRNA for the 17 IFs identified in the CAS-TF screen. We transduced these gRNAs at high MOI into the TUBB3-2A-mCherry cell line and evaluated reporter expression after four days (
[0224] Further validations of all five gRNAs represented in the CAS-TF library for ATOH1 and NR5A1 revealed a direct correlation between the calculated enrichment from the pooled screen and the degree of differentiation assessed with reporter gene expression when the gRNAs were tested individually (
[0225] Given that we relied on a single reporter gene as a proxy for a neuronal phenotype, we expected that the TFs enriched in the CAS-TF screen would include both master regulators of neuronal fate sufficient to initiate differentiation, as well as cofactors or downstream effectors that only regulate one or a subset of neuronal genes. To clarify these differences within our set of candidate factors, we first evaluated the expression of two other neuronal markers, NCAM and MAP2, four days after gRNA delivery. Several TFs upregulated one or both of these markers, while other TFs generated no change or even downregulation (
[0226] We used immunofluorescence staining to evaluate the presence of neuronal morphologies with expression of a subset of the TFs identified in our CAS-TF screen (
[0227] To account for variation in response to expression of these TFs across different pluripotent stem cell lines, and to see if the lack of complete neuronal differentiation for several factors was a cell-line specific phenomenon, we also tested KLF7, NR5A1, and OVOL1 in H9 embryonic stem cells. We similarly observed a clear up-regulation of TUBB3 without the development of neuronal morphologies (
[0228] While the 17 high-confidence TF hits had a high validation rate, we suspected that many pro-neural TFs, similar to ASCL1, did not meet our stringent cutoff criteria, In fact, there were 109 other TFs that contained at least a single gRNA significantly enriched in the mCherry-high expressing cells but were not called as a hit. To further investigate these TFs, we first focused on TFs who shared a subfamily with one of the 17 high-confidence hits. For instance, ATOH1 was a high-confidence hit with several enriched gRNAs, however ATOH7 and ATOH8 both had only a single enriched gRNA (
[0229] In order to more comprehensively validate the activity of these 109, we performed a secondary sub-library screen targeting only these TFs (
Example 5
Combinatorial gRNA Screens Identify Neuronal Cofactors
[0230] TFs often function cooperatively to orchestrate gene expression programs. Similarly, TF-mediated cell reprogramming often benefits from the co-expression of combinations of TFs to improve conversion efficiencies, maturation, and subtype specification. Because the mechanisms underlying the improvements observed with co-expressed IFs are often unknown, and because effective cofactors can have minimal activity when expressed alone, it can be challenging to predict effective TF cocktails. To address this challenge, we performed pooled screens with pairs of gRNAs to identify novel combinations of regulators that modulate neuronal differentiation of human pluripotent stem cells.
[0231] We hypothesized that some co-regulators of neuronal differentiation would lack detectable activity when expressed on their own, and thus would not be identified in our initial single-factor CAS-TF screen. Rather, these cofactors might require pairing with another neurogenic factor to reveal their activity. To enable the identification of such TFs, we opted to perform screens pairing a validated neurogenic TF identified from the single-factor screen with the remaining CAS-TF library (
[0232] Due to the constitutive presence of a validated neurogenic factor in each cell, a clear mCherry-positive cell population emerged. Because of this basal neurogenic stimulus, in addition to the detection of novel positive cofactors of differentiation, we were also able to readily detect negative regulators in the mCherry-low expressing cells (
[0233] Effective cofactors that enhance conversion efficiency are often shared across different neuronal reprogramming paradigms but can contribute to subtype specification in context-dependent ways. Similarly, we hypothesized that many cofactors would be shared between NEUROG3 and ASCL1. Consistent with this hypothesis, we found that the majority of positive regulators were shared between the two screens (
TABLE-US-00006 TABLE 1 All positive hits across the three neuronal differentiation screens. sgNGN3 + sgASCL1 + Single Factor CRa-TF CRa-TF CRa-TF NEUROG3 PRDM1 RUNX3 SOX4 LHX6 PRDM1 SOX9 NEUROG3 KLF6 KLF4 PAX8 PAX2 NR5A1 SOX3 RFX3 NEUROD1 KLF4 SOX10 SOX17 FLI1 GATA1 SMAD1 FOXH1 KLF5 ATOH1 FEV KLF1 INSM1 SOX17 ERF NEUROG1 FOS LHX6 SOX18 INSM1 PHOX2B RFX4 SOX2 NANOG KLF7 WT1 NR5A2 SP8 SOX18 ETV3 OVOL1 ZNF670 NEUROG3 NEUROG2 LHX8 SOX4 ERF (from sublibrary) OVOL1 SOX9 PRDM1 (from sublibrary) E2F7 PAX8 OLIG3 (from sublibrary) AFF1 IRF5 HIC1 (from sublibrary) HMX2 CDX4 SOX3 (from sublibrary) MAZ RARA FOXJ1 (from sublibrary) RARA BHLHE40 SOX10 (from sublibrary) PROP1 SOX3 KLF6 (from sublibrary) FOSL1 KLF4 ASCL1 (from sublibrary) PAX5 NR5A1 PLAGL2 (from sublibrary) KLF3 IRF4 ASCL1 GATA6 SPIB THRB FOXH1 NEUROD1 SOX17 CDX2 ZEB2 RARG INSM1 FOSL1 NEUROG1 SOX1 WT1 PAX5 SOX18 POU5F1 RFX4 KLF7 NKX2-2 OVOL2 FOXJ1 PRDM14 VENTX LHX8 GFI1 KLF17 OVOL1 OLIG3 HMX3 ZNF521 ONECUT3 OVOL3 ZNF362 AFF1 HMX2 ZNF786 GATA5 TBX3 ZNF385A ATOH1 PROP1 SOX11 JUN FOXE3 FERD3L E2F7
[0234] The positive hits from the two paired CAS-TF screens encompassed a diverse set of TF families (
[0235] All of the TFs tested improved the conversion efficiency to mCherry-positive cells up to 3-fold when paired with sgNGN3 compared to sgNGN3 co-expressed with a scrambled gRNA (
Example 6
Neurogenic Transcription Factors Modulate Subtype Specificity and Maturation
[0236] Neuronal subtype identity and degree of synaptic maturation are important features defining the utility of in vitro-derived neurons for disease modeling and cell therapy applications. Consequently, the development of protocols to improve maturation kinetics and purity of subtype specification has been a primary focus in the field. Given the diversity of neurogenic TFs identified through our CRISPRa screens, and the range of conversion efficiencies observed through validation experiments, we reasoned that many of these TFs likely influence subtype identity and maturation in distinct ways. To begin to address this question, we performed bulk mRNA-sequencing to more globally assess the degree of neuronal conversion and compare the transcriptional diversity in neuronal populations generated with different TFs.
[0237] We started by analyzing neurons derived from a single TF. While combinations of TFs often enhance the specificity of subtype generation and improve the conversion efficiency and maturation kinetics, single TFs can be sufficient to generate functional neurons with subtype proclivity. We chose to first perform mRNA-sequencing on neurons derived from either ATOH1 or NEUROG3 overexpression (
[0238] We overexpressed the cDNAs encoding either ATOH1 or NEUROG3, used FACS to purify TUBB3-mCherry-positive cells and performed mRNA-sequencing after seven days of transgene expression. Both populations of neurons had over 3000 genes up-regulated relative to the starting population of undifferentiated pluripotent stem cells (
[0239] Surprisingly, we observed a strong correlation across all detectable genes between ATOH1 and NEUROG3-derived neurons, indicating a striking consistency in the induction of the core neuronal program and suppression of the pluripotency network (
[0240] In many cases, combinations of TFs can aid in the precision of neuronal subtype specification or enhance conversion efficiency and maturation. We reasoned that the cofactors identified in our paired gRNA screens would serve as prime candidates for modulating subtype identity and maturation when combined with neurogenic factors identified in the single-factor screen. Consequently, we chose to perform mRNA-sequencing on neurons derived from NEUROG3 alone or in combination with either E2F7, RUNX3, or LHX8. These three cofactors were preferentially selected due to their substantial influence on differentiation efficiency assessed through gRNA validations (
[0241] Similar to the ATOH1 and NEUROG3 comparison, all TF pairs shared a core set of up-regulated genes (
[0242] Importantly, each TF pair uniquely up-regulated genes related to specification and maturation of particular neuronal subtypes. For example, the addition of RUNX3 led to an increase in expression of NTRK3, encoding the TrkC neutrophin-3 receptor linked to the development of proprioceptive dorsal root ganglion neurons (
[0243] To evaluate if the addition of LHX8 influenced the electrophysiological maturation of NEUROG3-derived neurons, we performed patch-clamp recordings of TUBB3-2A-mCherry-positive cells seven days after transgene induction, While we did not observe a difference in the resting membrane potential (
Example 7
Combinatorial gRNA Screens Identify Negative Regulators of Neuronal Fate
[0244] The conversion efficiencies achieved with cell reprogramming and differentiation protocols often vary depending on the starting and ending cell types. Generally, more distantly related cell types, or more aged cell lines, are less amenable to conversion. For instance, the reprogramming of astrocytes to neurons is often more efficient than that of fibroblasts to neurons, with efficiencies further reduced in adult fibroblasts relative to embryonic fibroblasts. These discrepancies in reprogramming outcomes can in part be explained by variation in gene expression profiles and epigenetic landscapes of cells of different type or developmental age. Consequently, this cellular context can create a barrier preventing proper TF activity, reducing conversion efficiency and fidelity.
[0245] High-throughput loss-of-function RNAi screens have been instrumental in the identification of molecular barriers preventing cell type reprogramming and influencing conversion efficiencies. Importantly, ablation of such barriers often results in significant improvements in reprogramming outcomes. Through our paired CRISPRa screens, we identified TFs whose activation impeded neuronal differentiation (
TABLE-US-00007 TABLE 2 Al! negative hits across the three neuronal differentiation screens. sgNGN3 + sgASCL1 + Single Factor CRa-TF CRa-TF CRa-TF ZIC2 HES2 ETV1 SPI1 SREBF1 ZIC2 GRHL2 CIC GSC2 TFAP2C WHSC1 CIC KLF8 VDR GRHL2 MYB HES1 REST TCF21 ID2 TFAP2C KLF12 TCF21 SALL1 TWIST1 SNAI1 NFKB1 SNAI1 RREB1 ELF2 RREB1 GCM2 HES1 GCM2 IRF3 MYB GRHL1 FOXA1 KLF12 ETS1 GATA5 VSX2 BARHL2 GRHL1 NFE2 GRHL3 SOX5 SNAI1 ELF3 DMRT1 TRERF1 PTF1A GCM1 RREB1 GSX1 BARHL2 IRF1 PBX2 SOX13 IRF3 NOTO ZEB1 KLF2 KLF3 PITX2 MYOD1 ZNF311 PTF1A SOX15 ELMSAN1 ZNF282 BARX1 ZNF296 NPAS2 GRHL1 PLEK ZNF160 SOX5 KMT2A HES7 ETS1 HES3 ZBED4 SKIL SALL4 BARHL2 GLIS3 SOX13 TBX22 ERG ZNF331 GRHL3 EGR4 ZNF281 ZIC5 ELF3 ZNF710 HESX1 ZNF697 KLF15 ZFP36L2 PITX2 ELMSAN1 PTF1A ZNF296 GSX1 ZNF318 ZNF160 ZNF570 ETV5 ZNF683 MYBL1 ZFP36L1 NOTO HES4 DPF1 ZNF777 MECOM HESS GLIS3 ZIM2 KLF3 ZNF579 TBX22 BMP2 ESX1 CRAMP1L ZNF337 TOX3 ZFP36L2 FEZF2 ELMSAN1 HES3 ZNF618 ZNF791 ZNF296 ZNF318 ZNF570 ZNF497 ZFP36L1 HES5 BMP2 CRAMP1L ZNF821 KMT2A HES3 BSX
[0246] Interestingly, the majority of the negative regulators were shared across the sgNGN3 and sgASCL1 screens (
[0247] We reasoned that some of these identified negative regulators that were expressed basally in pluripotent stern cells may serve as barriers to neuronal conversion, and that their inhibition could improve differentiation efficiency. Cas9 proteins from different bacterial species can be programmed for orthogonal gene regulation and epigenetic modification. Therefore, we chose to use the orthogonal dSaCas9.sup.KRAB (Thakore et al, Nat. Commun. 2018, 9, 1674), based on the Cas9 protein from S. aureus, to target the promoters of two negative regulators expressed basally in pluripotent stem cells, ZFP36L1 and HES3 (
[0248] The use of dSaCas9.sup.KRAB for targeted gene repression enables the co-expression of the orthogonal .sup.VP64dSpCas9.sup.VP64 for concurrent activation of a neurogenic factor (
[0249] To identify the genome-wide effects of this orthogonal CRISPR-based regulation, we performed mRNA-sequencing on neurons derived from NGN3 activation concurrent with repression of ZFP36L1 or HES3. While knockdown of HES3 resulted in only a few subtle changes in gene expression relative to cells that received a scrambled S. aureus gRNA (
Example 8
Discussion
[0250] As detailed herein, we systematically profiled 1,496 putative human transcription factors for their role in regulating neuronal differentiation of pluripotent stem cells through single and combinatorial CRISPRa screens. This work underscores the utility of CRISPR-based technologies for perturbing gene expression in a high-throughput manner and highlights the robust nature of dCas9-based gene activation for studying the causal role of gene expression in complex cellular phenotypes.
[0251] The use of an early pan-neuronal marker like TUBB3 as a proxy for a neuronal phenotype enabled the identification of a broad set of TFs with varying neurogenic activity. For instance, while NEUROG3 was sufficient to rapidly generate neuronal cells within four days of expression, ATOH7 and ASCL1 required more extended time in culture to achieve a similar phenotype (
[0252] We found that several IFs with clear neurogenic activity, including ASCL1 and ATOH7, had only a single gRNA enriched in the CAS-TF screen (
[0253] Through the use of paired gRNA screens, we identified a set of TFs that improved neuronal differentiation efficiency, maturation, and subtype specification. Interestingly, the majority of these TFs did not possess neurogenic activity on their own, as assessed in our single-factor CAS-TF screen. This observation underscores the importance of synergistic TF interactions that govern cell differentiation and supports the use of unbiased methods to identify these TFs. We identified E2F7 as improving neuronal conversion efficiency (
[0254] Future studies may take advantage of advanced screening platforms to further characterize cell lineage specifying factors. A more comprehensive list of neuronal TFs may have been identified by performing screens that relied on multiple neuronal markers, or that used markers of maturation or subtype identity. Alternatively, rather than assaying for a few discrete markers, these screens could be performed with a single-cell RNA-sequencing (scRNA-seq) output to more accurately define the diversity of neuronal phenotypes obtained with different TF combinations and benchmark these results against the growing atlas of scRNA-seq data from human brain samples. The TFs identified from the screens detailed herein may serve as prime candidates lor sub-libraries to test in these alternative approaches that may be more limited in the scale of library size.
[0255] The paired gRNA screens also identified negative regulators of neuronal differentiation. Knockdown of one of those TFs, ZFP36L1, was sufficient to improve differentiation, leading to global changes in gene expression towards a more differentiated neuronal phenotype (
[0256] Additional CRISPRa screens targeting epigenetic modifiers or other gene subsets besides TFs may help further elucidate the extent to which gene activation can modulate neuronal cell fate. The continued development of synthetic systems for programmable regulation of endogenous gene expression and chromatin state, and the application of these systems to more complex in vitro and in vivo models, may enable studies to more comprehensively define the gene networks and epigenetic mechanisms that govern cell fate decisions,
[0257] Overall, as detailed herein, we have identified a broad set of transcription factors that control neuronal fate specification in human cells. This catalog of factors may serve as a basis for the development of protocols for the generation of diverse neuronal cell types at high efficiency and fidelity for applications in regenerative medicine and disease modeling. Ultimately, the CRISPRa screening platform detailed herein may be extended to other cell reprogramming paradigms and facilitate the in vitro production of many clinically relevant cell types.
Example 9
High-Throughput CRISPR Activation Screen to Identify Novel Drivers of Myogenic Progenitor Cell Fate
[0258] Skeletal muscle regeneration is a complex process mediated by the muscle satellite cells. The cascade of events that drive proper myogenic differentiation from muscle satellite cells is well characterized; however, the upstream events that specify satellite cell fate during embryonic development are not as thoroughly understood. The transcription factor, PAX7 plays a pertinent role in specification and maintenance of satellite cells and its overexpression can specify rnyogenic progenitor cell fate in human pluripotent stem cells. To investigate novel drivers of satellite cell fate, we generated a PAX7-2a-GFP cell line in human H9 embryonic stem cells. We applied a gRNA library targeted at the promoter of all human transcription factors and co-delivered a CRISPR/Cas9-based transcriptional activator to systematically identify independent drivers of PAX7 expression. We then performed a second screen to investigate co-factors of PAX7 by applying the gRNA library along with a PAX7 promoter-targeting gRNA. This second screen identified a separate set of transcription factors, and together, a total of 21 transcription factors were identified. Individual validations demonstrated induction of PAX7 expression and adoption of a myogenic cell fate for some of the hits. The data generated from this study can be used for potential therapeutic targets for skeletal muscle regeneration in the context of cell and gene therapies.
[0259] Generation of a PAX7-2a-GFP Cell Line. Human H9 ESCs (obtained from the WCell Stem Cell Bank) were used for these studies and were maintained in mTeSR (Stem Cell Technologies) and plated on tissue culture treated plates coated with ES-qualified Matrigel (Corning). H9 ESCs were co-transfected with a Cas9-gRNA plasmid targeting the PAX7 isoform A stop codon and a donor plasmid with homology arms complementary to exon 8 and the 3′UTR of PAX7 isoform A. Transfections were performed with a GenePulser Xcell (Bio-Rad) at 250 V, 750 pF, and infinite resistance in a 4mm cuvette. The donor plasmid also contained a PGK-PuroR cassette surrounded by IoxP sites to allow for selective expansion of cells with donor plasmid integration. After two weeks of puromycin selection (1 μg/mL), clones were picked and screened by PCR for integration of the donor cassette at the correct genomic locus. Select positive clones were transfected with a Cre recombinase plasmid to remove the large PGK-PuroR cassette. Cells were plated sparsely and clones were picked and screened for correct integration using primers outside the donor template. Resulting PCR bands were confirmed by Sanger sequencing.
[0260] Generation of CRISPR Activation-Transcription Factor (CRa-TF) gRNA Library. Putative human transcription factors were selected based off of a previously curated list. The corresponding gRNAs available for the list of genes were extracted from the human subpooled CRISPRa library. The 100 scrambled non-targeting gRNAs were also extracted from this library. Our custom library consists of 5 gRNAs targeted per transcriptional start site for 1496 unique genes and the 100 scrambled non-targeting gRNAs for a total library size of 8,505 gRNAs. The oligonucleotide pool (Custom Array) was PCR amplified and cloned using Gibson assembly into the single gRNA expression plasmid for the single CRa-TF screen or the dual gRNA expression plasmid for the paired CRa-TF screens with a PAX7 promoter targeting gRNA.
[0261] Lentivirus Production. HEK293T cells were obtained from the American Tissue Collection Center (ATCC) and purchased through the Duke University Cancer Center Facilities and were cultured in Dulbecco's Modified Eagle's Medium (Invitrogen) supplemented with 10% FBS (Sigma) and 1% penicillin/streptomycin (Invitrogen) at 37° C. with 5% CO2. Approximately 3.5 million cells were plated per 10 cm TCPS dish. Twenty-four hours later, the cells were transfected using the calcium phosphate precipitation method with the expression plasmid, pMD2.G enveloping plasmid (Addgene #12259), and psPAX2 second-generation packaging plasmid (Addgene #12260). The medium was exchanged 12 hours post-transfection, and the viral supernatant was harvested 24 and 48 hours after this medium change. The viral supernatant was pooled and centrifuged at 500 g for 5 minutes, passed through a 0.45 μm filter, and concentrated to 20× using Lenti-X Concentrator (Clontech) in accordance with the manufacturer's protocol. Lentiviral gRNA libraries were titered by flow cytometry.
[0262] High-Throughput CRa-TF Screen for Upstream Regulators of PAX7. Undifferentiated H9 PAX7-2a-GFP cells stably expressing .sup.VP64dCas9.sup.VP64 were dissociated and 22.5×10.sup.6 cells were transduced (3.1×10.sup.4 cells/cm.sup.2) with the CRa-TF lentiviral library at an MOI of 0.2 per replicate. We aimed to achieve 500-fold coverage of the library per replicate. Cells were selected with 1 μg/mL of puromycin for 6 days. For differentiation, the hESCs were dissociated into single cells with Accutase (Stem Cell Technologies) and plated on Matrigel-coated plates (3.6×10.sup.4 cells/cm.sup.2) in in mTeSR medium supplemented with 10 μM Y27632 (Stem Cell Technologies). The following day, mTeSR medium was replaced with E6 media supplemented with 10 μM CHIR99021 (Sigma) to initiate mesoderm differentiation. After 2 days, CHIR99021 was removed and cells were maintained in E6 media with 10 ng/mL FGF2 (Sigma) supplemented daily. Cells were unpassaged during the duration of differentiated for 2 weeks in version 1 of the screen and for 1 week in version 2 of the screen before analysis.
[0263] At 1 or 2 weeks after induction of differentiation, cells were dissociated with 0.2% Collagenase II (ThermoFisher) and washed with neutralizing media (10% FBS in DMEM/F12). Cells were pelleted by centrifugation and resuspended in flow media (5% FBS in PBS). Cells were gated for positive mCherry expression and the top 10% and bottom 10% of GFP expressing cells were sorted on the SONY SH800 flow cytometer into separate tubes. Sorted cells were pelleted and genomic DNA was extracted using the Qiagen DNeasy kit. Unsorted cells were also set aside for genomic DNA isolation to serve as an input control.
[0264] The gRNA sequences were recovered from the genomic DNA by PCR. Sequencing was performed on an Illumina Miseq with 21bp paired-end sequencing using custom read and index primers.
[0265] Data Processing and Enrichment Analysis. FASTQ files were aligned to custom indexes (generated from the bowtie2-build function) using Bowtie with the options -p 32—end-to-end—very-sensitive −3 1-I 0-X 200. Counts for each gRNA were extracted and used for further analysis. All enrichment analysis was performed using R. For individual gRNA enrichment analysis, the DESeq2 package was used to compare between high and low, unsorted and low, or unsorted and high conditions for each screen.
[0266] Individual gRNA Validations. The protospacers from the top enriched gRNAs found in each screen were order as oligonucleotides from IDT and cloned into a lentiviral gRNA expression vector as described earlier. The same H9 PAX7-2a-GFP cell line used in the pooled CRa-TF screen were used for the individual gRNA validations. The cells were transduced with individual gRNAs and underwent the same purornycin selection and differentiation protocol as in the original screens, but in a smaller scale.
[0267] RNA was isolated using the RNeasy Plus RNA isolation kit (Qiagen). cDNA was synthesized with the SuperScript VILO cDNA Synthesis Kit (Invitrogen). Real-time PCR using PerfeCTa SYBR Green FastMix (Quanta Biosciences) was performed with the CFX96 Real-Time PCR Detection System (Bio-Rad). The results are expressed as fold-increase expression of the gene of interest normalized to GAPDH expression using the ΔΔC.sub.t method.
[0268] Immunofluorescence Staining of Cultured Cells. For differentiation, cells were grown to confluency and differentiated on 24 well tissue culture plates coated with Matrigel, and immunofluorescence staining was performed directly in the well. Cells were fixed with 4% PFA for 15 min and permeabilized in blocking buffer (PBS supplemented with 3% BSA and 0.2% Triton X-100) for 1 hr at room temperature. Samples were incubated overnight at 4° C. with PAX7 (1:20, Developmental Studies Hybridoma Bank) and Myosin Heavy Chain MF20 (1:200, Developmental Studies Hybridoma Bank). Samples were washed with PBS for 15 min and incubated with compatible secondary antibodies diluted 1:500 from Invitrogen and DAPI for 1 hr at room temperature. Samples were washed for three times for 5 min with PBS and wells were kept in PBS and imaged using conventional fluorescence microscopy.
[0269] Results: Generation of PAX7 Reporter Line in Human ESCs. PAX7 may be critical for satellite cell specification, function, and maintenance. Because adult satellite cells are also identified by their unique expression of PAX7, we decided to use this gene to generate a satellite cell reporter line. We tested three gRNAs designed to cut near the stop codon of PAX7 in H9 ESCs and found highest cutting activity with gRNA 1 by SURVEYOR analysis. We designed a donor template that contained homology arms and a P2A-eGFP sequence to be inserted downstream of the last exon of PAX7 (
[0270] Reporter activity was validated by transducing cells with a lentiviral vector encoding .sup.VP64dCas9.sup.VP64 and a gRNA targeted at the PAX7 promoter to activate endogenous gene expression. Flow cytometry analysis showed a clear shift in GFP expression in the clonal population compared to non-transduced cells (
[0271] CRa-TF Screen to Identify Novel Regulators of PAX7 Expression. To systematically identify TFs that act upstream of PAX7, we generated a gRNA library targeting the promoter of all putative TFs, based off of a previously curated list. The corresponding gRNAs available for the list of genes were extracted from the human subpooled CRISPRa library previously generated. The custom CRISPRa-TF (CRa-TF) library generated for our studies included 5 gRNAs targeted per transcriptional start site for 1496 unique genes and 100 scrambled non-targeting gRNAs for a total library size of 8,505 gRNAs.
[0272] Because PAX7 is expressed in the ectoderm-derived neural crest during embryogenesis, we paired our screen with a mesoderm differentiation protocol to promote myogenic lineage specification. Differentiation of hPSCs into mesoderm cells can be initiated by addition of the small molecule CHIR99021, a GSK3 inhibitor. Prior to differentiation, we transduced our cell line to stably express .sup.VP64dCas9.sup.VP64. We next transduced our CRa-TF library at an MOI of 0.2, applied selection, and allowed cells to differentiate for 2 weeks in the presence of FGF2 in serum-free media conditions (
[0273] With the CRa-TF library and differentiation, a discernable population of GFP+ cells emerged and we sorted the top 10% and bottom 10% of GFP-expressing cells by FACS (
[0274] Combinatorial CRa-TF Screen to Identify TFs Synergistic with PAX7. Although mesodermal differentiation with small molecules has been shown to generate myogenic cells, it also leads to differentiation of heterogenous cell types including neurons. Mesodermal differentiation with CHIR99021 is also used for differentiation of pluripotent cells into cardiac and kidney lineages as well. It has previously been demonstrated that PAX7 cDNA expression during the differentiation time-course can influence cells to adopt a myogenic cell fate over alternative lineages.
[0275] We performed a second screen with the addition of a mU6-PAX7 promoter-targeting gRNA cassette in the lentiviral CRa-TF library (
[0276] Validation of Hit TFs that Promote Myogenic Differentiation. Next, we wanted to determine if the TFs could not only upregulate PAX7 expression, but also yield myogenic cells. We cloned each of the 21 TF gRNA hits into a lentiviral vector expressing rtTA3 and used a tetracycline-inducible promoter to drive expression of .sup.VP64dCas9.sup.VP54. We transduced both constructs into the H9 PAX7-2a-GFP cell line and differentiated the cells in the presence of doxycycline (dox) for 28 days with a passaging step at day 14. We withdrew dox after 28 days to allow for downregulation of PAX7, which allows downstream myogenic genes to become upregulated to induce terminal differentiation of myogenic progenitors into myocytes (
[0277] Discussion. In this study, we use an unbiased systematic approach to screen all human TFs for myogenic progenitor cell fate specification. Using PAX7 expression as a proxy for satellite cell specification, we generated a PAX7-2a-GFP human embryonic stem cell line to uncover novel upstream regulators of PAX7 during the course of myogenic differentiation. Using individual and combinatorial CRISPRa screens, we generated a list of 21 putative TFs that demonstrated activation of PAX7. A subset of these TFs also demonstrated the ability to differentiate ESCs into myofibers. Hits such as TWISTI and PAX3 were unsurprising due to their previously characterized importance for paraxial mesoderm development. PAX3 in particular is the paralogue of PAX7 they have overlapping functions as upstream regulators of myogenesis. MYOD and MYOG were interesting hits because they are understood to lie downstream of PAX7 expression during myogenesis. A likely explanation is that overexpression of these myogenic factors pushes embryonic stem cells toward the myogenic program to generate primary myofibers of the myotome, which may then form a positive feedback loop to generate more PAX7-derived embryonic myoblasts. In the two versions of the CRISPRa screens conducted in this study, SOX9 and SOX10 were the only TFs to emerge as hits in both. SOX9 and SOX10 are both important TFs during development and SOX factors in general are involved in cell fate determination. SOX9′s implications span from chondrogenesis to central nervous system development and it has also been shown to enhance differentiation of ESCs into progenitors of all 3 germ layers. Like SOX9 and PAX7. SOX10 also plays an important role in neural crest development. Unlike PAX7, SOX10 is not expressed in mesoderm; however, SOX10-deficient embryos exhibit a significant reduction in PAX7+ muscle progenitor cells and a reduced myotome formation. The combination of prior studies linking SOX9 and SOX10 to differentiation and proper myogenesis and the emergence of these TFs in our CRa-TF screen solidifies their importance in myogenic progenitor cell specification.
[0278] Of all the hits analyzed one TF in particular, DMRT1, showed the exciting ability to generate a multitude of PAX7+ cells among abundant myofibers in vitro. DMRT1 is a particularly unexpected hit because it is mainly recognized as a sex determination gene. This gene is predominantly expressed in Sertoli cells and is necessary for testicular maturation. Interestingly, PAX7 was recently identified as a marker for a rare subpopulation of spermatogonia in mice that have stem cell-like properties. Although there is no defined link between DMRT1 and PAX7 in the context of either spermatogenesis or myogenesis, our results would suggest that DMRT1 has the ability to act upstream of PAX7 and activate its expression to give cells a stem-cell phenotype. In the context of the mesodermal differentiation used in our screen, this gives rise to myogenic progenitor cells and myofiber generation. While this process may not be a naturally occurring phenomenon, DMRT1 overexpression may be harnessed for generating robust myogenic progenitors for cell therapies.
[0279] In conclusion, we performed a powerful CRISPRa screen of all human IFs, which revealed hits that were a combination of expected, intriguing, and surprising. These results shed light on our understanding of satellite cell development and the upstream regulators of PAX7 and can be useful for engineering myogenic progenitor cells. The approach developed in this study has broad utility for discovering novel TFs to enhance engineering of other cell lineages.
Example 10
Identification of Transcription Factors that Regulate Chondrogenesis
[0280] A high-throughput CRISPR activation screen similar to that detailed in Example 9 was used to identify novel drivers of chondrocyte-specific gene expression. A gene specifically expressed in collagen was used as the chondrocyte-specific marker. Chondrocyte-specific transcription factors were identified.
[0281] Generation of TF-targeted CRISPR Activation Library. gRNAs targeting annotated TFs as described in the previous Examples were extracted from the library, resulting in a library comprised of 8,435 gRNAs (roughly 5 gRNAs per TF). The library was amplified and cloned into a modified lenti-CRISPR construct containing an mCherry-2A-Pure expression cassette using Gibson Assembly.
[0282] Lentiviral Production and Titration. Lentiviral packaging of gRNA library and VP64-dCas9-VP64 expression vector was performed by transfecting pooled gRNA library plasmids or VP64-dCas9-VP64 plasmid (20 μg), pMD2.G (Addgene, 12259, 6 μg), and psPAX2 (Addgene, 12260, 15 μg) into 3E6 HEK 293Ts using calcium phosphate precipitation. After 16 hours, media was replaced. Viral supernatant was collected 24 and 48 hours later and concentrated using Lenti-X concentration system (Clonetech) according to the manufacturer's instructions.
[0283] Titration of lentivirus containing gRNA library was performed by transduction of COL2A1-2A-GFP; VP64-dCas9-VP64 hiPSCs in a 24-well plate at 60K cells/cm.sup.2 eight hours after plating. 10-fold serial dilutions of concentrated lentivirus, ranging from 5E-5 to 5 μL were added, were added to the media. Media was changed 16 hours after transduction and mCherry fluorescence was measured using BD Accuri C6 cytometer to determine transduction efficiency at D3.
[0284] Generation Validation of CRISPR activator hiPSC line. COL2A1-2A-GFP reporter hiPSCs were transduced with lentivirus carrying an expression cassette of dCas9 fused to VP64 transactivation domains at N- and C-termini as described above. Cells were selected with 100 μg/mL blasticidin for 5 days. The resulting polyclonal line was validated by transduction of NGN2-targeting gRNA. After 3 days, cells were lysed and NGN2 expression was assessed by qRT-PCR.
[0285] Gene expression. Cells in monolayer and pellets were rinsed with DPBS. Monolayer cells were lysed in 350 μl of Buffer RL (Norgen Biotek, Thorold Canada). The RNA was isolated using the Total RNA Purification Kit according to the manufacture's recommendations (Norgen Biotek). Reverse transcription was performed using SuperScript™ VILO™ Master Mix (Thermo Fisher) per the manufacturer's instructions. Quantitative RT-PCR was performed on the QuantStudio 3 (Thermo Fisher) and CFX96 Real Time System (Biorad, Hercules Calif.) using Fast SYBR™ Green Master Mix (Thermo Fisher) according to the manufacturer's protocol. Fold changes were calculated using the ΔΔC.sub.T method relative to hiPSCs as the reference time point and TATA-box-binding protein (TBP) as the reference gene. Gene expression of NGN2 was assessed using the primer pair:
TABLE-US-00008 F: (SEQ ID NO: 151) 5′-CAGGCCAAAGTCACAGCAAC-3′ R: (SEQ ID NO: 152) 5′-CGATCCGAGCAGCACTAACA-3′
[0286] Lentiviral gRNA screening of TF-targeted library. To maintain >500-fold library coverage, 5 15-cm matrigel coated dishes containing 4.5×10.sup.6 million cells each were transduced with lentiviral gRNA library in 25 mL of complete mTeSR at an MOI of 0.2 to ensure that most cells contained 0 or 1 gRNA. Transduced cells were selected with 0.5 pg/mL Puromycin for 3 days and passage at density of 10K/cm.sup.2 in 4 15-cm matrigel coated dishes. At this time point a sample of 5×10.sup.6 cells were sampled to serve an input control for each replicate. 24 hours after seeding cells were selected with puromycin for another 2 days to ensure complete selection. Cells were differentiated to chondroprogenitors as described in 2.4.3 for 21 days. At this timepoint, the top/bottom 5.sup.th percentiles were collected in addition to an unsorted population. After sorting, input, unsorted, GFP.sup.high, and GFP.sup.low populations were harvested for genomic DNA purification (Qiagen).
[0287] gRNA library sequencing. gRNA libraries were amplified from each population by amplifying from 12 μg of gDNA split into twelve 100 μL FOR reactions using Q5 Hot-Start Polymerase (NEB, M0493L). We used the following PCR conditions: 60 degree annealing temperature, 20″ extension time, for 25 cycles. The following primers were used:
TABLE-US-00009 F: (SEQ ID NO: 153) 5′ AATGATACGGCGACCACCGAGATCTACACAATTTCTTGGGTAGTTT GCAGTT-3′ R: (SEQ ID NO: 154) 5′-CAAGCAGAAGACGGCATACGAGAT(NNNNNN)GACTCGGTGCCACT TTTTCAA-3′ where NNNNNN denotes 6-bp barcode sequence.
[0288] PCR-amplified libraries were purified using Agencourt AMPure XP beads (Beckman Coulter) using double selection to remove large fragments and primer dimers by first adding a bead volume of 0.65× PCR volume and then 1× original FOR volume. After resuspension in water, library concentrations in each sample was determined using the Qubit dsDNA High Sensitivity kit (ThermoFisher). Samples were pooled and 21-bp paired end sequencing was performed on Illumina Miseq using the following read and index primers:
TABLE-US-00010 Read 1: (SEQ ID NO: 155) 5′-GATTTCTTGGCTTTATATATCTTGTGGAAAGGACGAAACACCG-3′ Read 2: (SEQ ID NO: 156) 5′-GTTGATAACGGACTAGCCTTATTTTAACTTGCTATTTCTAGCTCTA AAAC-3′ Index: (SEQ ID NO: 157) 5′-GCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTC-3′
[0289] Analysis of differential gRNA enrichment. FASTQ files generated by MiSeq sequencing were aligned to custom indexes using Bowtie 2 with the options -p 32—end-to-end—very-sensitive −3 2-I 0-X 200. We then created a counts table for the number of reads of each gRNA in each sequenced population. Significant enrichment of each gRNA was assessed using the DESeq2 package in R. We compared unsorted to GFP.sup.high, unsorted to GFP.sup.low, and GFP.sup.high to GFP.sup.low; here we only show data for the GFP.sup.high to GFP.sup.low comparison.
[0290] Validation of candidate TFs. Reporter hiPSCs were transduced with lentivirus containing SOX9 cDNA as described in 4.4.3 alongside non-transduced controls. After two days of recovery, cells were differentiated according to the chondrogenic protocol described in 2.4.2 but harvested at the sclerotome stage (D6). At this time point, chondrogenic differentiation was evaluated using flow cytometry with Accuri C6 cytometer.
[0291] Identification of Candidate Regulators of hiPSC Chondrogenesis. To evaluate the effect of activated TFs on chondrogenic differentiation, we generated, in the COL2A1-2A-GFP background, a line stably expressing dCas9 fused to VP64 transactivation domains at both N- and C-terminals (VP64-dCas9-VP64) (
[0292] To generate a TF-targeted CRISPR activation library, we extracted TF-targeting gRNAs from a previously described, publicly available, genome-scale activation library as similarly detailed in Example 9. The gRNA library was cloned into a Lenti-CRISPR construct harboring an mCherry-2a-Pure.sup.R expression cassette to allow selection of transduced lines (
[0293] Notably two gRNAs targeting SOX9 were significantly enriched in the GFP.sup.high population. We also observed strong enrichment for two gRNAs targeting SOX10, another transcription factor known to be involved in limb bud chondrogenesis. The roles of SOX15 and TBR1, remain to be validated and defined. Interestingly, several more gRNAs were enriched in the GFP.sup.low population. As expected, gRNAs targeting TFs strongly expressed in the pluripotent state, such as PRDM14 and NR5A2, were enriched in this population. However, other commonly cited pluripotency TFs such as NANOG and OCT4 were not enriched in this population. Surprisingly, gRNAs targeting TFs that are induced during chondrogenesis, such as P17X1, HES1, 1D4, SP9, and SIX6, were also enriched in the GFP.sup.low population. gRNAs enriched over 3-fold in either population, but not meeting significance criteria, are colored in blue (
[0294] Preliminary Validation of Screening Results by SOX9 Overexpression. While SOX9 is a known chondrogenic transcription factor that binds directly to promoter and enhancer elements of genes encoding cartilage matrix proteins, it was unclear what effect SOX9 activation would have in the context of our staged differentiation. Gene expression data from time course experiments suggested that SOX9 activation occurs at D12 of this differentiation protocol. To determine the effect of SOX9 overexpression on chondrogenesis in the context of our differentiation scheme, we transduced lentivirus encoding SOX9 cDNA to reporter hiPSCs and assessed reporter fluorescence after 6 days of differentiation (
[0295] After 6 days of differentiation with SOX9 overexpression and prior to any BMP-4 treatment, we observed a GFP.sup.high population of roughly 2-3% of the total population (
[0296] Discussion. Here, we show a high-throughput screen of all TFs for their ability to regulate chondrogenesis. SOX9, which we expected to be enriched in the GFP.sup.high, population served as an internal control. Other factors known to be involved in chondrogenesis such as SOX10 were also enriched in the GFP.sup.high population. SOX10 has been shown to be involved in limb bud chondrogenesis and coordinates the chondrogenic program along with SOX9 and SOX8, and may be involved promoting hypertrophic differentiation of chondrocytes. A potential role of TBR1 and SOX15 for chondrogenesis may be less clear; SOX15 has been implicated in muscle regeneration, and TBR1 is known to be expressed glutamatergic neurons.
[0297] Our screen generated far more hits that were enriched in the GFP.sup.low population, Strong activation of most TFs might impede chondrogenic, specification at various stages of differentiation. The most significantly enriched gRNAs in this population target PRDM14, a regulator of naïve pluripotency. gRNAs targeting NR5A2, also highly expressed in pluripotency, are also enriched in this population. Notably gRNAs targeting TFs that are involved in and activated during chondrogenesis, such as PITX1, are also enriched in the GFP.sup.low.
[0298] In our validation experiment to test SOX9 overexpression in the context of differentiation, we observed, after 6 days of differentiation, the emergence of a GFP.sup.high population prior to the addition of BMP-4, suggesting that exogenous delivery of TFs may bypass the pre-chondrogenic phase of differentiation. It appears that hiPSC-derived sclerotome was appropriately poised to activate COL2A1 in response to SOX9. Close analysis of the histogram shown in
[0299] In summary, we demonstrate the utility of a high-throughput hiPSC chondrogenesis platform using a COL2A1 knock-in reporter to screen pro-chondrogenic TFs. The screen successfully enriched gRNAs targeting the known chondrogenic TF SOX9 and produced several other interesting hits. The TFs discovered herein may improve techniques to generate hiPSC-derived cartilage or to specific various chondrocyte subtypes (such as articular versus growth plate).
[0300] The foregoing description of the specific aspects will so fully reveal the general nature of the invention that others can, by applying knowledge within the skill of the art, readily modify and/or adapt for various applications such specific aspects, without undue experimentation, without departing from the general concept of the present disclosure. Therefore, such adaptations and modifications are intended to be within the meaning and range of equivalents of the disclosed aspects, based on the teaching and guidance presented herein. It is to be understood that the phraseology or terminology herein is for the purpose of description and not of limitation, such that the terminology or phraseology of the present specification is to be interpreted by the skilled artisan in light of the teachings and guidance.
[0301] The breadth and scope of the present disclosure should not be limited by any of the above-described exemplary aspects, but should be defined only in accordance with the following claims and their equivalents.
[0302] All publications, patents, patent applications, and/or other documents cited in this application are incorporated by reference in their entirety for all purposes to the same extent as if each individual publication, patent, patent application, and/or other document were individually indicated to be incorporated by reference for all purposes.
[0303] For reasons of completeness, various aspects of the invention are set out in the following numbered clauses:
[0304] Clause 1. A polynucleotide encoding: (1) a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLlG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2: or (2) a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and a second neuronal-specific transcription factor selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLlG3, HIC1, SOX3, FOXJ1 SOX10, KLF6, ASCL1, and PLAGL2; (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1, FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3; (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLF5, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, IRF5, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCL1, GATA6, SPIB, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX, LHX8, GFI1, KLF17, OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, E2F7; (iv) ZIC2, SPI1, GRHL2, TFAP2C, KLF8, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3; (v) HES2, SREBF1, CIC, WHSC1, VDR, HES1, ID2, TCF21, SNAI1, RREB1, GCM2, IRF3, FOXA1, GATA5, GRHL1, SOX5, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HES7, ZBED4, SALL4, GLIS3, TBX22, ZNF331, EGR4, ZIC5, ZNF710, ZNF697, ZFP36L2, ELMSAN1, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HES5, ZIM2, ZNF579, BMP2, CRAMP1L, TOX3, FEZF2, HES3, ZNF791; (vi) ETV1, ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1,1RF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1, ZNF160, ETV5, MYBL1, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HES5, BMP2, CRAMP1L, ZNF821, KMT2A, HES3, and BSX.
[0305] Clause 2. A system for increasing expression of a neuronal-specific gene, the system comprising: (a) a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; or (b) a first gRNA targeting a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and a second gRNA targeting a second neuronal-specific transcription factor selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1, FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3; (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLF5, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, IRF5, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCL1, GATA6, SPIB, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAXS, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX, LHX8, GFI1, KLF17, OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, E2F7; (iv) ZIC2, SPI1, GRHL2, TFAP2C, KLF8, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3; (v) HES2, SREBF1, CIC, WHSC1, VDR, HES1, ID2, TCF21, SNAI1, RREB1, GCM2, IRF3, FOXA1, GATA5, GRHL1, SOX5, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HES7, ZBED4, SALL4, GLIS3, TBX22, ZNF331, EGR4, ZIC5, ZNF710, ZNF697, ZFP36L2, ELMSAN1, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HES5, ZIM2, ZNF579, BMP2, CRAMP1L, TOX3, FEZF2, HES3, ZNF791; (vi) ETV1, ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1, IRF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1, ZNF160, ETV5, MYBL1, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HES5, BMP2, CRAMP1L, ZNF821, KMT2A, HES3, and BSX; and a Cas protein or a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein, or a TALE protein, and the second polypeptide domain has an activity selected from transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, nucleic acid association activity, methylase activity, and demethylase activity.
[0306] Clause 3. The polynucleotide of clause 1 or the system of clause 2, wherein the second neuronal-specific transcription factor is selected from LHX8, LHX6, E2F7, RUNX3, FOXH1, SOX2, HMX2, NKX2-2, HES3, and ZFP36L1.
[0307] Clause 4. The polynucleotide or system of clause 3, wherein the second neuronal-specific transcription factor is selected from LHX8, LHX6, E2F7, RUNX3, FOXH1, SOX2, HMX2, and NKX2-2.
[0308] Clause 5. The polynucleotide or system of clause 3, wherein the second neuronal-specific transcription factor is selected from HES3 and ZFP36L1.
[0309] Clause 6. The system of clause 2, wherein the second neuronal-specific transcription factor is selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEURODI, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SF8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOXIO, KLF6, ASCL1, and PLAGL2, (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1, FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3; (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLFS, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, !RFS, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCL1, GATA6, SPIB, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX, LHX8, GFI1, KLF17, OVOL1 OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1. HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1. SOX11, JUN, FOXE3, FERD3L, and E2F7, and wherein the second polypeptide domain has transcription activation activity.
[0310] Clause 7. The system of clause 6 erein the fusion protein comprises .sup.VP64dCas9.sup.VP64 or dCas9-p300.
[0311] Clause 8. The system of clause 2, wherein the second neuronal-specific transcription factor is selected from: (i) ZIC2, SP11, GRHL2, TFAP2C, KLF8, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3; (ii) HES2, SREBF1, CIC, WHSC1, VDR, HES1, ID2, TCF21, SNAI1, RREB1, GCM2, 1RF3, FOXA1, GATA5, GRHL1, SOX5, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HES7, ZBED4, SALL4, GLIS3, TBX22, ZNF331, EGR4, ZIC5, ZNF710, ZNF697, ZFP36L2, ELMSAN1, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HES5, ZIM2, ZNF579, BMP2, CRAMPIL. TOX3, FEZF2, HES3, ZNF791: (iii) ETV1, Z1C2, GSC2, CIC, GRHL2. REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1, IRF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1, ZNF160, ETVS, MYBL1, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HESS, BMP2, CRAMP1 L, ZNF821, KMT2A, HESS, and BSX, and wherein the second polypeptide domain has transcription repression activity,
[0312] Clause 9. The system of clause 8, wherein the fusion protein comprises dCas9-KRAB.
[0313] Clause 10, The system of any one of clauses 2-9, wherein the first gRNA and the second gRNA each individually comprise a 12-22 base pair complementary polynucleotide sequence of the target DNA sequence followed by a protospacer-adjacent motif, and optionally wherein the gRNA binds and targets and/or comprises a polynucleotide comprising a sequence selected from SEQ ID NOs: 38-87, and optionally wherein the first and/or second gRNA comprises a crRNA, a tracrRNA, or a combination thereof.
[0314] Clause 11. An isolated polynucleotide encoding the system of any one of clauses 2-10.
[0315] Clause 12. A vector comprising the isolated polynucleotide of clause 11.
[0316] Clause 13. A cell comprising the isolated polynucleotide of clause 11 or the vector of clause 12.
[0317] Clause 14. A method of increasing maturation of a stem cell-derived neuron, the method comprising: (a) increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2, or (b) increasing in the stern cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and increasing in the stern cell the level of a second neuronal-specific transcription factor selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1, FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3, (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLF5, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, IRF5, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCL1, GATA6, SPIB, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX, LHX8, GFl1, KLF17, OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATAS, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, and E2F7.
[0318] Clause 15. A method of increasing maturation of a stem cell-derived neuron, the method comprising: increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and decreasing in the stem cell the level of a second neuronal-specific transcription factor selected from: (i) ZIC2, SPI1, GRHL2, TFAP2C, KLFB, MYB, TCF21, KLF12, TWIST1, SNAIL RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3; (ii) HES2, SREBF1, CIC, WHSC1, VIER, HES1, ID2, TCF21, SNAI1, RREB1, GCM2, IRF3, FOXA1, GATAS, GRHL1, SOXS, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HES7, ZBED4, SALL4, GLIS3, TBX22, ZNF331, EGR4, ZIC5, ZNF71O, ZNF697, ZFP36L2, ELMSAN1, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HESS, ZIM2, ZNF579, BMP2, CRAMP1L, TOX3, FEZF2, HES3, ZNF791; (iii) ETV1, ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1, IRF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOXS, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1, ZNF160, ETV5, MYBL1, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HESS, BMP2, CRAMP1L, ZNF821, KMT2A, HES3, and BSX.
[0319] Clause 16. A method of increasing the conversion of a stem cell to a neuron, the method comprising: (a) increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SPS, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2, or (b) increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and increasing in the stem cell the level of a second neuronal-specific transcription factor selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1, FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAXS, KLF3; (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLF5, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8, IRF5, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCL1, GATA6, SP1B, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1 , FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX. LHX8, GFI1, KLF17. OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, and E2F7.
[0320] Clause 17. A method of increasing the conversion of a stem cell to a neuron, the method comprising: increasing in the stem cell the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and decreasing in the stern cell the level of a second neuronal-specific transcription factor selected from: (i) ZIC2, SPI1, GRHL2, TFAP2C, KLF8, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1. ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK. KMT2A, HES3; (ii) HES2, SREBF1, CIC, WHSC1. VDR, HES1, ID2, TCF21, SNAI1, RREB1. GCM2. IRF3, FOXA1, GATA5, GRHL1, SOXS, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HES7, ZBED4, SALL4, GLIS3, TBX22, ZNF331, EGR4, ZIC5, ZNF710, ZNF697, ZFP36L2, ELMSAN1, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HES5, ZIM2, ZNF579, BMP2, CRAMP1L, TOX3, FEZF2, HES3, ZNF791; (iii) ETV1, ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNA11, TRERF1, RREB1,1RF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, P1TX2, PTF1A, GSX1, ZNF160, ETV5, MYBLI, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1. HESS, BMP2, CRAMP1L, ZNF821, KMT2A, HES3, and BSX.
[0321] Clause 18. A method of treating a subject in need thereof, the method comprising: (a) increasing in a stem cell in the subject the level of a first neuronal-specific transcription factor selected from NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROG1, SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, H1C1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2, or (b) increasing in a stern cell in the subject the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and increasing in a stem cell in the subject the level of a second neuronal-specific transcription factor selected from: (i) NEUROG3, SOX4, SOX9, KLF4, NR5A1, NEUROD1, SOX17, SMAD1, ATOH1, INSM1, NEUROGI SOX18, RFX4, KLF7, SP8, OVOL1, NEUROG2, ERF, PRDM1, OLIG3, HIC1, SOX3, FOXJ1, SOX10, KLF6, ASCL1, and PLAGL2; (ii) PRDM1, LHX6, NEUROG3, PAX8, SOX3, KLF4, FLI1, FOXH1, FEV, SOX17, FOS, INSM1, SOX2, WT1, SOX18, ZNF670, LHX8, OVOL1, E2F7, AFF1, HMX2, MAZ, RARA, PROP1, FOSL1, PAX5, KLF3; (iii) RUNX3, PRDM1, KLF6, PAX2, RFX3, SOX10, GATA1, KLF5, KLF1, ERF, LHX6, PHOX2B, NANOG, NR5A2, ETV3, NEUROG3, SOX4, SOX9, PAX8,1RF5, CDX4, RARA, BHLHE40, SOX3, KLF4, NR5A1, IRF4, ASCL1, GATA6, SPIB, THRB, FOXH1, NEUROD1, SOX17, CDX2, ZEB2, RARG, INSM1, FOSL1, NEUROG1, SOX1, WT1, PAX5, SOX18, POU5F1, RFX4, KLF7, NKX2-2, OVOL2, FOXJ1, PRDM14, VENTX, LHX8, GFI1, KLF17, OVOL1, OLIG3, HMX3, ZNF521, ONECUT3, OVOL3, ZNF362, AFF1, HMX2, ZNF786, GATA5, TBX3, ZNF385A, ATOH1, PROP1, SOX11, JUN, FOXE3, FERD3L, and E2F7.
[0322] Clause 19. A method of treating a subject in need thereof, the method comprising: increasing in a stem cell in the subject the level of a first neuronal-specific transcription factor selected from NGN3 and ASCL1, or a combination thereof; and decreasing in a stem cell in the subject the level of a second neuronal-specific transcription factor selected from: (i) ZIC2, SPII, GRHL2, TFAP2C, KLF8, MYB, TCF21, KLF12, TWIST1, SNAI1, RREB1, GCM2, GRHL1, ETS1, BARHL2, GRHL3, ELF3, PTF1A, GSX1, PBX2, NOTO, KLF3, ZNF311, ELMSAN1, ZNF296, PLEK, KMT2A, HES3; (ii) HES2, SREBF1, CIC, WHSC1, VCR, HES1, ID2, TCF21, SNAI1, RREB1, GCM2, IRF3, FOXA1, GATA5, GRHL1, SOX5, DMRT1, GCM1, BARHL2, SOX13, ZEB1, PITX2, PTF1A, ZNF282, NPAS2, ZNF160, HES7, ZBED4, SALL4, GLIS3, TBX22, ZNF331, EGR4, ZIC5, ZNF710, ZNF697, ZFP36L2, ELMSAN1, ZNF296, ZNF318, ZNF570, ZNF683, ZFP36L1, HES4, ZNF777, HES5, ZIM2, ZNF579, BMP2, CRAMP1L, TOX3, FEZF2, HES3, ZNF791; (iii) ETV1, ZIC2, GSC2, CIC, GRHL2, REST, TFAP2C, SALL1, NFKB1, ELF2, HES1, MYB, KLF12, VSX2, NFE2, SNAI1, TRERF1, RREB1, IRF1, IRF3, KLF2, MYOD1, SOX15, BARX1, GRHL1, SOX5, ETS1, SKIL, BARHL2, SOX13, ERG, GRHL3, ZNF281, ELF3, HESX1, KLF15, PITX2, PTF1A, GSX1, ZNF160, ETV5, MYBL1, NOTO, DPF1, MECOM, GLIS3, KLF3, TBX22, ESX1, ZNF337, ZFP36L2, ELMSAN1, ZNF618, ZNF296, ZNF318, ZNF570, ZNF497, ZFP36L1, HESS, BMP2, CRAMP1L, ZNF821, KMT2A, HES3, and BSX.
[0323] Clause 20, The method of any one of clauses 14-19, wherein increasing the level of the first neuronal-specific transcription factor comprises at least one of: (a) administering to the stem cell a polynucleotide encoding the first neuronal-specific transcription factor; (b) administering to the stem cell a polypeptide comprising the first neuronal-specific transcription factor; and (c) administering to the stem cell a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein targeting the first neuronal-specific transcription factor, or a TALE protein targeting the first neuronal-specific transcription factor, and the second polypeptide domain has transcription activation activity, and wherein a gRNA targeting the first neuronal-specific transcription factor is additionally administered to the stem cell when the first polypeptide domain comprises a Cas protein.
[0324] Clause 21. The method of any one of clauses 14, 16, and 18, wherein increasing the level of the second neuronal-specific transcription factor comprises at least one of: (a) administering to the stern cell a polynucleotide encoding the second neuronal-specific transcription factor; (b) administering to the stem cell a polypeptide comprising the second neuronal-specific transcription factor; and (c) administering to the stem cell a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein targeting the second neuronal-specific transcription factor, or a TALE protein targeting the second neuronal-specific transcription factor, and the second polypeptide domain has transcription activation activity, and wherein a gRNA targeting the second neuronal-specific transcription factor is additionally administered to the stem cell when the first polypeptide domain comprises a Cas protein.
[0325] Clause 22. The method of any one of clauses 15, 17, and 19, wherein decreasing the level of the second neuronal-specific transcription factor comprises administering to the stem cell a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein targeting the second neuronal-specific transcription factor, or a TALE protein targeting the second neuronal-specific transcription factor, and the second polypeptide domain has transcription repression activity, and wherein a gRNA targeting the second neuronal-specific transcription factor is additionally administered to the stem cell when the first polypeptide domain comprises a Cas protein.
[0326] Clause 23. The method of any one of clauses 14-22, wherein the stem cell is directly converted to a neuron without a pluripotent stage.
[0327] Clause 24. The cell of clause 13 or the method of any one of clauses 14-23, wherein the stem cell is a pluripotent stern cell, an induced pluripotent stem cell, or an embryonic stern cell.
[0328] Clause 25. A system for selecting a polynucleotide for activity as a cell type-specific transcription factor, the system comprising: a polynucleotide encoding a reporter protein and a cell type marker; a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, and the second polypeptide domain has transcription activation activity; and a library of guide RNAs (gRNAs), each gRNA targeting a different putative cell type-specific transcription factor.
[0329] Clause 26. The system of clause 25, wherein the cell-type specific transcription factor is a neuronal-specific transcription factor, wherein the cell type marker is a neuronal marker, and wherein the neuronal marker comprises TUBB3.
[0330] Clause 27. The system of clause 25, wherein the cell-type specific transcription factor is a muscle-specific transcription factor, wherein the cell type marker is a myogenic marker, and wherein the myogenic marker comprises PAX7.
[0331] Clause 28. The system of clause 25, wherein the cell-type specific transcription factor is a chondrocyte-specific transcription factor, wherein the cell type marker is a collagen marker, and wherein the collagen marker comprises COL2A1,
[0332] Clause 29. The system of any one of clauses 25-28, wherein the reporter protein comprises mCherry.
[0333] Clause 30. An isolated polynucleotide sequence encoding the system of any one of clauses 25-29.
[0334] Clause 31. A vector comprising the isolated polynucleotide sequence of clause 30.
[0335] Clause 32. A cell comprising the system of any one of clauses 25-29, the isolated polynucleotide sequence of clause 30, or the vector of clause 31, or a combination thereof.
[0336] Clause 33. A method of screening for a cell type-specific transcription factor, the method comprising; transducing a population of cells with the system of any one of clauses 25-29 at a multiplicity of infection (MOD) of about 0.2, such that a majority of the cells each independently includes one gRNA and targets one putative transcription factor; determining a level of expression of the reporter protein in each cell; determining a level of the gRNA in each cell having a high expression of the reporter protein, wherein high expression of the reporter protein is defined as being in the top 5% among the population of cells; and selecting the putative transcription factor as a cell-type-specific transcription factor when the putative transcription factor corresponds to at least two gRNAs enriched in the cell having a high expression of the reporter protein.
[0337] Clause 34. A method of screening for a pair of cell-type-specific transcription factors, the method comprising: transducing a population of cells with the system of any one of clauses 25-29 at a multiplicity of infection (MOI) of about 0.2, such that a majority of the cells each independently includes two gRNAs and targets two putative transcription factors; determining a level of expression of the reporter protein in each cell; determining a level of the two gRNAs in each cell having a high expression of the reporter protein, wherein high expression of the reporter protein is defined as being in the top 5% among the population of cells; and selecting the two putative transcription factors as a pair of cell type-specific transcription factors when the putative transcription factors correspond to at least two gRNAs enriched in the cell having a high expression of the reporter protein.
[0338] Clause 35. The method of clause 33 or 34, wherein the level of expression of the reporter protein in each cell is determined after about four days from transduction.
[0339] Clause 36. The method of any one of clauses 33-35, wherein the level of expression of the reporter protein in each cell is determined by flow cytometry.
[0340] Clause 37, The method of any one of clauses 33-36, wherein the level of the gRNA in each cell having a high expression of the reporter protein is determined by deep sequencing.
[0341] Clause 38. The method of any one of clauses 33-37, wherein the gRNA increases the expression of the reporter protein in the cell by about 2-50% relative to a non-targeting gRNA.
[0342] Clause 39. A polynucleotide encoding a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1.
[0343] Clause 40. A system for increasing expression of a muscle-specific gene, the system comprising: (a) a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1; or (b) a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein targeting a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1, or a TALE protein targeting a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1, wherein the second polypeptide domain has an activity selected from transcription activation activity, transcription release factor activity, histone modification activity, nucleic acid association activity, methylase activity, and demethylase activity, and wherein the system further includes a gRNA targeting a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1 when the first polypeptide domain comprises a Cas protein.
[0344] Clause 41. The system of clause 40, wherein the fusion protein comprises .sup.VP64dCas9.sup.VP64 or dCas9-p300,
[0345] Clause 42. An isolated polynucleotide encoding the system of any one of clauses 40-41.
[0346] Clause 43. A vector comprising the isolated polynucleotide of clause 42.
[0347] Clause 44. A cell comprising the isolated polynucleotide of clause 42 or the vector of clause 43.
[0348] Clause 45. A method of increasing differentiation of a stem cell into a myoblast, the method comprising: increasing in the stem cell the level of a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1.
[0349] Clause 46. A method of treating a subject in need thereof, the method comprising: increasing in a stem cell from the subject the level of a muscle-specific transcription factor selected from TWIST1, PAX3, MYOD, MYOG, SOX9, SOX10, and DMRT1.
[0350] Clause 47. The method of clause 45 or 46, wherein increasing the level of the muscle-specific transcription factor comprises at least one of: (a) administering to the stern cell a polynucleotide encoding the muscle-specific transcription factor; (b) administering to the stem cell a polypeptide comprising the muscle-specific transcription factor; and (c) administering to the stern cell a fusion protein, wherein the fusion protein comprises two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein, a zinc finger protein targeting the muscle-specific transcription factor, or a TALE protein targeting the muscle-specific transcription factor, wherein the second polypeptide domain has transcription activation activity, and wherein a gRNA targeting the muscle-specific transcription factor is additionally administered when the first polypeptide domain comprises a Cas protein,
TABLE-US-00011 SEQUENCES SEQ ID NO: 1 NGG (N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 2 NGA (N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQID NO: 3 NGAN (N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 4 NGNG (N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 5 NGGNG (N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 6 NNAGAAW (W = A or T; N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 7 NAAR (R = A or G; N can be any nucleotide residue, e.g., any of A, G, C, or T ) SEQ ID NO: 8 NNGRR (R = A or G; N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 9 NNGRRN (R = A or G; N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 10 NNGRRT (R = A or G: N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 11 NNGRRV (R = A or G; N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 12 NNNNGATT (N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 13 NNNNGNNN (N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 14 codon optimized polynucleotide encoding S. pyogenes Cas9 atggataaaa agtacaqcat cgggctggac atcggtacaa actcagtggg gtgggccgtg attacggacg agtacaaggt accctccaaa aaatttaaag tgctgggtaa cacggacaga cactctataa agaaaaatct tattggagcc ttgctgttcg actcaggcga gacagccgaa gccacaaggt tgaagcggac cgccaggagg cggtatacca ggagaaagaa ccgcatatgc tacctgcaag aaatcttcag taacgagatg gcaaaggttg acgatagctt tttccatcgc ctggaagaat cctttcttgt tgaggaagac aagaagcacg aacggcaccc catctttggc aatattgtcg acgaagtggc atatcacgaa aagtacccga ctatctacca cctcaggaag aagctggtgg actctaccga taaggcggac ctcagactta tttatttggc actcgcccac atgattaaat ttagaggaca tttcttgatc gagggcgacc tgaacccgga caacagtgac gtcgataagc tgttcatcca acttgtgcag acctacaatc aactgttcga agaaaaccct ataaatgctt caggagtcga cgctaaagca atcctgtccg cgcgcctctc aaaatctaga agacttgaga atctgattgc tcagttgccc ggggaaaaga aaaatggatt gtttggcaac ctgatcgccc tcagtctcgg actgacccca aatttcaaaa gtaacttcga cctggccgaa gacgctaagc tccagctgtc caaggacaca tacgatgacg acctcgacaa tctgctggcc cagattgggg atcagtacgc cgatctcttt ttggcagcaa agaacctgtc cgacgccatc ctgttgagcg atatcttgag agtgaacacc gaaattacta aagcacccct tagcgcatct atgatcaagc ggtacgacga gcatcatcag gatctgaccc tgctgaaggc tcttgtgagg caacagctcc ccgaaaaata caaggaaatc ttctttgacc agagcaaaaa cggctacgct ggctatatag atggtggggc cagtcaggag gaattctata aattcatcaa gcccattctc gagaaaatgg acggcacaga ggagttgctg gtcaaactta acagggagga cctgctgcgg aagcagcgga cctttgacaa cgggtctatc ccccaccaga ttcatctggg cgaactgcac gcaatcctga ggaggcagga ggatttttat ccttttctta aagataaccg cgagaaaata gaaaagattc ttacattcag gatcccgtac tacgtgggac ctctcgcccg gggcaattca cggtttgcct ggatgacaag gaagtcagag gagactatta caccttggaa cttcgaagaa gtggtggaca agggtgcatc tgcccagtct ttcatcgagc ggatgacaaa ttttgacaag aacctcccta atgagaaggt gctgcccaaa cattctctgc tctacgagta ctttaccgtc tacaatgaac tgactaaagt caagtacgtc accgagggaa tgaggaagcc ggcattcctt agtggagaac agaagaaggc gattgtagac ctgttgttca agaccaacag gaaggtgact gtgaagcaac ttaaagaaga ctactttaag aagatcgaat gttttgacag tgtggaaatt tcaggggttg aagaccgctt caatgcgtca ttggggactt accatgatct tctcaagatc ataaaggaca aagacttcct ggacaacgaa gaaaatgagg atattctcga agacatcgtc ctcaccctga ccctgttcga agacagggaa atgatagaag agcgcttgaa aacctatgcc cacctcttcg acgataaagt tatgaagcag ctgaagcgca ggagatacac aggatgggga agattgtcaa ggaagctgat caatggaatt agggataaac agagtggcaa gaccatactg gatttcctca aatctgatgg cttcgccaat aggaacttca tgcaactgat tcacgatgac tctcttacct tcaaggagga cattcaaaag gctcaggtga gcgggcaggg agactccctt catgaacaca tcgcgaattt ggcaggttcc cccgctatta aaaagggcat ccttcaaact gtcaaggtgg tggatgaatt ggtcaaggta atgggcagac ataagccaga aaatattgtg atrgagatgg cccgcgaaaa ccagaccaca cagaagggcc agaaaaatag tagagagcgg atgaagagga tcgaggaggg catcaaagag ctgggatctc agattctcaa agaacacccc gtagaaaaca cacagctgca gaacgaaaaa ttgtacttgt actatctgca gaacggcaga gacatgtacg tcgaccaaga acttgatatt aatagactgt ccgactatga cgtagaccat atcgtgcccc agtccttcct gaaggacgac tccattgata acaaagtctt gacaagaagc gacaagaaca ggggtaaaag tgataatgtg cctagcgagg aggtggtgaa aaaaatgaag aactactggc gacagctgct taatgcaaag ctcattacac aacggaagtt cgataatctg acgaaagcag agagaggtgg cttgtctgag ttggacaagg cagggtttat taagcggcag ctggtggaaa ctaggcagat cacaaagcac gtggcgcaga ttttggacag ccggatgaac acaaaatacg acgaaaatga taaactgata cgagaggtca aagttatcac gctgaaaagc aagctggtgt ccgattttcg gaaagacttc cagttctaca aagttcgcga gattaataac taccatcatg ctcacgatgc gtacctgaac gctgttgtcg ggaccgcctt gataaagaag tacccaaagc tggaatccga gttcgtatac ggggattaca aagtgtacga tgtgaggaaa atgatagcca agtccgagca ggagattgga aaggccacag ctaagtactt cttttattct aacatcatga atttttttaa gacggaaatt accctggcca acggagagat cagaaagcgg ccccttatag agacaaatgg tgaaacaggt gaaatcgtct gggataaggg cagggatttc gctactgtga ggaaggtgct gagtatgcca caggtaaata tcgtgaaaaa aarrgaagta cagaccggag gattttccaa ggaaagcatt ttgcctaaaa gaaactcaga caagctcatc gcccgcaaga aagattggga ccctaagaaa tacgggggat ttgactcacc caccgtagcc tattctgtgc tggtggtagc taaggtggaa aaaggaaagt ctaagaagct gaagtccgtg aaggaactct tgggaatcac tatcatggaa agatcatcct ttgaaaagaa ccctatcgat ttcctggagg ctaagggtta caaggaggtc aagaaagacc tcatcattaa actgccaaaa tactctctct tcgagctgga aaatggcagg aagagaatgt tggccagcgc cggagagctg caaaagggaa acgagcttgc tctgccctcc aaatatgtta attttctcta tctcgcttcc cactatgaaa agctgaaagg gtctcccgaa gataacgagc agaagcagct gttcgtcgaa cagcacaagc actatctgga tgaaataatc gaacaaataa gcgagttcag caaaagggtt atcctggcgg atgctaattt ggacaaagta ctgtctgctt ataacaagca ccgggataag cctattaggg aacaagccga gaatataatt cacctcttta cactcacgaa tctcggagcc cccgccgcct tcaaatactt tgatacgact atcgaccgga aacggtatac cagtaccaaa gaggtcctcg atgccaccct catccaccag tcaattactg gcctgtacga aacacggatcgacctctctc aactgggcgg cgactag SEQ ID NO: 15 Amino acid sequence of codon optimized poiynucleotide encoding S. pyogenes Cas9 MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTA RRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKEHERHPIFGNIVDEVAYHEKYPTIY HLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINAS GVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIAISLGLTPNFKSNFDLAEDAKLQLSKDTYD DDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVR QQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNG SIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPW NFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQ KKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEEN EDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTIL DELKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELV KVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYL QNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWR QLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIRE VKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRK MIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLS MPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKK LKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGN ELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLS AYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRI DLSQLGGD SEQ ID NO: 16 codon optimized nucleic acid sequences encoding S. aureus Cas9 atgaaaagga actacattct ggggctggac atcgggatta caagcgtggg gtatgggatt attgactatg aaacaaggga cgtgatcgac gcaggcgtca gactgttcaa ggaggccaac gtggaaaaca atgagggacg gagaagcaag aggggagcca ggcgcctgaa acgacggaga aggcacagaa tccagagggt gaagaaactg ctgttcgatt acaacctgct gaccgaccat tctgagctga gtggaattaa tccttatgaa gccagggtga aaggcctgag tcagaagctg tcagaggaag agttttccgc agctctgctg cacctggcta agcgccgagg agtgcataac gtcaatgagg tggaagagga caccggcaac gagctgtcta caaaggaaca gatctcacgc aatagcaaag ctctggaaga gaagtatgtc gcagagctgc agctggaacg gctgaagaaa gatggcgagg tgagagggtc aattaatagg ttcaagacaa gcgactacgt caaagaagcc aagcagctgc tgaaagtgca gaaggcttac caccagctgg atcagagctt catcgatact tatatcgacc tgctggagac tcggagaacc tactatgagg gaccaggaga agggagcccc ttcggatgga aagacatcaa ggaatggtac gagatgctga tgggacattg cacctatttt ccagaagagc tgagaagcgt caagtacgct tataacgcag atctgtacaa cgccctgaat gacctgaaca acctggtcat caccagggat gaaaacgaga aactggaata ctatgagaag ttccagatca tcgaaaacgt gtttaagcag aagaaaaagc ctacactgaa acagattgct aaggagatcc tggtcaacga agaggacatc aagggctacc gggtgacaag cactggaaaa ccagagttca ccaatctgaa agtgtatcac gatattaagg acatcacagc acggaaagaa atcattgaga acgccgaact gctggatcag attgctaaga tcctgactat ctaccagagc tccgaggaca tccaggaaga gctgactaac ctgaacagcg agctgaccca ggaagagatc gaacagatta gtaatctgaa ggggtacacc ggaacacaca acctgtccct gaaagctatc aatctgattc tggatgagct gtggcataca aacgacaatc agattgcaat ctttaaccgg ctgaagctgg tcccaaaaaa ggtggacctg agtcagcaga aagagatccc aaccacactg gtggacgatt tcattctgtc acccgtggtc aagcggagct tcatccagag catcaaagtg atcaacgcca tcatcaagaa gtacggcctg cccaatgata tcattatcga gctggctagg gagaagaaca gcaaggacgc acagaagatg atcaatgaga tgcagaaacg aaaccggcag accaatgaac gcattgaaga gattatccga actaccggga aagagaacgc aaagtacctg attgaaaaaa tcaagctgca cgatatgcag gagggaaagt gtctgtattc tctggaggcc tcccccctgg aggacctgct gaacaatcca ttcaactacg aggtcgatca tattatcccc accagcgtgt ccttcgacaa ttcctttaac aacaaggtgc tggtcaagca ggaagagaac tctaaaaagg gcaataggac tcctttccag tacctgtcta gttcagattc caagatctct tacgaaacct ttaaaaagca cattctgaat ctggccaaag gaaagggccg catcagcaag accaaaaagg agtacctgct ggaagagcgg gacatcaaca gattctccgt ccagaaggat tttattaacc ggaatctggt ggacacaaga tacgctactc gcggcctgat gaatctgctg cgatcctatt tccgggtgaa caatctggat gtgaaagtca agtccatcaa cggcgggttc acatcttttc tgaggcgcaa atggaagttt aaaaaggagc gcaacaaagg gtacaagcac catgccgaag atgctctgat tatcgcaaat gccgacttca tctttaagga gtggaaaaag ctggacaaag ccaagaaagt gatggagaac cagatgttcg aagagaagca ggccgaatct atgcccgaaa tcgagacaga acaggagtac aaggagattt tcatcactcc tcaccagatc aagcatatca aggatttcaa ggactacaag tactctcacc gggtggataa aaagcccaac agagagctga tcaatgacac cctgtatagt acaagaaaag acgataaggg gaataccctg attgtgaaca atctgaacgg actgtacgac aaagataatg acaagctgaa aaagctgatc aacaaaagtc ccgagaagct gctgatgtac caccatgatc ctcagacata tcagaaactg aagctgatta tggagcagta cggcgacgag aagaacccac tgtataagta ctatgaagag actgggaact acctgaccaa gtatagcaaa aaggataatg gccccgtgat caagaagatc aagtactatg ggaacaagct gaatgcccat ctggacatca cagacgatta ccctaacagt cgcaacaagg tggtcaagct gtcactgaag ccatacagat tcgatgtcta tctggacaac ggcgtgtata aatLLgtgac tgtcaagaat ctggatgtca tcaaaaagga gaactactat gaagtgaata gcaagtgcta cgaagaggct aaaaagctga aaaagattag caaccaggca gagttcatcg cctcctttta caacaacgac ctgattaaga tcaatggcga actgtatagg gtcatcgggg tgaacaatga tctgctgaac cgcattgaag tgaatatgat tgacatcact taccgagagt atctggaaaa catgaatgat aagcgccccc ctcgaattat caaaacaatt gcctctaaga ctcagagtat caaaaagtac tcaaccgaca ttctgggaaa cctgtatgag gtgaagagca aaaagcaccc tcagattatc aaaaagggc SEQ ID NO: 17 codon optimized nucleic acid sequences encoding S. aureus Cas9 atgaagcgga actacatcct gggcctggac atcggcatca ccagcgtggg ctacggcatc atcgactacg agacacggga cgtgatcgat gccggcgtgc ggctgttcaa agaggccaac gtggaaaaca acgagggcag gcggagcaag agaggcgcca gaaggctgaa gcggcggagg cggcatagaa tccagagagt gaagaagctg ctgttcgact acaacctgct gaccgaccac agcgagctga gcggcatcaa cccctacgag gccagagtga agggcctgag ccagaagctg agcgaggaag agttctctgc cgccctgctg cacctggcca agagaagagg cgtgcacaac gtgaacgagg tggaagagga caccggcaac gagctgtcca ccaaagagca gatcagccgg aacagcaagg ccctggaaga gaaatacgtg gccgaactgc agctggaacg gctgaagaaa gacggcgaag tgcggggcag catcaacaga ttcaagacca gcgactacgt gaaagaagcc aaacagctgc tgaaggtgca gaaggcctac caccagctgg accagagctt catcgacacc tacatcgacc tgctggaaac ccggcggacc tactatgagg gacctggcga gggcagcccc ttcggctgga aggacatcaa agaatggtac gagatgctga tgggccactg cacctacttc cccgaggaac tgcggagcgt gaagtacgcc tacaacgccg acctgtacaa cgccctgaac gacctgaaca atctcgtgat caccagggac gagaacgaga agctggaata ttacgagaag ttccagatca tcgagaacgt gttcaagcag aagaagaagc ccaccctgaa gcagatcgcc aaagaaatcc tcgtgaacga agaggatatt aagggctaca gagtgaccag caccggcaag cccgagttca ccaacctgaa ggtgtaccac gacatcaagg acattaccac ccggaaagag attattgaga acgccgagct gctggatcag attgccaaga tcctgaccat ctaccagagc agcgaggaca tccaggaaga actgaccaat ctgaactccg agctgaccca ggaagagatc gagcagatct ctaatctgaa gggctatacc ggcacccaca acctgagcct gaaggccatc aacctgatcc tggacgagct gtggcacacc aacgacaacc agatcgctat cttcaaccgg ctgaagctgg tgcccaagaa ggtggacctg tcccagcaga aagagatccc caccaccctg gtggacgact tcatcctgag ccccgtcgtg aagagaagct tcatccagag catcaaagtg atcaacgcca tcatcaagaa gtacggcctg cccaacgaca tcattatcga gctggcccgc gagaagaact ccaaggacgc ccagaaaatg atcaacgaga tgcagaagcg gaaccggcag accaacgagc ggatcgagga aatcatccgg accaccggca aagagaacgc caagtacctg atcgagaaga tcaagctgca cgacatgcag gaaggcaagt gcctgtacag cctggaagcc atccctctgg aagatctgct gaacaacccc ttcaactatg aggtggacca catcatcccc agaagcgtgt ccttcgacaa cagcttcaac aacaaggtgc tcgtgaagca ggaagaaaac agcaagaagg gcaaccggac cccattccag tacctgagca gcagcgacag caagatcagc tacgaaacct tcaagaagca catcctgaat ctggccaagg gcaagggcag aatcagcaag accaagaaag agtatctgct ggaagaacgg gacatcaaca ggttctccgt gcagaaagac ttcatcaacc ggaacctggt ggataccaga tacgccacca gaggcctgat gaacctgctg cggagctact tcagagtgaa caacctggac gtgaaagtga agtccatcaa tggcggcttc accagctttc tgcggcggaa gtggaagttt aagaaagagc ggaacaaggg gtacaagcac cacgccgagg acgccctgat cattgccaac gccgatttca tcttcaaaga gtggaagaaa ctggacaagg ccaaaaaagt gatggaaaac cagatgttcg aggaaaagca ggccgagagc atgcccgaga tcgaaaccga gcaggagtac aaagagatct tcatcacccc ccaccagatc aagcacatta aggacttcaa ggactacaag tacagccacc gggtggacaa gaagcctaat agagagctga ttaacgacac cctgtactcc acccggaagg acgacaaggg caacaccctg atcgtgaaca atctgaacgg cctgtacgac aaggacaatg acaagctgaa aaagctgatc aacaagagcc ccgaaaagct gctgatgtac caccacgacc cccagaccta ccagaaactg aagctgatta tggaacagta cggcgacgag aagaatcccc tgtacaagta ctacgaggaa accgggaact acctgaccad gtactccaaa aaggacaacg gccccgtgat caagaagatt aagtattacg gcaacaaact gaacgcccat ctggacatca ccgacgacta ccccaacagc agaaacaagg tcgtgaagct gtccctgaag ccctacagat tcgacgtgta cctggacaat ggcgtgtaca agttcgtgac cgtgaagaat ctggatgtga tcaaaaaaga aaactactac gaagtgaata gcaagtgcta tgaggaagct aagaagctga agaagatcag caaccaggcc gagtttatcg cctccttcta caacaacgat ctgatcaaga tcaacggcga gctgtataga gtgatcggcg tgaacaacga cctgctgaac cggatcgaag tgaacatgat cgacatcacc taccgcgagt acctggaaaa catgaacgac aagaggcccc ccaggatcat taagacaatc gcctccaaga cccagagcat taagaagtac agcacagaca ttctgggcaa cctgtatgaa gtgaaatcta agaagcaccc tcagatcatc aaaaagggc SEQ ID NO: 18 codon optimized nucleic acid sequences encoding S. aureus Cas9 atgaagcgca actacatcct cggactggac atcggcatta cctccgtggg atacggcatc atcgattacg aaactaggga tgtgatcgac gctggagtca ggctgttcaa agaggcgaac gtggagaaca acgaggggcg gcgctcaaag aggggggccc gccggctgaa gcgccgccgc agacatagaa tccagcgcgt gaagaagctg ctgttcgact acaaccttct gaccgaccac tccgaacttt ccggcatcaa cccatatgag gctagagtga agggattgtc ccaaaagctg tccgaggaag agttctccgc cgcgttgctc cacctcgcca agcgcagggg agtgcacaat gtgaacgaag tggaagaaga taccggaaac gagctgtcca ccaaggagca gatcagccgg aactccaagg ccctggaaga gaaatacgtg gcggaactgc aactggagcg gctgaagaaa gacggagaag tgcgcggctc gatcaaccgc ttcaagacct cggactacgt gaaggaggcc aagcagctcc tgaaagtgca aaaggcctat caccaacttg accagtcctt tatcgatacc tacatcgatc tgctcgagac tcggcggact tactacgagg gtccagggga gggctcccca tttggttgga aggatattaa ggagtggtac gaaatgctga tgggacactg cacatacttc cctgaggagc tgcggagcgt gaaatacgca tacaacgcag acctgtacaa cgcgctgaac gacctgaaca atctcgtgat cacccgggac gagaacgaaa agctcgagta ttacgaaaag ttccagatta ttgagaacgt gttcaaacag aagaagaagc cgacactgaa gcagattgcc aaggaaatcc tcgtgaacga agaggacatc aagggctatc gagtgacctc aacgggaaag ccggagttca ccaatctgaa ggtctaccac gacatcaaag acattaccgc ccggaaggag atcattgaga acgcggagct gttggaccag attgcgaaga ttctgaccat ctaccaatcc tccgaggata ttcaggaaga actcaccaac ctcaacagcg aactgaccca ggaggagata gagcaaatct ccaacctgaa gggctacacc ggaactcata acctgagcct gaaggccatc aacttgatcc tggacgagct gtggcacacc aacgataacc agatcgctat tttcaatcgg ctgaagctgg tccccaagaa agtggacctc tcacaacaaa aggagatccc tactaccctt gtggacgatt tcattctgtc ccccgtggtc aagagaagct tcatacagtc aatcaaagtg atcaatgcca ttatcaagaa atacggtctg cccaacgaca ttatcattga gctcgcccgc gagaagaact cgaaggacgc ccagaagatg attaacgaaa tgcagaagag gaaccgacag actaacgaac ggatcgaaga aatcatccgg accaccggga aggaaaacgc gaagtacctg atcgaaaaga tcaagctccd tgacatgcag gaaggaaagt gtctgtactc gctggaggcc attccgctgg aggacttgct gaacaaccct tttaactacg aagtggatca tatcattccg aggagcgtgt cattcgacaa ttccttcaac aacaaggtcc tcgtgaagca ggaggaaaac tcgaagaagg gaaaccgcac gccgttccag tacctgagca gcagcgactc caagatttcc tacgaaacct tcaagaagca catcctcaac ctggcaaagg ggaagggtcg catctccaag accaagaagg aatatctgct ggaagaaaga gacatcaaca gattctccgt gcaaaaggac ttcatcaacc gcaacctcgt ggatactaga tacgctactc ggggtctgat gaacctcctg agaagctact ttagagtgaa caatctggac gtgaaggtca agtcgattaa cggaggtttc acctccttcc tgcggcgcaa gtggaagttc aagaaggaac ggaacaaggg ctacaagcac cacgccgagg acgccctgat cattgccaac gccgacttca tcttcaaaga atggaagaaa cttgacaagg ctaagaaggt catggaaaac cagatgttcg aagaaaagca ggccgagtct atgcctgaaa tcgagactga acaggagtac aaggaaatct ttattacgcc acaccagatc aaacacatca aggatttcaa ggattacaag tactcacatc gcgtggacaa aaagccgaac agggaactga tcaacgacac cctctactcc acccggaagg atgacaaagg gaataccctc atcgtcaaca accttaacgg cctgtacgac aaggacaacg ataagctgaa gaagctcatt aacaagtcgc ccgaaaagtt gctgatgtac caccacgacc ctcagactta ccagaagctc aagctgatca tggagcagta tggggacgag aaaaacccgt tgtacaagta ctacgaagaa actgggaatt atctgactaa gtactccaag aaagataacg gccccgtgat taagaagatt aagtactacg gcaacaagct gaacgcccat ctggacatca ccgatgacta ccctaattcc cgcaacaagg tcgtcaagct gagcctcaag ccctaccggt ttgatgtgta ccttgacaat ggagtgtaca agttcgtgac tgtgaagaac cttgacgtga tcaagaagga gaactactac gaagtcaact ccaagtgcta cgaggaagca aagaagttga agaagatctc gaaccaggcc gagttcattg cctccttcta taacaacgac ctgattaaga tcaacggcga actgtaccgc gtcattggcg tgaacaacga tctcctgaac cgcatcgaag tgaacatgat cgacatcact taccgggaat acctggagaa tatgaacgac aagcgcccgc cccggatcat taagactatc gcctcaaaga cccagtcgat caagaagtac agcaccgaca tcctgggcaa cctgtacgag gtcaaatcga agaagcaccc ccagatcatc aagaaggga SEQ ID NO: 19 codon optimized nucleic acid sequences encoding S. aureus Cas9 atggccccaaagaagaagcggaaggtcggtatccacggagtcccagcagccaagcggaactacatcct gggcctggacatcggcatcaccagcgtgggctacggcatcatcgactacgagacacgggacgtgatcg atgccggcgtgcggctgttcaaagaggccaacgtggaaaacaacgagggcaggcggagcaagagaggc gccagaaggctgaagcggcggaggcggcatagaatccagagagtgaagaagctgctgttcgactacaa cctgctgaccgaccacagcgagctgagcggcatcaacccctacgaggccagagtgaagggcctgagcc agaagctgagcgaggaagagttctctgccgccctgctgcacctggccaagagaagaggcgtgcacaac gtgaacgaggtggaagaggacaccggcaacgagctgtccaccagagagcagatcagccggaacagcaa ggccctggaagagaaatacgtggccgaactgcagctggaacggctgaagaaagacggcgaagtgcggg gcagcatcaacagattcaagaccagcgactacgtgaaagaagccaaacagctgctgaaggtgcagaag gcctaccaccagctggaccagagcttcatcgacacctacatcgacctgctggaaacccggcggaccta ctatgagggacctggcgagggcagccccttcggctggaaggacatcaaagaatggtacgagatgctga tgggccactgcacctacttccccgaggaactgcggagcgtgaagtacgcctacaacgccgacctgtac aacgccctgaacgacctgaacaatctcgtgatcaccagggacgagaacgagaagctggaatattacga gaagttccagatcatcgagaacgtgttcaagcagaagaagaagcccaccctgaagcagatcgccaaag aaatcctcgtgaacgaagaggatattaagggctacagagtgaccagcaccggcaagcccgagttcacc aacctgaaggtgtaccacgacatcaaggacattaccgcccggaaagagattattgagaacgccgagct gctggatcagattgccaagatcctgaccatctaccagagcagcgaggacatccaggaagaactgacca atctgaactccgagctgacccaggaagagatcgagcagatctctaatctgaagggctataccggcacc cacaacctgagcctgaaggccatcaacctgatcctggacgagctgtggcacaccaacgacaaccagat cgctatcttcaaccggctgaagctggtgcccaagaaggtggacctgtcccagcagaaagagatcccca ccaccctggtggacgacttcatcctgagccccgtcgtgaagagaagcttcatccagagcatcaaagtg atcaacgccatcatcaagaagtacggcctgcccaacgacatcattatcgagctggcccgcgagaagaa ctccaaggacgcccagaaaatgatcaacgagatgcagaagcggaaccggcagaccaacgagcggatcg aggaaatcatccggaccaccggcaaagagaacgccaagtacctgatcgagaagatcaagctgcacgac atgcaggaaggcaagtgcctgtacagcctggaagccatccctctggaagatctgctgaacaacccctt caactatgaggtggaccacatcatccccagaagcgtgtccttcgacaacagcttcaacaacaaggtgc tcgtgaagcaggaagaaaacagcaagaagggcaaccggaccccattccagtacctgagcagcagcgac agcaagatcagctacgaaaccttcaagaagcacatcctgaatctggccaagggcaagggcagaatcag caagaccaagaaagagtatctgctggaagaacgggacatcaacaggttctccgtgcagaaagacttca tcaaccggaacctggtggataccagatacgccaccagaggcctgatgaacctgctgcggagctacttc agagtgaacaacctggacgtgaaagtgaagtccatcaatggcggcttcaccagctttctgcggcggaa gtggaagtttaagaaagagcggaacaaggggtacaagcaccacgccgaggacgccctgatcattgcca acgccgatttcatcttcaaagagtggaagaaactggacaaggccaaaaaagtgatggaaaaccagatg ttcgaggaaaggcaggccgagagcatgcccgagatcgaaaccgagcaggagtacaaagagatcttcat caccccccaccagatcaagcacattaaggacttcaaggactacaagtacagccaccgggtggacaaga agcctaatagagagctgattaacgacaccctgtactccacccggaaggacgacaagggcaacaccctg atcgtgaacaatctgaacggcctgtacgacaaggacaatgacaagctgaaaaagctgatcaacaagag ccccgaaaagctgctgatgtaccaccacgacccccagacctaccagaaactgaagctgattatggaac agtacggcgacgagaagaatcccctgtacaagtactacgaggaaaccgggaactacctgaccaagtac tccaaaaaggacaacggccccgtgatcaagaagattaagtattacggcaacaaactgaacgcccatct ggacatcaccgacgactaccccaacagcagaaacaaggtcgtgaagctgtccctgaagccctacagat tcgacgtgtacctggacaatggcgtgtacaagttcgtgaccgtgaagaatctggatgtgatcaaaaaa gaaaactactacgaagtgaatagcaagtgctatgaggaagctaagaagctgaagaagatcagcaacca ggccgagtttatcgcctccttctacaacaacgatctgatcaagatcaacggcgagctgtatagagtga tcggcgtgaacaacgacctgctgaaccggatcgaagtgaacatgatcgacatcacctaccgcgagtac ctggaaaacatgaacgacaagaggccccccaggatcattaagacaatcgcctccaagacccagagcat taagaagtacagcacagacattctgggcaacctgtatgaagtgaaatctaagaagcaccctcagatca tcaaaaagggcaaaaggccggcggccacgaaaaaggccggccaggcaddaaagaddaag SEQ ID NO: 20 codon optimized nucleic acid sequences encoding S. aureus Cas9 accggtgcca ccatgtaccc atacgatgtt ccagattacg cttcgccgaa gaaaaagcgc aaggtcgaag cgtccatgaa aaggaactac attctggggc tggacatcgg gattacaagc gtggggtatg ggattattga ctatgaaaca agggacgtga tcgacgcagg cgtcagactg ttcaaggagg ccaacgtgga aaacaatgag ggacggagaa gcaagagggg agccaggcgc ctgaaacgac ggagaaggca cagaatccag agggtgaaga aactgctgtt cgattacaac ctgctgaccg accattctga gctgagtgga attaatcctt atgaagccag ggtgaaaggc ctgagtcaga agctgtcaga ggaagagttt tccgcagctc tgctgcacct ggctaagcgc cgaggagtgc ataacgtcaa tgaggtggaa gaggacaccg gcaacgagct gtctacaaag gaacagatct cacgcaatag caaagctctg gaagagaagt atgtcgcaga gctgcagctg gaacggctga agaaagatgg cgaggtgaga gggtcaatta ataggttcaa gacaagcgac tacgtcaaag aagccaagca gctgctgaaa gtgcagaagg cttaccacca gctggatcag agcttcatcg atacttatat cgacctgctg gagactcgga gaacctacta tgagggacca ggagaaggga gccccttcgg atggaaagac atcaaggaat ggtacgagat gctgatggga cattgcacct attttccaga agagctgaga agcgtcaagt acgcttataa cgcagatct tacaacgccc tgaatgacct gaacaacctg gtcatcacca gggatgaaaa cgagaaactg gaatactatg agaagttcca gatcatcgaa aacgtgttta agcagaagaa aaagcctaca ctgaaacaga ttgctaagga gatcctggtc aacgaagagg acatcaaggg ctaccgggtg acaagcactg gaaaaccaga gttcaccaat ctgaaagtgt atcacgatat taaggacatc acagcacgga aagaaatcat tgagaacgcc gaactgctgg atcagattgc taagatcctg actatctacc agagctccga ggacatccag gaagagctga ctaacctgaa cagcgagctg acccaggaag agatcgaaca gattagtaat ctgaaggggt acaccggaac acacaacctg tccctgaaag ctatcaatct gattctggat gagctgtggc atacaaacga caatcagatt gcaatcttta accggctgaa gctggtccca aaaaaggtgg acctgagtca gcagaaagag atcccaacca cactggtgga cgatttcatt ctgtcacccg tggtcaagcg gagcttcatc cagagcatca aagtgatcaa cgccatcatc aagaagtacg gcctgcccaa tgatatcatt atcgagctgg ctagggagaa gaacagcaag gacgcacaga agatgatcaa tgagatgcag aaacgaaacc ggcagaccaa tgaacgcatt gaagagatta tccgdactac cgcmaaagag aacgcaaagt acctgattga aaaaatcaag ctgcacgata tgcaggaggg aaagtgtctg tattctctgg aggccatccc cctggaggac ctgctgaaca atccattcaa ctacgaggtc gatcatatta tccccagaag cgtgtccttc gacaattcct ttaacaacaa ggtgctggtc aagcaggaag agaactctaa aaagggcaat aggactcctt tccagtacct gtctagttca gattccaaga tctcttacga aacctttaaa aagcacattc tgaatctggc caaaggaaag ggccgcatca gcaagaccaa aaaggagtac ctgctggaag agcgggacat caacagattc tccgtccaga aggattttat taaccggaat ctggtggaca caagatacgc tactcgcggc ctgatgaatc tgctgcgatc ctatttccgg gtgaacaatc tggatgtgaa agtcaagtcc atcaacggcg ggttcacatc ttttctgagg cgcaaatgga agtttaaaaa ggagcgcaac aaagggtaca agcaccatgc cgaagatgct ctgattatcg caaatgccga cttcatcttt aaggagtgga aaaagctgga caaagccaag aaagtgatgg agaaccagat gttcgaagag aagcaggccg aatctatgcc cgaaatcgag acagaacagg agtacaagga gattttcatc actcctcacc agatcaagca tatcaaggat ttcaaggact acaagtactc tcaccgggtg gataaaaagc ccaacagaga gctgatcaat gacaccctgt atagtacaag aaaagacgat aaggggaata ccctgattgt gaacaatctg aacggactgt acgacaaaga taatgacaag ctgaaaaagc tgatcaacaa aagtcccgag aagctgctga tgtaccacca tgatcctcag acatatcaga aactgaagct gattatggag cagtacggcg acgagaagaa cccactgtat aagtactatg aagagactgg gaactacctg accaagtata gcaaaaagga taatggcccc gtgatcaaga agatcaagta ctatgggaac aagctgaatg cccatctgga catcacagac gattacccta acagtcgcaa caaggtggtc aagctgtcac tgaagccata cagattcgat gtctatctgg acaacggcgt gtataaattt gtgactgtca agaatctgga tgtcatcaaa aaggagaact actatgaagt gaatagcaag tgctacgaag aggctaaaaa gctgaaaaag attagcaacc aggcagagtt catcgcctcc ttttacaaca acgacctgat taagatcaat ggcgaactgt atagggtcat cggggtgaac aatgatctgc tgaaccgcat tgaagtgaat atgattgaca tcacttaccg agagtatctg gaaaacatga atgataagcg cccccctcga attatcaaaa caattgcctc taagactcag agtatcaaaa agtactcaac cgacattctg ggaaacctgt atgaggtgaa gagcaaaaag caccctcaga ttatcaaaaa gggctaagaa ttc SEQ ID NO: 21 Amino acid sequence of codon optimized nucleic acid sequence encoding S. aureus Cas9 MKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRRRHRIQRVK KLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEEDTGNELSTKE QISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQKAYHQLDQSFIDTYIDL LETRRTYYEGPGEGSPFGWDKIKEWYEMLMGHCTYFPEELRSVKYAYNADLYNALNDLNNLVITRDEN EKLEYYEKFQIIENVFKQKKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKE IIENAELLDQIAKILTIYQSSEDIQEELTNLNSELTQEEIEQISNLKGYTGTHNLSLKAINLILDELW HTNDNQIAIFNRLKLVPKKVDLSQQKEIPTTLVDDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIII ELAREKNSKDAQKMINEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLEAIPLE DLLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEENSKKGNRTPFQYLSSSDSKISYETFKKHILNLA KGKGRISKTKKEYLLEERDINRFSVQKDFINRNLVDTRYATRGLMNLLRSYFRVNNLDVKVKSINGGF TSFLRRKWKFKKERNKGYKHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFEEKQAESMPEIETEQ EYKEIFITPHQIKHIKDFKDYKYSHRVDKKPNRELINDTLYSTRKDDKGNTLIVNYLNGLYDKDNDKL KKLINKSPEKLLMYHHDPQTYQKLKLMIEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYG NKLNAHLDITDDYPNSRNKVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKCYEEAKK LKKISNQAEFIASFYNNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKTI ASKTQSIKKYSTDILGNLYEVKSKKHPQIIKKG SEQ ID NO: 22 Polynucleotide sequence of D10A mutant of S. aureus Cas9 atgaaaagga actacattct ggggctggcc atcgggatta caagcgtggg gtatgggatt attgactatg aaacaaggga cgtgatcgac gcaggcgtca gactgttcaa ggaggccaac gtggaaaaca atgagggacg gagaagcaag aggggagcca ggcgcctgaa acgacggaga aggcacagaa tccagagggt gaagaaactg ctgttcgatt acaacctgct gaccgaccat tctgagctga gtggaattaa tccttatgaa gccagggtga aaggcctgag tcagaagctg tcagaggaag agttttccgc agctctgctg cacctggcta agcgccgagg agtgcataac gtcaatgagg tggaagagga caccggcaac gagctgtcta caaaggaaca gatctcacgc aatagcaaag ctctggaaga gaagtatgtc gcagagctgc agctggaacg gctgaagaaa gatggcgagg tgagagggtc aattaatagg ttcaagacaa gcgactacgt caaagaagcc aagcagctgc tgaaagtgca gaaggcttac caccagctgg atcagagctt catcgatact tatatcgacc tgctggagac tcggagaacc tactatgagg gaccaggaga agggagcccc ttcggatgga aagacatcaa ggaatggtac gagatgctga tgggacattg cacctatttt ccagaagagc tgagaagcgt caagtacgct tataacgcag atctgtacaa cgccctgaat gacctgaaca acctggtcat caccagggat gaaaacgaga aactggaata ctatgagaag ttccagatca tcgaaaacgt gtttaagcag aagaaaaagc ctacactgaa acagattgct aaggagatcc tggtcaacga agaggacatc aagggctacc gggtgacaag cactggaaaa ccagagttca ccaatctgaa agtgtatcac gatattaagg acatcacagc acggaaagaa atcattgaga acgccgaact gctggatcag attgctaaga tcctgactat ctaccagagc tccgaggaca tccaggaaga gctgactaac ctgaacagcg agctgaccca ggaagagatc gaacagatta gtaatctgaa ggggtacacc ggaacacaca acctgtccct gaaagctatc aatctgattc tggatgagct gtggcataca aacgacaatc agattgcaat ctttaaccgg ctgaagctgg tcccaaaaaa ggtggacctg agtcagcaga aagagatccc aaccacactg gtggacgatt tcattctgtc acccgtggtc aagcggagct tcatccagag catcaaagtg atcaacgcca tcatcaagad gtacggcctg cccaatgata tcattatcga gctggctagg gagaagaaca gcaaggacgc acagaagatg atcaatgaga tgcagaaacg aaaccggcag accaatgaac gcattgaaga gattatccga actaccggga aagagaacgc aaagtacctg attgaaaaaa tcaagctgca cgatatgcag gagggaaagt gtctgtattc tctggaggcc atccccctgg aggacctgct gaacaatcca ttcaactacg aggtcgatca tattatcccc agaagcgtgt ccttcgacaa ttcctttaac aacaaggtgc tggtcaagca ggaagagaac tctaaaaagg gcaataggac tcctttccag tacctgtcta gttcagattc caagatctct tacgaaacct ttaaaaagca cattctgaat ctggccaaag gaaagggccg catcagcaag accaaaaagg agtacctgct ggaagagcgg gacatcaaca gattctccgt ccagaaggat tttattaacc ggaatctggt ggacacaaga tacgctactc gcggcctgat gaatctgctg cgatcctatt tccgggtgaa caatctggat gtgaaagtca agtccatcaa cggcgggttc acatcttttc tgaggcgcaa atggaagttt aaaaaggagc gcaacaaagg gtacaagcac catgccgaag atgctctgat tatcgcaaat gccgacttca tctttaagga gtggaaaaag ctggacaaag ccaagaaagt gatggagaac cagatgttcg aagagaagca ggccgaatct atgcccgaaa tcgagacaga acaggagtac aaggagattt tcatcactcc tcaccagatc aagcatatca aggatttcaa ggactacaag tactctcacc gggtggataa aaagcccaac agagagctga tcaatgacac cctgtatagt acaagaaaag acgataaggg gaataccctg attgtgaaca atctgaacgg actgtacgac aaagataatg acaagctgaa aaagctgatc aacaaaagtc ccgagaagct gctgatgtac caccatgatc ctcagacata tcagaaactg aagctgatta tggagcagta cggcgacgag aagaacccac tgtataagta ctatgaagag actgggaact acctgaccaa gtatagcaaa aaggataatg gccccgtgat caagaagatc aagtactatg ggaacaagct gaatgcccat ctggacatca cagacgatta ccctaacagt cgcaacaagg tggtcaagct gtcactgaag ccatacagat tcgatgtcta tctggacaac ggcgtgtata aatttgtgac tgtcaagaat ctggatgtca tcaaaaagga gaactactat gaagtgaata gcaagtgcta cgaagaggct daaaagctga aaaagattag caaccaggca gagttcatcg cctcctttta caacaacgac ctgattaaga tcaatggcga actgtatagg gtcatcgggg tgaacaatga tctgctgaac cgcattgaag tgaatatgat tgacatcact taccgagagt atctggaaaa catgaatgat aagcgccccc ctcgaattat caaaacaatt gcctctaaga ctcagagtat caaaaagtac tcaaccgaca ttctgggaaa cctgtatgag gtgaagagca aaaagcaccc tcagattatc aaaaagggc SEQ ID NO: 23 Polynucleotide sequence of N580A mutant of S. aureus Cas9 atgaaaagga actacattct ggggctggac atcgggatta caagcgtggg gtatgggatt attgactatg aaacaaggga cgtgatcgac gcaggcgtca gactgttcaa ggaggccaac gtggaaaaca atgagggacg gagaagcaag aggggagcca ggcgcctgaa acgacggaga aggcacagaa tccagagggt gaagaaactg ctgttcgatt acaacctgct gaccgaccat tctgagctga gtggaattaa tccttatgaa gccagggtga aaggcctgag tcagaagctg tcagaggaag agttttccgc agctctgctg cacctggcta agcgccgagg agtgcataac gtcaatgagg tggaagagga caccggcaac gagctgtcta caaaggaaca gatctcacgc aatagcaaag ctctggaaga gaagtatgtc gcagagctgc agctggaacg gctgaagaaa gatggcgagg tgagagggtc aattaatagg ttcaagacaa gcgactacgt caaagaagcc aagcagctgc tgaaagtgca gaaggcttac caccagctgg atcagagctt catcgatact tatatcgacc tgctggagac tcggagaacc tactatgagg gaccaggaga agggagcccc ttcggatgga aagacatcaa ggaatggtac gagatgctga tgggacattg cacctatttt ccagaagagc tgagaagcgt caagtacgct tataacgcag atctgtacaa cgccctgaat gacctgaaca acctggtcat caccagggat gaaaacgaga aactggaata ctatgagaag ttccagatca tcgaaaacgt gtttaagcag aagaaaaagc ctacactgaa acagattgct aaggagatcc tggtcaacga agaggacatc aagggctacc gggtgacaag cactggaaaa ccagagttca ccaatctgaa agtgtatcac gatattaagg acatcacagc acggaaagaa atcattgaga acgccgaact gctggatcag attgctaaga tcctgactat ctaccagagc tccgaggaca tccaggaaga gctgactaac ctgaacagcg agctgaccca ggaagagatc gaacagatta gtaatctgaa ggggtacacc ggaacacaca acctgtccct gaaagctatc aatctgattc tggatgagct gtggcataca aacgacaatc agattgcaat ctttaaccgg ctgaagctgg tcccaaaaaa ggtggacctg agtcagcaga aagagatccc aaccacactg gtggacgatt tcattctgtc acccgtggtc aagcggagct tcatccagag catcaaagtg atcaacgcca tcatcaagaa gtacggcctg cccaatgata tcattatcga gctggctagg gagaagaaca gcaaggacgc acagaagatg atcaatgaga tgcagaaacg aaaccggcag accaatgaac gcattgaaga gattatccga actaccggga aagagaacgc aaagtacctg attgaaaaaa tcaagctgca cgatatgcag gagggaaagt gtctgtattc tctggaggcc atccccctgg aggacctgct gaacaatcca ttcaactacg aggtcgatca tattatcccc agaagcgtgt ccttcgacaa ttcctttaac aacaaggtgc tggtcaagca ggaagaggcc tctaaaaagg gcaataggac tcctttccag tacctgtcta gttcagattc caagatctct tacgaaacct ttaaaaagca cattctgaat ctggccaaag gaaagggccg catcagcaag accaaaaagg agtacctgct ggaagagcgg gacatcaaca gattctccgt ccagaaggat tttattaacc ggaatctggt ggacacaaga tacgctactc gcggcctgat gaatctgctg cgatcctatt tccgggtgaa caatctggat gtgaaagtca agtccatcaa cggcgggttc acatcttttc tgaggcgcaa atggaagttt aaaaaggagc gcaacaaagg gtacaagcac catgccgaag atgctctgat tatcgcaaat gccgacttca tctttaagga gtggaaaaag ctggacaaag ccaagaaagt gatggagaac cagatgttcg aagagaagca ggccgaatct atgcccgaaa tcgagacaga acaggagtac aaggagattt tcatcactcc tcaccagatc aagcatatca aggatttcaa ggactacaag tactctcacc gggtggataa aaagcccaac agagagctga tcaatgacac cctgtatagt acaagaaaag acgataaggg gaataccctg attgtgaaca atctgaacgg actgtacgac aaagataatg acaagctgaa aaagctgatc aacaaaagtc ccgagaagct gctgatgtac caccatgatc ctcagacata tcagaaactg aagctgatta tggagcagta cggcgacgag aagaacccac tgtataagta ctatgaagag actgggaact acctgaccaa gtatagcaaa aaggataatg gccccgtgat caagaagatc aagtactatg ggaacaagct gaatgcccat ctggacatca cagacgatta ccctaacagt cgcaacaagg tggtcaagct gtcactgaag ccatacagat tcgatgtcta tctggacaac ggcgtgtata aatttgtgac tgtcaagaat ctggatgtca tcaaaaagga gaactactat gaagtgaata gcaagtgcta cgaagaggct aaaaagctga aaaagattag caaccaggca gagttcatcg cctcctttta caacaacgac ctgattaaga tcaatggcga actgtatagg gtcatcgggg tgaacaatga tctgctgaac cgcattgaag tgaatatgat tgacatcact taccgagagt atctggaaaa catgaatgat aagcgccccc ctcgaattat caaaacaatt gcctctaaga ctcagagtat caaaaagtac tcaaccgaca ttctgggaaa cctgtatgag gtgaagagca aaaagcaccc tcagattatc aaaaagggc SEQ ID NO: 24 codon optimized nucleic acid sequences encoding S. aureus Cas9 atggccccaaagaagaagcggaaggtcggtatccacggagtcccagcagccaagcggaactacatcct gggcctggacatcggcatcaccagcgtgggctacggcatcatcgactacgagacacgggacgtgatcg atgccggcgtgcggctgttcaaagaggccaacgtggaaaacaacgagggcaggcggagcaagagaggc gccagaaggctgaagcggcggaggcggcatagaatccagagagtgaagaagctgctgttcgactacaa cctgctgaccgaccacagcgagctgagcggcatcaacccctacgaggccagagtgaagggcctgagcc agaagctgagcgaggaagagttctctgccgccctgctgcacctggccaagagaagaggcgtgcacaac gtgaacgaggtggaagaggacaccggcaacgagctgtccaccaaagagcagatcagccggaacagcaa ggccctggaagagaaatacgtggccgaactgcagctggaacggctgaagaaagacggcgaagtgcggg gcagcatcaacagattcaagaccagcgactacgtgaaagaagccaaacagctgctgaaggtgcagaag gcctaccaccagctggaccagagcttcatcgacacctacatcgacctgctggaaacccggcggaccta ctatgagggacctggcgagggcagccccttcggctggaaggacatcaaagaatggtacgagatgctga tgggccactgcacctacttccccgaggaactgcggagcgtgaagtacgcctacaacgccgacctgtac aacgccctgaacgacctgaacaatctcgtgatcaccagggacgagaacgagaagctggaatattacga gaagttccagatcatcgagaacgtgttcaagcagaagaagaagcccaccctgaagcagatcgccaaag aaatcctcgtgaacgaagaggatattaagggctacagagtqaccagcaccggcaagcccgagttcacc aacctgaaggtgtaccacgacatcaaggacattaccgcccggaaagagattattgagaacgccgagct gctggatcagattgccaagatcctgaccatctaccagagcagcgaggacatccaggaagaactgacca atctgaactccgagctgacccaggaagagatcgagcagatctctaatctgaagggctataccggcacc cacaacctgagcctgaaggccatcaacctgatcctggacgagctgtggcacaccaacgacaaccagat cgctatcttcaaccggctgaagctggtgcccaagaaggtggacctgtcccagcagaaagagatcccca ccaccctggtggacgacttcatcctgagccccgtcgtgaagagaagcttcatccagagcatcaaagtg atcaacgccatcatcaagaagtacggcctgcccaacgacatcattatcgagctggcccgcgagaagaa ctccaaggacgcccagaaaatgatcaacgagatgcagaagcggaaccggcagaccaacgagcggatcg aggaaatcatccggaccaccggcaaagagaacgccaagtacctgatcgagaagatcaagctgcacgac atgcaggaaggcaagtgcctgtacagcctggaagccatccctctggaagatctgctgaacaacccctt caactatgaggtggaccacatcatccccagaagcgtgtccttcgacaacagcttcaacaacaaggtgc tcgtgaagcaggaagaaaacagcaagaagggcaaccggaccccattccagtacctgagcagcagcgac agcaagatcagctacgaaaccttcaagaagcacatcctgaatctggccaagggcaagggcagaatcag caagaccaagaaagagtatctgctggaagaacgggacatcaacaggttctccgtgcagaaagacttca tcaaccggaacctggtggataccagatacgccaccagaggcctgatgaacctgctgcggagctacttc agagtgaacaacctggacgtgaaagtgaagtccatcaatggcggcttcaccagctttctgcggcggaa gtggaagtttaagaaagagcggaacaaggggtacaagcaccacgccgaggacgccctgatcattgcca acgccgatttcatcttcaaagagtggaagaaactggacaaggccaaaaaagtgatggaaaaccagatg ttcgaggaaaagcaggccgagagcatgcccgagatcgaaaccgagcaggagtacaaagagatcttcat caccccccaccagatcaagcacattaaggacttcaaggactacaagtacagccaccgggtggacaaga agcctaatagagagctgattaacgacaccctgtactccacccggaaggacgacaagggcaacaccctg atcgtgaacaatctgaacggcctgtacgacaaggacaatgacaagctgaaaaagctgatcaacaagag ccccgaaaagctgctgatgtaccaccacgacccccagacctaccagaaactgaagctgattatggaac aggacggcgacgagaagaatcccctgtacaagtactacgaggaaaccgggaactacctgaccaagtac tccaaaaaggacaacggccccgtgatcaagaagattaagtattacggcaacaaactgaacgcccatct ggacatcaccgacgactaccccaacagcagaaacaaggtcgtgaagctgtccctgaagccctacagat tcgacgtgtacctggacaatggcgtgtacaagttcgtgaccgtgaagaatctggatgtgatcaaaaaa gaaaactactacgaagtgaatagcaagtgctatgaggaagctaagaagctgaagaagatcagcaacca ggccgagtttatcgcctccttctacaacaacgatctgatcaagatcaacggcgagctgtatagagtga tcggcgtgaacaacgacctgctgaaccggatcgaagtgaacatgatcgacatcacctaccgcgagtac ctggaaaacatgaacgacaagaggccccccaggatcattaagacaatcgcctccaagacccagagcat taagaagtacagcacagacattctgggcaacctgtatgaagtgaaatctaagaagcaccctcagatca tcaaaaagggcaaaaggccggcggccacgaaaaaggccggccaggcaaaaaagaaaaag SEQ ID NO: 25 codon optimized nucleic acid sequences encoding S. aureus Cas9 aagcggaactacatcctgggcctggacatcggcatcaccagcgtgggctacggcateatcgactacga gacacgggacgtgatcgatgccggcgtgcggctgttcaaagaggccaacgtggaaaacaacgagggca ggcggagcaagagaggcgccagaaggctgaagcggcggaggcggcatagaatccagagagtgaagaag ctgctgttcgactacaacctgctgaccgaccacagcgagctgagcggcatcaacccctacgaggccag agtgaagggcctgagccagaagctgagcgaggaagagttctctgccgccctgctgcacctggccaaga gaagaggcgtgcacaacgtgaacgaggtggaagaggacaccggcaacgagctgtccaccaaagagcag atcagccggaacagcaaggccctggaagagaaatacgtggccgaactgcagctggaacggctgaagaa agacggcgaagtgcggggcagcatcaacagattcaagaccagcgactacgtgaaagaagccaaacagc tgctgaaggtgcagaaggcctaccaccagctggaccagagcttcatcgacacctacatcgacctgctg gaaacccggcggacctactatgagggacctggcgagggcagccccttcggctggaaggacatcaaaga atggtacgagatgctgatgggccactgcacctacttccccgaggaactgcggagcgtgaagtacgcct acaacgccgacctgtacaacgccctgaacgacctgaacaatctcgtgatcaccagggacgagaacgag aagctggaatattacgagaagttccagatcatcgagaacgtgttcaagcagaagaagaagcccaccct gaagcagatcgccaaagaaatcctcgtgaacgaagaggatattaagggctacagagtgaccagcaccg gcaagcccgagttcaccaacctgaaggtgtaccacgacatcaaggacattaccgcccggaaagagatt attgagaacgccgagctgctggatcagattgccaagatcctgaccatctaccagagcagcgaggacat ccaggaagaactgaccaatctgaactccgagctgacccaggaagagatcgagcagatctctaatctga agggctataccggcacccacaacctgagcctgaaggccatcaacctgatcctggacgagctgtggcac accaacgacaaccagatcgctatcttcaaccggctgaagctggtgcccaagaaggtggacctgtccca gcagaaagagatccccaccaccctggtggacgacttcatcctgagccccgtcgtgaagagaagcttca tccagagcatcaaagtgatcaacgccatcatcaagaagtacggcctgcccaacgacatcattatcgag ctggcccgcgagaagaactccaaggacgcccagaaaatgatcaacgagatgcagaagcggaaccggca gaccaacgagcggatcgaggaaatcatccggaccaccggcaaagagaacgccaagtacctgatcgaga agatcaagctgcacgacatgcaggaaggcaagtgcctgtacagcctggaagccatccctctggaagat ctgctgaacaaccccttcaactatgaggtggaccacatcatccccagaagcgtgtccttcgacaacag cttcaacaacaaggtgctcgtgaagcaggaagaaaacagcaagaagggcaaccggaccccattccagt acctgagcagcagcgacagcaagatcagctacgaaaccttcaagaagcacatcctgaatctggccaag ggcaagggcagaatcagcaagaccaagaaagagtatctgctggaagaacgggacatcaacaggttctc cgtgcagaaagacttcatcaaccggaacctggtggataccagatacgccaccagaggcctgatgaacc tgctgcggagctacttcagagtgaacaacctggacgtgaaagtgaagtccatcaatggcggcttcacc agctttctgcggcggaagtggaagtttaagaaagagcggaacaaggggtacaageaccacgccgagga cgccctgatcattgccaacgccgatttcatcttcaaagagtggaagaaactggacaaggccaaaaaag tgatggaaaaccagatgttcgaggaaaagcaggccgagagcatgcccgagatcgaaaccgagcaggag tacaaagagatcttcatcaccccccaccagatcaagcacattaaggacttcaaggactacaagtacaq ccaccgggtggacaagaagcctaatagagagctgattaacgacaccctgtactccacccggaaggacg acaagggcaacaccctgatcgtgaacaatctgaacggcctgtacgacaaggacaatgacaagctgaaa aagctgatcaacaagagccccgaaaagctgctgatgtaccaccacgacccccagacctaccagaaact gaagctgattatggaacagtacggcgacgagaagaatcccctgtacaagtactacgaggaaaccggga actacctgaccaagtactccaaaaaggacaacggccccgtgatcaagaagattaagtattacggcaac aaactgaacgcccatctggacatcaccgacgactaccccaacagcagaaacaaggtcgtgaagctgtc cctgaagccctacagattcgacgtgtacctggacaatggcgtgtacaagttcgtgaccgtgaagaatc tggatgtgatcaaaaaagaaaactactacgaagtgaacagcaagtgctatgaggaagctaagaagctg aagaagatcagcaaccaggccgagtttatcgcctccttctacaacaacgatctgatcaagatcaacgg cgagctgtatagagtgatcggcgtgaacaacgacctgctgaaccggatcgaagtgaacatgatcgaca tcacctaccgcgagtacctggaaaacatgaacgacaagaggccccccaggatcattaagacaatcgcc tccaagacccagagcattaagaagtacagcacagacattctgggcaacctgtatgaagtgaaatctaa gaagcaccctcagatcatcaaaaagggc SEQ ID NO: 26 Amino acid sequence of codon optimized nucleic acid sequences encoding S. aureus Cas9 KRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRRRHRIQRVKK LLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEEDTGNELSTKEQ ISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQKAYHQLDQSFIDTYIDLL ETRPTYYEGPGEGSPFGWKDIKEWYEMLMGHCTYFPEELRSVKYAYNADLYNALNDLNNLVITRDENE KLEYYEKFQIIENVFKQKKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEI IENAELLDQIAKILTIYQSSEDIQEELTNLNSELTQEEIEQISNLKGYTGTHNLSLKAINLILDELWH TNDNQIAIFNRLKLVPKKVDLSQQKEIPTTLVDDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIE LAREKNSKDAQKMINEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLEAIPLED LLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEENSKKGNRTPFQYLSSSDSKISYETFKKHILNLAK GKGRISKTKKEYLLEERDINRFSVQKDFINRNLVDTRYATRGLMNLLRSYFRVNNLDVKVKSINGGFT SFLRRKWKFKKERNKGYKHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFEEKQAESMPEIETEQE YKEIFITPHQIKHIKDFKDYKYSHRVDKKPNRELINDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLK KLINKSPEKLLMYHHDPQTYQKLKLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPIIKKIKYYGN KLNAHLDITDDYPNSRNKVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKCYEEAKKL KKISNQAEFIASFYNNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKTIA SKTQSIKKYSTDILGNLYLTVKSKKHPQIIKKG SEQ ID NO: 27 Vector (pD0242) encoding codon optimized nucleic add sequences encoding S. aureus Cas9 ctaaattgtaagcgttaatattttgttaaaattcgcgttaaatttttgttaaatcagctcatttttta accaataggccgaaatcggcaaaatcccttataaatcaaaagaatagaccgagatagggttgagtgtt gttccagtttggaacaagagtccactattaaagaacgtggactccaacgtcaaagggcgaaaaaccgt ctatcagggcgatggcccactacgtgaaccatcaccctaatcaagttttttggggtcgaggtgccgta aagcactaaatcggaaccctaaagggagcccccgatttagagcttgacggggaaagccggcgaacgtg gcgagaaaggaagggaagaaagcgaaaggagcgggcgctagggcgctggcaagtgtagcggtcacgct gcgcgtaaccaccacacccgccgcgcttaatgcgccgctacagggcgcgtcccattcgccattcaggc tgcgcaactgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaaggggga tgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacgacggc cagtgagcgcgcgtaatacgactcactatagggcgaattgggtacCtttaattctagtactatgcaTg cgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccata tatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcc cattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgg gtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtacgccccc tattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttatgggactttc ctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacatc aatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggag tttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaacaactccgccccattgacgcaaa tgggcggtaggegtgtaeggtgggaggtctatataagcagagctctctggctaactaccggtgccacc ATGAAAAGGAACTACATTCTGGGGCTGGACATCGGGATTACAAGCGTGGGGTATGGGATTATTGACTA TGAAACAAGGGACGTGATCGACGCAGGCGTCAGACTGTTCAAGGAGGCCAACGTGGAAAACAATGAGG GACGGAGAAGCAAGAGGGGAGCCAGGCGCCTGAAACGACGGAGAAGGCACAGAATCCAGAGGGTGAAG AAACTGCTGTTCGATTACAACCTGCTGACCGACCATTCTGAGCTGAGTGGAATTAATCCTTATGAAGC CAGGGTGAAAGGCCTGAGTCAGAAGCTGTCAGAGGAAGAGTTTTCCGCAGCTCTGCTGCACCTGGCTA AGCGCCGAGGAGTGCATAACGTCAATGAGGTGGAAGAGGACACCGGCAACGAGCTGTCTACAAAGGAA CAGATCTCACGCAATAGCAAAGCTCTGGAAGAGAAGTATGTCGCAGAGCTGCAGCTGGAACGGCTGAA GAAAGATGGCGAGGTGAGAGGGTCAATTAATAGGTTCAAGACAAGCGACTAGGTCAAAGAAGCCAAGC AGCTGCTGAAAGTGCAGAAGGCTTACCACCAGCTGGATCAGAGCTTCATCGATACTTATATCGACCTG CTGGAGACTCGGAGAACCTACTATGAGGGACCAGGAGAAGGGAGCCCCTTCGGATGGAAAGACATCAA GGAATGGTACGAGATGCTGATGGGACATTGCACCTATTTTCCAGAAGAGCTGAGAAGCGTCAAGTACG CTTATAACGCAGATCTGTACAACGCCCTGAATGACCTGAACAACCTGGTCATCACCAGGGATGAAAAC GAGAAACTGGAATACTATGAGAAGTTCCAGATCATCGAAAACGTGTTTAAGCAGAAGAAAAAGCCTAC ACTGAAACAGATTGCTAAGGAGATCCTGGTCAACGAAGAGGACATCAAGGGCTACCGGGTGACAAGCA CTGGAAAACCAGAGTTCACCAATCTGAAAGTGTATCACGATATTAAGGACATCACAGCACGGAAAGAA ATCATTGAGAACGCCGAACTGCTGGATCAGATTGCTAAGATCCTGACTATCTACCAGAGCTCCGAGGA CATCCAGGAAGAGCTGACTAACCTGAACAGCGAGCTGACCCAGGAAGAGATCGAACAGATTAGTAATC TGAAGGGGTACACCGGAACACACAACCTGTCCCTGAAAGCTATCAATCTGATTCTGGATGAGCTGTGG CATACAAACGACAATCAGATTGCAATCTTTAACCGGCTGAAGCTGGTCCCAAAAAAGGTGGACCTGAG TCAGCAGAAAGAGATCCCAACCACACTGGTGGACGATTTCATTCTGTCACCCGTGGTCAAGCGGAGCT TCATCCAGAGGATCAAAGTGATCAACGCCATCATCAAGAAGTACGGCCTGCCCAATGATATCATTATC GAGCTGGCTAGGGAGAAGAACAGCAAGGACGGACAGAAGATGATCAATGAGATGCAGAAACGAAACCG GCAGACCAATGAACGCATTGAAGAGATTATCCGAACTACCGGGAAAGAGAACGCAAAGTACCTGATTG AAAAAATCAAGCTGCACGATATGCAGGAGGGAAAGTGTCTGTATTCTCTGGAGGCCATCCCCCTGGAG GACCTGCTGAACAATCCATTCAACTACGAGGTCGATCATATTATCCCCAGAAGCGTGTCCTTCGACAA TTCCTTTAACAACAAGGTGCTGGTCAAGCAGGAAGAGAACTCTAAAAAGGGCAATAGGACTCCTTTCC AGTACCTGTCTAGTTCAGATTCCAAGATCTCTTACGAAACCTTTAAAAAGCACATTCTGAATCTGGCC AAAGGAAAGGGCCGCATCAGCAAGACCAAAAAGGAGTACCTGCTGGAAGAGCGGGACATCAACAGATT CTCCGTCCAGAAGGATTTTATTAACCGGAATCTGGTGGACACAAGATACGCTACTCGCGGCCTGATGA ATCTGCTGCGATCCTATTTCCGGGTGAACAATCTGGATGTGAAAGTCAAGTCCATCAACGGCGGGTTC ACATCTTTTCTGAGGCGCAAATGGAAGTTTAAAAAGGAGCGCAACAAAGGGTACAAGCACCATGCCGA AGATGCTCTGATTATCGCAAATGCCGACTTCATCTTTAAGGAGTGGAAAAAGCTGGACAAAGCCAAGA AAGTGATGGAGAACCAGATGTTCGAAGAGAAGCAGGCCGAATCTATGCCCGAAATCGAGACAGAACAG GAGTACAAGGAGATTTTCATCACTCCTCACCAGATCAAGCATATCAAGGATTTCAAGGACTACAAGTA CTCTCACCGGGTGGATAAAAAGCCCAACAGAGAGCTGATCAATGACACCCTGTATAGTACAAGAAAAG ACGATAAGGGGAATACCCTGATTGTGAACAATCTGAACGGACTGTACGACAAAGATAATGACAAGCTG AAAAAGCTGATCAACAAAAGTCCCGAGAAGCTGCTGATGTACCACCATGATCCTCAGACATATCAGAA ACTGAAGCTGATTATGGAGCAGTACGGCGACGAGAAGAACCCACTGTATAAGTACTATGAAGAGACTG GGAACTACCTGACCAAGTATAGCAAAAAGGATAATGGCCCCGTGATCAAGAAGATCAAGTACTATGGG AACAAGCTGAATGCCCATCTGGACATCACAGACGATTAGCCTAACAGTCGCAACAAGGTGGTCAAGCT GTCACTGAAGCCATACAGATTCGATGTCTATCTGGACAACGGCGTGTATAAATTTGTGACTGTCAAGA ATCTGGATGTCATCAAAAAGGAGAACTACTATGAAGTGAATAGCAAGTGCTACGAAGAGGCTAAAAAG CTGAAAAAGATTAGCAACCAGGCAGAGTTCATCGCCTCCTTTTACAACAACGACCTGATTAAGATCAA TGGCGAACTGTATAGGGTCATCGGGGTGAACAATGATCTGCTGAACCGCATTGAAGTGAATATGATTG ACATCACTTACCGAGAGTATCTGGAAAACATGAATGATAAGCGCCCCCCTCGAATTATCAAAACAATT GCCTCTAAGACTCAGAGTATCAAAAAGTACTCAACCGACATTCTGGGAAACCTGTATGAGGTGAAGAG CAAAAAGCACCCTCAGATTATCAAAAAGGGCagcggaggcaagcgtcctgctgctactaagaaagctg gtcaagctaagaaaaagaaaggatcctacccatacgatgttccagattacgcttaagaattcctagag ctcgctgatcagcctcgactgtgccttctagttgccagccatctgttgtttgcccctcccccgtgcct tccttgaccctggaaggtgccactcccactgtcctttcctaataaaatgaggaaattgcatcgcattg tctgagtaggtgtcattctattctggggggtggggtggggcaggacagcaagggggaggattgggaag agaatagcaggcatgctggggaggtagcggccgcCCgcggtggagctccagcttttgttccctttagt gagggttaattgcgcgcttggcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctc acaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagcta actcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcatt aatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcact gactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggtt atccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaacc gtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcga cgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctc cctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaa gcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctg ggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtc caacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggt atgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaaggacagtattt ggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaaca aaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctc aagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggatt ttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatc aatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatct cagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgg gagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagattt atcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctcca tccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgtt gttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttc ccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctc cgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattct cttactgtcatgccatccgtaaqatgcttttctgtgactggtgagtactcaaccaagtcattctgaga atagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagca gaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctg ttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatctcttactttcaccag cgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaat gttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagc ggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagt gccac SEQ ID NO: 28 MCherry polypeptide MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSP QFMYGSGAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPS DGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKL DITSHNEDYTIVEQYERAEGRHSTGGMDELYKPKKKRKVGGPKKKRKV SEQ ID NO: 29 mCherry polynucleotide atggtgagcaagggcgaggaggataacatggccatcatcaaggagttcatgcgcttcaaggtgcacat ggagggctccgtgaacggccacgagttcgagatcgagggcgagggcgagggccgcccctacgagggca cccagaccgccaagctgaaggtgaccaagggcggccccctgcccttcgcctgggacatcctgtcccct cagttcatgtacggctccaaggcctacgtgaagcaccccgccgacatccccgactacttgaagctgtc cttccccgagggcttcaagtgggagcgcgtgatgaacttcgaggacggcggcgtggtgaccgtgaccc aggactcctccctgcaggacggcgagttcatctacaaggtgaagctgcgcggcaccaacttcccctcc gacggccccgtaatgcagaagaagaccatgggctgggaggcctcctccgagcggatgtaccccgagga cggcgccctgaagggcgagatcaagcagaggctgaagctgaaggacggcggccactacgacgctgagg tcaagaccacctacaaggccaagaagcccgtgcagctgcccggcgcctacaacgtcaacatcaagttg gacatcacctcccacaacgaggactacaccatcgtggaacagtacgaacgcgccgagggccgccactc caccggcggcatggacgagctgtacaagcccaagaagaagaggaaggtgggtggccctaagaaaaaga gaaaggtgtga SEQ ID NO: 30 Fwd: 5′-AATGATACGGCGACCACCGAGATCTACACAATTTCTTGGGTAGTTTGCAGTT SEQ ID NO: 31 Rev: 5′-CAAGCAGAAGACGGCATACGAGAT-(6-bp index sequence)- GACTCGGTGCCACTTTTTCAA SEQ ID NO: 32 Read1: 5′-GATTTCTTGGCTTTATATATCTTGTGGAAAGGACGAAACACCG SEQ ID NO: 33 Index: 5′-GCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTC SEQ ID NO: 34 Read2: 5′-GTTGATAACGGACTAGCCTTATTTAAACTTGCTATGCTGTTTCCAGCATAGCTCTTAAAC SEQ ID NO: 35 tttn (N can be any nucleotide residue, e.g., any of A, G, C, or T) SEQ ID NO: 36 VP64-dCas9-VP64 protein RADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMVNPKKKRKVGRGMDKKY SIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYT RRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYKEKYPTIYHLRKK LVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAK AILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDN LLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPE KYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQ IHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEV VDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIV DLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILE DIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKS DGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGR HKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRD MYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNA KLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVIT LKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKS EQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVN IVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVK ELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALP SKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKH RDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQL GGDSRADPKKKRKVASRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDML I SEQ ID NO: 37 VP64-dCas9-VP64 DNA cgggctgacgcattggacgactttgatctggatatgctgggaagtgacgccctcgatgattttgacct tgacatgcttggttcggatgcccttgatgactttgacctcgacatgctcggcagcgacgcccttgatg atttcgacctggacatggttaaccccaagaagaagaggaaggtgggccgcggaatggacaagaagtac tccattgggctcgccatcggcacaaacagcgtcggctgggccgtcattacggacgagtacaaggtgcc gagcaaaaaattcaaagttctgggcaataccgatcgccacagcataaagaagaacctcattggcgccc tcctgttcgactccggggaaaccgccgaagccacgcggctcaaaagaacagcacggcgcagatatacc cgcagaaagaatcggatctgctacctgcaggaqatctttagtaatgagatggctaaggtggatgactc tttcttccataggctggaggagtcctttttggtggaggaggataaaaagcacgagcgccacccaatct ttggcaatatcgtggacgaggtggcgtaccatgaaaagtacccaaccatatatcatctgaggaagaag cttgtagacagtactgataaggctgacttgcggttgatctatctcgcgctggcgcatatgatcaaatt tcggggacacttcctcatcgagggggacctgaacccagacaacagcgatgtcgacaaactctttatcc aactggttcagacttacaatcagcttttcgaagagaacccgatcaacgcatccggagttgacgccaaa gcaatcctgagcgctaggctgtccaaatcccggcggctcgaaaacctcatcgcacagctccctgggga gaagaagaacggcctgtttggtaatcttatcgccctgtcactcgggctgacccccaactttaaatcta acttcgacctggccgaagatgccaagcttcaactgagcaaagacacctacgatgatgatctcgacaat ctgctggcccagatcggcgaccagtacgcagacctttttttggcggcaaagaacctgtcagacgccat tctgctgagtgatattctgcgagtgaacacggagatcaccaaagctccgctgagcgctagtatgatca agcgctatgatgagcaccaccaagacttgactttgctgaaggcccttgtcagacagcaactgcctgag aagtacaaggaaattttcttcgatcagtctaaaaatggctacgccggatacattgacggcggagcaag ccaggaggaattttacaaatttattaagcccatcttggaaaaaatggacggcaccgaggagctgctgg taaagcttaacagagaagatctgttgcgcaaacagcgcactttcgacaatggaagcatcccccaccag atccacctgggcgaacCgcacgctatcctcaggcggcaagaggatttctacccctttttgaaagataa cagggaaaagattgagaaaatcctcacatttcggataccctactatgtaggccccctcgcccggggaa attccagattcgcgtggatgactcgcaaatcagaagagaccatcactccctggaacttcgaggaagtc gtggataagggggcctctgcccagtccttcatcgaaaggatgactaactttgataaaaatctgcctaa cgaaaaggtgcttcctaaacactctctgctgtacgagtacttcacagtttataacgagctcaccaagg tcaaatacgtcacagaagggatgagaaagccagcattcctgtctggagagcagaagaaagctatcgtg gacctcctcttcaagacgaaccggaaagttaccgtgaaacagctcaaagaagactatttcaaaaagat tgaatgtttcgactctgttgaaatcagcggagtggaggatcgcttcaacgcatccctgggaacgtatc acgatctcctgaaaatcattaaagacaaggacttcctggacaatgaggagaacgaggacattcttgag gacattgtcctcacccttacgttgtttgaagatagggagatgattgaagaacgcttgaaaacttacgc tcatctcttcgacgacaaagtcatgaaacagctcaagaggcgccgatatacaggatgggggcggctgt caagaaaactgatcaatgggatccgagacaagcagagtggaaagacaatcctggattttcttaagtcc gatggatttgccaaccggaacttcatgcagttgatccatgatgactctctcacctttaaggaggacat ccagaaagcacaagtttctggccagggggacagtcttcacgagcacatcgctaatcttgcaggtagcc cagctatcaaaaagggaatactgcagaccgttaaggtcgtggatgaactcgtcaaagtaatgggaagg cataagcccgagaatatcgttatcgagatggcccgagagaaccaaactacccagaagggacagaagaa cagtagggaaaggatgaagaggattgaagagggtataaaagaactggggtcccaaatccttaaggaac acccagttgaaaacacccagcttcagaatgagaagctctacctgcactacctgcagaacggcagggac atgtacgtggatcaggaactggacatcaatcggctctccgactacgacgtggatgccatcgtgcccca gtcttttctcaaagatgattctattgataataaagtgttgacaagatccgataaaaatagagggaaga gtgataacgtcccctcagaagaagttgtcaagaaaatgaaaaattattggcggcagctgctgaacgcc aaactgatcacacaacggaagttcgataatctgactaaggctgaacgaggtggcctgtctgagttgga taaagccggcttcatcaaaaggcagcttgttgagacacgccagatcaccaagcacgtggcccaaattc tcgattcacgcatgaacaccaagtacgatgaaaatgacaaactgattcgagaggtgaaagttattact ctgaagtctaagctggtctcagatttcagaaaggactttcagttttataaggtgagagagatcaacaa ttaccaccatgcgcatgatgcctacctgaatgcagtggtaggcactgcacttatcaaaaaatatccca agcttgaatctgaatttgtttacggagactataaagtgtacgatgttaggaaaatgatcgcaaagtct gagcaggaaataggcaaggccaccgctaagtacttcttttacagcaatattatgaattttttcaagac cgagattacactggccaatggagagattcggaagcgaccacttatcgaaacaaacggagaaacaggag aaatcgtgtgggacaagggtagggatttcgcgacagtccggaaggtcctgtccatgccgcaggtgaac atcgttaaaaagaccgaagtacagaccggaggcttctccaaggaaagtatcctcccgaaaaggaacag cgacaagctgatcgcacgcaaaaaagattgggaccccaagaaatacggcggattcgattctcctacag tcgcttacagtgtactggttgtggccaaagtggagaaagggaagtctaaaaaactcaaaagcgtcaag gaactgctgggcatcacaatcatggagcgatcaagcttcgaaaaaaaccccatcgactttctcgaggc gaaaggatataaagaggtcaaaaaagacctcatcattaagcttcccaagtactctctctttgagcttg aaaacggccggaaacgaatgctcgctagtgcgggcgagctgcagaaaggtaacgagctggcactgccc tctaaatacgttaatttcttgtatctggccagccactatgaaaagctcaaagggtctcccgaagataa tgagcagaagcagctgttcgtggaacaacacaaacactaccttgatgagatcatcgagcaaataagcg aattctccaaaagagtgatcctcgccgacgctaacctcgataaggtgctttctgcttacaataagcac agggataagcccatcagggagcaggcagaaaacattatccacttgtttactctgaccaacttgggcgc gcctgcagccttcaagtacttcgacaccaccatagacagaaagcggtacacctctacaaaggaggtcc tggacgccacactgattcatcagtcaattacggggctctatgaaacaagaatcgacctctctcagctc ggtggagacagcagggctgaccccaagaagaagaggaaggtggctagccgcgccgacgcgctggacga tttcgatctcgacatgctgggttctgatgccctcgatgactttgacctggatatgttgggaagcgacg cattggatgactttgatctggacatgctcggctccgatgctctggacgatttcgatctcgatatgtta atc SEQ ID NO: 159 Human p300 (with L553M mutation) protein MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSL GMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNM GMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQN MQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGL QIQTKTVLSNNLSPEAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQ QLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTR HDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQ VNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMM SENASVPSMGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYA RKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQP GMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPP MGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSH IHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQ TPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVS NPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELK TEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPD YFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPV MQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQT TINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIKPAGFVCDGCLKKSARTRKENKFSAKR LPSTRLGTFLENRVNDFLRRQNHPESGEVTYRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKAL FAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKL GYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEBRLT SAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTBVTKGDSKNAKKKNNKKTSKNKSSLS RGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLT LARDKHLEFSSLRRAQWSTKCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKN HDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHT KGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQ RTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQ VTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPM TRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISP LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQ GQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMP SQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQ LPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQP VPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNP GMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH SEQ ID NO: 160 Human p300 Core Effector protein (aa 1048-1664 of SEQ ID NO: 134) IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPW QYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLC TIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDOPSQPQTTINKEQFSKRKNDTLDPELFVECTECG RKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPP PNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQ KIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQE EEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKH KEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELH TQSQD SEQ ID NO: 158 Polynucleotide sequence of a gRNA scaffold gttttagagctagaaatagcaagttaaaataaggctagtccgttatcaacttgaaaaagtgg caccgagtcggtgcttttttt