CD80 EXTRACELLULAR DOMAIN FC FUSION PROTEINS FOR TREATING PD-L1 NEGATIVE TUMORS
20220031806 · 2022-02-03
Inventors
- Susannah D. BARBEE (San Francisco, CA, US)
- Thomas Brennan (Cupertino, CA)
- Barbara Sennino (San Francisco, CA)
Cpc classification
C12Q2600/106
CHEMISTRY; METALLURGY
G01N33/57492
PHYSICS
A61K38/177
HUMAN NECESSITIES
A61K38/1774
HUMAN NECESSITIES
C07K2319/30
CHEMISTRY; METALLURGY
G01N2800/52
PHYSICS
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
The present disclosure provides methods of treating PD-L1 negative tumors, the methods comprising administering fusion proteins comprising the extracellular domain of human cluster of differentiation 80 (CD80) and the fragment crystallizable (Fc) domain of human immunoglobulin G 1 (IgG1).
Claims
1. A method of treating a PD-L1 negative tumor in a subject, the method comprising administering to the subject a composition comprising CD80 extracellular domain (ECD) fusion molecules.
2. The method of claim 1, wherein the tumor has been determined to be PD-L1 negative prior to the administration.
3. The method of claim 1, further comprising determining that the tumor is PD-L1 negative prior to the administration.
4. A method of selecting a subject with a tumor for treatment with a composition comprising CD80 ECD fusion molecules, the method comprising determining whether a tumor sample obtained from the subject is PD-L1 negative and selecting the subject for treatment with the composition if the tumor sample is determined to be PD-L1 negative.
5. A composition comprising CD80 ECD fusion molecules for use in the treatment of a PD-L1 negative cancer tumor in a subject.
6. The composition for use of claim 5, wherein the subject is selected for the treatment by determining that a tumor sample obtained from the subject is PD-L1 negative.
7. A composition comprising CD80 ECD fusion molecules for use in the treatment of a tumor in a subject, wherein the tumor has been determined to be PD-L1 negative.
8. An in vitro method for identifying a subject with a tumor that is responsive to treatment with a composition comprising CD80 ECD fusion molecules, the method comprising determining whether a tumor sample obtained from the subject is PD-L1 negative, wherein the subject is identified as being responsive to treatment with a CD80 ECD fusion molecule if the tumor sample is determined to be PD-L1 negative.
9. An in vitro use of at least one agent capable of determining that a tumor sample is PD-L1 negative, for identifying a subject with a tumor that is responsive to treatment with a composition comprising CD80 ECD fusion molecules.
10. The method, composition, or use of any one of claims 2-4, and 6-9, wherein the tumor has been determined or is determined to be PD-L1 negative using an agent that is capable of detecting PD-L1 protein, optionally wherein the agent is an antibody that specifically binds to PD-L1 protein.
11. The method, composition, or use of claim 10, wherein the tumor has been determined or is determined to be PD-L1 negative by Western blot.
12. The method, composition, or use of claim 10, wherein the tumor has been determined or is determined to be PD-L1 negative by fluorescence-activated cell sorting (FACS).
13. The method, composition, or use of claim 10, wherein the tumor has been determined or is determined to be PD-L1 negative by immunohistochemistry (IHC), optionally wherein the sample is a paraffin-embedded sample.
14. The method, composition, or use of any one of claims 2-4 and 6-9, wherein the tumor has been determined or is determined to be PD-L1 negative using an agent that is capable of detecting PD-L1 mRNA.
15. The method, composition, or use of claim 14, wherein the tumor has been determined or is determined to be PD-L1 negative by quantitative reverse transcriptase (RT)-polymerase chain reaction (PCR).
16. The method, composition, or use of claim 14, wherein the tumor has been determined or is determined to be PD-L1 negative using RNA-Seq.
17. The method, composition, or use of claim 14, wherein the tumor has been determined or is determined to be PD-L1 negative using a microarray.
18. The method, composition, or use of any one of claims 1-17, wherein the tumor is a solid tumor.
19. The method, composition, or use of any one of claims 1-18, wherein the subject is afflicted with a cancer selected from the group consisting of colorectal cancer, breast cancer, gastric cancer, non-small cell lung cancer, melanoma, squamous cell carcinoma of the head and neck, ovarian cancer, pancreatic cancer, renal cell carcinoma, hepatocellular carcinoma, bladder cancer, and endometrial cancer.
20. The method, composition, or use of any one of claims 1-19, wherein the subject is afflicted with a cancer that is recurrent or progressive after a therapy consisting of surgery, chemotherapy, radiation therapy, or a combination thereof.
21. The method, composition, or use of any one of claims 1-20, wherein the CD80 ECD fusion molecules comprise a human CD80 ECD and a human IgG1 Fc domain.
22. The method, composition, or use of any one of claims 1-21, wherein the composition comprises sialylated CD80 ECD fusion molecules.
23. The method, composition, or use of claim 22, wherein the sialylated CD80 ECD fusion molecules comprise at least 15 moles of sialic acid (SA) per mole of fusion protein.
24. The method, composition, or use of claim 22, wherein the sialylated CD80 ECD fusion molecules comprise 15-60 moles of SA per mole of fusion protein.
25. The method, composition, or use of claim 22, wherein the sialylated CD80 ECD fusion molecules comprise 15-40 moles of SA per mole of fusion protein.
26. The method, composition, or use of claim 22, wherein the sialylated CD80 ECD fusion molecules comprise 15-30 moles of SA per mole of fusion protein.
27. The method, composition, or use of claim 22, wherein the sialylated CD80 ECD fusion molecules comprise 20-30 moles of SA per mole of fusion protein.
28. The method, composition, or use of any one of claims 1-27, wherein the CD80 ECD fusion molecules comprise a human CD80 ECD comprising the amino acid sequence of SEQ ID NO:1.
29. The method, composition, or use of any one of claims 1-28, wherein the CD80 ECD fusion molecules comprise a human IgG1 Fc domain comprising the amino acid sequence of SEQ ID NO:3.
30. The method, composition, or use of any one of claims 1-29, wherein the Fc domain of human IgG1 is linked to the carboxy terminus of the ECD of human CD80.
31. The method, composition, or use of any one of claims 1-30, wherein the CD80 ECD fusion molecules comprise the amino acid sequence of SEQ ID NO:5.
32. The method, composition, or use of any one of claims 1-31, wherein the PD-L1 negative tumor has a TPS score of less than 5% or less than 1%.
33. The method, composition, or use of any one of claims 1-32, wherein the composition alone does not cause significant release of interferon gamma or TNF alpha from T-cells in vitro.
34. The method, composition, or use of any one of claims 1-33, wherein the composition alone causes less release of interferon gamma or TNF alpha from T-cells in vitro than TGN1412 alone.
35. The method, composition, or use of claim 34, wherein the composition alone is at least 1000-fold less potent at inducing interferon gamma or TNF alpha release compared to TGN1412 alone.
36. The method, composition, or use of any one of claims 1-35, wherein the composition is capable of at least 90% tumor growth inhibition in at least one mouse syngeneic cancer model over a period of at least one week, 10 days, two weeks, or three weeks following administration of a single dose of the composition at 0.3 to 0.6 mg/kg.
37. The method, composition, or use of claim 36, wherein the mouse syngeneic cancer model is a CT26 tumor model.
38. The method, composition, or use of any one of claims 1-37, wherein the treatment comprises administration of about 0.07 mg to about 70 mg of the CD80 ECD fusion molecules.
39. The method, composition, or use of claim 38, wherein the treatment comprises administration of about 7.0 mg to about 70 mg of the CD80 ECD fusion molecules.
40. The method, composition, or use of claim 39, wherein the treatment comprises administration of about 70 mg of the CD80 ECD fusion molecules.
41. The method, composition, or use of claim 39, wherein the treatment comprises administration of about 42 mg of the CD80 ECD fusion molecules.
42. The method, composition, or use of claim 39, wherein the treatment comprises administration of about 21 mg of the CD80 ECD fusion molecules.
43. The method, composition, or use of claim 39, wherein the treatment comprises administration of about 7 mg of the CD80 ECD fusion molecules.
44. The method, composition, or use of claim 38, wherein the treatment comprises administration of about 2.1 mg of the CD80 ECD fusion molecules.
45. The method, composition, or use of claim 38, wherein the treatment comprises administration of about 0.7 mg of the CD80 ECD fusion molecules.
46. The method, composition, or use of claim 38, wherein the treatment comprises administration of about 0.21 mg of the CD80 ECD fusion molecules.
47. The method, composition, or use of claim 38, wherein the treatment comprises administration of about 0.07 mg of the CD80 ECD fusion molecules.
48. The method, composition, or use of any one of claims 1-47, wherein the treatment comprises administration once every three weeks.
49. The method, composition, or use of any one of claims 1-48, wherein the treatment comprises intravenous administration of the CD80 ECD fusion molecules.
50. The method, composition, or use of any one of claims 1-49, wherein the subject has not received prior therapy with a PD-1/PD-L1 antagonist.
51. The method, composition, or use of any one of claims 1-50, wherein the subject has received prior therapy with at least one anti-angiogenic agent.
52. The method, composition, or use of claim 51, wherein the anti-angiogenic agent is sunitinib, sorafenib, pazopanib, axitinib, tivozanib, ramucirumab, or bevacizumab.
53. The method, composition, or use of claim 51 or 52, wherein the anti-angiogenic agent was administered in an advanced or metastatic setting.
54. The method, composition, or use of any one of claims 1-53, wherein the subject is afflicted with a melanoma that has a BRAF mutation.
55. The method, composition, or use of claim 54, wherein the subject has received prior therapy with at least one BRAF inhibitor.
56. The method, composition, or use of claim 55, wherein the BRAF inhibitor is vemurafenib or dabrafenib.
57. The method, composition, or use of claim 55 or 56, wherein the BRAF inhibitor was administered in an advanced or metastatic setting.
58. The method, composition, or use of any one of claims 1-57, wherein the tumor is recurrent or progressive after a therapy selected from surgery, chemotherapy, radiation therapy, and a combination thereof
59. A method of treating a PD-L1 negative tumor in a human patient, the method comprising administering to the patient a composition comprising about 0.07 mg to about 70 mg CD80 extracellular domain (ECD) fusion molecules comprising the amino acid sequence of SEQ ID NO:5.
60. The method of claim 59, wherein the tumor has been determined to be PD-L1 negative by IHC prior to the administration.
61. The method of claim 59 or 60, wherein the composition comprises sialylated CD80 ECD fusion molecules and wherein the sialylated CD80 ECD fusion molecules comprise 15-60 moles of SA per mole of fusion protein.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0028]
[0029]
[0030]
[0031]
[0032]
DESCRIPTION OF PARTICULAR EMBODIMENTS 1. Definitions
[0033] Unless otherwise defined, scientific and technical terms used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.
[0034] Unless specifically stated or obvious from context, as used herein, the term “or” is understood to be inclusive. The term “and/or” as used in a phrase such as “A and/or B” herein is intended to include both “A and B,” “A or B,” “A,” and “B.” Likewise, the term “and/or” as used in a phrase such as “A, B, and/or C” is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
[0035] The terms “polypeptide,” “peptide,” and “protein” are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length. Such polymers of amino acid residues may contain natural or non-natural amino acid residues, and include, but are not limited to, peptides, oligopeptides, dimers, trimers, and multimers of amino acid residues. Both full-length proteins and fragments thereof are encompassed by the definition. The terms also include post-expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, phosphorylation, and the like. Furthermore, for purposes of the present invention, a “polypeptide” refers to a protein which includes modifications, such as deletions, additions, and substitutions (generally conservative in nature), to the native sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR amplification.
[0036] A “fusion molecule” as used herein refers to a molecule composed of two or more different molecules that do not occur together in nature being covalently or noncovalently joined to form a new molecule. For example, fusion molecules may be comprised of a polypeptide and a polymer such as PEG, or of two different polypeptides. A “fusion protein” refers to a fusion molecule composed of two or more polypeptides that do not occur in a single molecule in nature.
[0037] A “CD80 extracellular domain” or “CD80 ECD” refers to an extracellular domain polypeptide of CD80, including natural and engineered variants thereof. A CD80 ECD can, for example, comprise, consist essentially of, or consist of the amino acid sequence set forth in SEQ ID NO:1 or 2. A “CD80 ECD fusion molecule” refers to a molecule comprising a CD80 ECD and a fusion partner. The fusion partner may be covalently attached, for example, to the N- or C-terminal of the CD80 ECD or at an internal location. A “CD80 ECD fusion protein” is a CD80 ECD fusion molecule comprising a CD80 ECD and another polypeptide that is not naturally associated with the CD80 ECD, such as an Fc domain. A CD80 ECD fusion protein can, for example, comprise, consist essentially of, or consist of the amino acid sequence set forth in SEQ ID NO: 4 or 5.
[0038] The term “isolated” as used herein refers to a molecule that has been separated from at least some of the components with which it is typically found in nature. For example, a polypeptide is referred to as “isolated” when it is separated from at least some of the components of the cell in which it was produced. Where a polypeptide is secreted by a cell after expression, physically separating the supernatant containing the polypeptide from the cell that produced it is considered to be “isolating” the polypeptide. Similarly, a polynucleotide is referred to as “isolated” when it is not part of the larger polynucleotide (such as, for example, genomic DNA or mitochondrial DNA, in the case of a DNA polynucleotide) in which it is typically found in nature, or is separated from at least some of the components of the cell in which it was produced, e.g., in the case of an RNA polynucleotide. Thus, a DNA polynucleotide that is contained in a vector inside a host cell may be referred to as “isolated” so long as that polynucleotide is not found in that vector in nature.
[0039] The terms “subject” and “patient” are used interchangeably herein to refer to a human. In some embodiments, methods of treating other mammals, including, but not limited to, rodents, simians, felines, canines, equines, bovines, porcines, ovines, caprines, mammalian laboratory animals, mammalian farm animals, mammalian sport animals, and mammalian pets, are also provided.
[0040] The term “cancer” is used herein to refer to a group of cells that exhibit abnormally high levels of proliferation and growth. A cancer can be a solid tumor, for example, a colorectal cancer, breast cancer, gastric cancer, non-small cell lung cancer, small cell lung cancer, melanoma, squamous cell carcinoma of the head and neck, ovarian cancer, pancreatic cancer, renal cell carcinoma, hepatocellular carcinoma, bladder cancer, or endometrial cancer.
[0041] Terms such as “treating,” “treatment,” and “to treat,” refer to therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a pathologic condition or disorder. Thus, those in need of treatment include those already diagnosed with or suspected of having the disorder. In certain embodiments, a subject is successfully “treated” for cancer according to the methods of the present invention if the patient shows one or more of the following: a reduction in the number of or complete absence of cancer cells; a reduction in the tumor size; inhibition of or an absence of cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibition or an absence of tumor metastasis; inhibition or an absence of tumor growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; reduction in tumorigenicity, tumorigenic frequency, or tumorigenic capacity, of a tumor; reduction in the number or frequency of cancer stem cells in a tumor; differentiation of tumorigenic cells to a non-tumorigenic state; increased progression-free survival (PFS), disease-free survival (DFS), overall survival (OS), complete response (CR), partial response (PR), stable disease (SD), a decrease in progressive disease (PD), a reduced time to progression (TTP), or any combination thereof.
[0042] The terms “administer,” “administering,” “administration,” and the like, as used herein, refer to methods that may be used to enable delivery of a drug, e.g., a CD80 ECD fusion protein to the desired site of biological action (e.g., intravenous administration). Administration techniques that can be employed with the agents and methods described herein are found in e.g., Goodman and Gilman, The Pharmacological Basis of Therapeutics, current edition, Pergamon; and Remington's, Pharmaceutical Sciences, current edition, Mack Publishing Co., Easton, Pa.
[0043] The term “therapeutically effective amount” refers to an amount of a drug, e.g., a CD80 ECD fusion protein, effective to treat a disease or disorder in a subject. In the case of cancer, the therapeutically effective amount of the drug can reduce the number of cancer cells; reduce the tumor size or burden; inhibit, to some extent, cancer cell infiltration into peripheral organs; inhibit, to some extent, tumor metastasis; inhibit, to some extent, tumor growth; relieve, to some extent, one or more of the symptoms associated with the cancer; and/or result in a favorable response such as increased progression-free survival (PFS), disease-free survival (DFS), overall survival (OS), complete response (CR), partial response (PR), or, in some cases, stable disease (SD), a decrease in progressive disease (PD), a reduced time to progression (TTP), or any combination thereof.
[0044] The terms “resistant” or “nonresponsive” when used in the context of treatment with a therapeutic agent, means that the subject shows decreased response or lack of response to a standard dose of the therapeutic agent, relative to the subject's response to the standard dose of the therapeutic agent in the past, or relative to the expected response of a similar subject with a similar disorder to the standard dose of the therapeutic agent. Thus, in some embodiments, a subject may be resistant to a therapeutic agent although the subject has not previously been given the therapeutic agent, or the subject may develop resistance to the therapeutic agent after having responded to the agent on one or more previous occasions.
[0045] A “refractory” cancer is one that progresses even though an anti-tumor treatment, such as a chemotherapy, is administered to the cancer patient.
[0046] A “recurrent” cancer is one that has regrown, either at the initial site or at a distant site, after a response to initial therapy.
[0047] The terms “programmed cell death 1 ligand 1” and “PD-L1” refer to one of two cell surface glycoprotein ligands for PD-1 (the other being PD-L2) that down regulate T-cell activation and cytokine secretion upon binding to PD-1. The term “PD-L1” as used herein includes human PD-L1 (hPD-L1), naturally occurring variants and isoforms of hPD-1, and species homologs of hPD-L1. A mature hPD-L1 sequence is provided as SEQ ID NO:6.
[0048] The term “PD-L1 negative tumor” refers to a tumor that does not significantly express PD-L1 on the cell surface. The presence or absence of PD-L1 can be determined, for example, using immunohistochemistry, which can be quantitated using a tumor proportion score (TPS). A TPS (%) is equal to [Number of PD-L1-stained tumor cells/total number of viable tumor cells]×100. Accordingly, a PD-L1 negative tumor can be a tumor with a TPS score of less than 5% or less than 1%.
[0049] The term “PD-1/PD-L1 antagonist” refers to a moiety that disrupts the PD-1/PD-L1 signaling pathway. In some embodiments, the antagonist inhibits the PD-1/PD-L1 signaling pathway by binding to PD-1 and/or PD-L1. In some embodiments, the PD-1/PD-L1 antagonist also binds to PD-L2. In some embodiments, a PD-1/PD-L1 antagonist blocks binding of PD-1 to PD-L1 and optionally PD-L2. Nonlimiting exemplary PD-1/PD-L1 antagonists include PD-1 antagonists, such as antibodies that bind to PD-1 (e.g., nivolumab and pembrolizumab); PD-L1 antagonists, such as antibodies that bind to PD-L1 (e.g., atezolizumab, durvalumab and avelumab); fusion proteins, such as AMP-224; and peptides, such as AUR-012.
[0050] An “anti-angiogenic agent” or “angiogenesis inhibitor” refers to an agent such as a small molecular weight substance, a polynucleotide (including, e.g., an inhibitory RNA (RNAi or siRNA)), a polypeptide, an isolated protein, a recombinant protein, an antibody, or conjugates or fusion proteins thereof, that inhibits angiogenesis, vasculogenesis, or undesirable vascular permeability, either directly or indirectly. It should be understood that an anti-angiogenic agent includes those agents that bind and block the angiogenic activity of the angiogenic factor or its receptor. For example, an anti-angiogenic agent is an antibody to or other antagonist of an angiogenic agent, e.g., antibodies to VEGF-A (e.g., bevacizumab)) (Avastin® or to the VEGF-A receptor (e.g., KDR receptor or Flt-1 receptor), anti-PDGFR inhibitors such as Gleevec® (Imatinib Mesylate), small molecules that block VEGF receptor signaling (e.g., PTK787/ZK2284, SU6668, Sutent®/SU11248 (sunitinib malate), AMG706, or those described in, e.g., international patent application WO 2004/113304). Anti-angiogensis agents also include native angiogenesis inhibitors, e.g., angiostatin, endostatin, etc. See, e.g., Klagsbrun and D'Amore (1991) Annu. Rev. Physiol. 53:217-39; Streit and Detmar (2003) Oncogene 22:3172-3179 (e.g., Table 3 listing anti-angiogenic therapy in malignant melanoma); Ferrara & Alitalo (1999) Nature Medicine 5(12):1359-1364; Tonini et al. (2003) Oncogene 22:6549-6556 (e.g., Table 2 listing known anti-angiogenic factors); Sato (2003) Int. J. Clin. Oncol. 8:200-206 (e.g., Table 1 listing anti-angiogenic agents used in clinical trials), and Jayson (2016) Lancet 338(10043):518-529.
[0051] The term “pharmaceutical composition” refers to a preparation which is in such form as to permit the biological activity of the active ingredient to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered. The formulation can be sterile. A pharmaceutical composition may contain a “pharmaceutical carrier,” which refers to carrier that is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation. The pharmaceutically acceptable carrier is appropriate for the formulation employed. For example, if the therapeutic agent is to be administered intravenously, the carrier ideally is not irritable to the skin and does not cause injection site reaction.
[0052] As used herein, the terms “about” and “approximately,” when used to modify a numeric value or numeric range, indicate that deviations of 5% to 10% above and 5% to 10% below the value or range remain within the intended meaning of the recited value or range.
[0053] Any compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
2. CD80 Extracellular Domain Fc Fusion Proteins
[0054] Provided herein are methods of administering CD80 ECD fusion proteins comprising a CD80 ECD and an Fc domain (a “CD80 ECD Fc fusion protein”). Exemplary CD80 ECD fusion proteins are provided, for example, in WO 2017/079117, which is herein incorporated by reference in its entirety.
[0055] The CD80 ECD can, for example, be a human CD80 ECD. In certain aspects, the human CD80 ECD comprises, consists essentially of, or consists of the amino acid sequence set forth in SEQ ID NO:1.
[0056] The Fc domain can be the Fc domain of an IgG. The Fc domain can be the Fc domain of a human immunoglobulin. In certain aspects, the Fc domain is a human IgG Fc domain. In certain aspects, the Fc domain is a human IgG1 Fc domain. In certain aspects, the human IgG1 Fc domain comprises, consists essentially of, or consists of the amino acid sequence set forth in SEQ ID NO:4.
[0057] The CD80 ECD and the Fc domain can be directly linked such that the N-terminal amino acid of the Fc domain immediately follows the C-terminal amino acid of the CD80 ECD. In certain aspects, the CD80 ECD and the Fc domain are translated as a single polypeptide from a coding sequence that encodes both the CD80 ECD and the Fc domain. In certain aspects, the CD80 ECD Fc fusion protein comprises a human CD80 ECD and a human IgG1 Fc domain. In certain aspects, the CD80 ECD Fc fusion protein comprises, consists essentially of, or consists of the amino acid sequence set forth in SEQ ID NO:5.
[0058] CD80 ECD Fc fusion proteins can, depending on how they are produced, have different levels of particular glycosylation modifications. For example, a CD80 ECD Fc fusion protein can be sialylated and can have different amounts of sialic acid (SA) residues.
[0059] In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises 10 to 60 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises 15 to 60 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises 10 to 40 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises 15 to 30 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises 15 to 25 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises 20 to 40 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises 20 to 30 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises 30 to 40 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises 10, 15, 20, 25, 30, 35, or 40 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises at least 15 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises at least 20 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises at least 25 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises at least 30 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises at least 35 molecules of SA. In certain aspects, a CD80 ECD Fc fusion protein (e.g., comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprises at least 40 molecules of SA.
3. Pharmaceutical Compositions Comprising CD80 Extracellular Domain Fc Fusion Proteins
[0060] Provided herein are methods of administering pharmaceutical compositions comprising CD80 ECD Fc fusion proteins, e.g. having the desired degree of purity in a physiologically acceptable carrier, excipient, or stabilizer (Remington's Pharmaceutical Sciences (1990) Mack Publishing Co., Easton, Pa.). Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed. (See, e.g., Gennaro, Remington: The Science and Practice of Pharmacy with Facts and Comparisons: Drugfacts Plus, 20th ed. (2003); Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7th ed., Lippencott Williams and Wilkins (2004); Kibbe et al., Handbook of Pharmaceutical Excipients, 3rd ed., Pharmaceutical Press (2000)). The compositions to be used for in vivo administration can be sterile. This is readily accomplished by filtration through, e.g., sterile filtration membranes.
[0061] In certain aspects, a pharmaceutical composition comprising a CD80 ECD Fc fusion protein (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) is formulated for intravenous administration.
[0062] In certain aspects, a pharmaceutical composition comprises 70 mg of a CD80 ECD Fc fusion protein (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5). In certain aspects, a pharmaceutical composition comprises 42 mg of a CD80 ECD Fc fusion protein (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5). In certain aspects, a pharmaceutical composition comprises 21 mg of a CD80 ECD Fc fusion protein (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5). In certain aspects, a pharmaceutical composition comprises 7 mg of a CD80 ECD Fc fusion protein (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5). In certain aspects, a pharmaceutical composition comprises 2.1 mg of a CD80 ECD Fc fusion protein (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5). In certain aspects, a pharmaceutical composition comprises 0.7 mg of a CD80 ECD Fc fusion protein (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5). In certain aspects, a pharmaceutical composition comprises 0.21 mg of a CD80 ECD Fc fusion protein (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5). In certain aspects, a pharmaceutical composition comprises 0.07 mg of a CD80 ECD Fc fusion protein (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5).
[0063] In certain aspects, a pharmaceutical composition comprises 0.07 to 70 mg of a CD80 ECD Fc fusion protein (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5). In certain aspects, a pharmaceutical composition comprises 7 to 70 mg of a CD80 ECD Fc fusion protein (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5).
[0064] In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising 10 to 60 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising 15 to 60 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising 10 to 40 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising 15 to 30 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising 15 to 25 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising 20 to 40 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising 20 to 30 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising 30 to 40 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising 10, 15, 20, 25, 30, 35, or 40 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising at least 15 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising at least 20 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising at least 25 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising at least 30 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising at least 35 moles of SA per mole CD80 ECD Fc fusion protein. In certain aspects a pharmaceutical composition comprises CD80 ECD Fc fusion proteins (e.g. comprising a human CD80 ECD and a human IgG1 Fc domain, or comprising SEQ ID NO:5) comprising at least 40 moles of SA per mole CD80 ECD Fc fusion protein.
4. Methods and Uses of CD80 Extracellular Domain Fc Fusion Proteins
[0065] Presented herein are methods for treating a PD-L1 negative tumor (e.g., in a human) comprising administering to a subject in need thereof a CD80 ECD Fc fusion protein, or a pharmaceutical composition thereof. The CD80 ECD Fc fusion protein can comprise the extracellular domain of human CD80 and the Fc domain of human IgG1. In some embodiments, the CD80 ECD Fc fusion protein comprises the sequence of SEQ ID NO:5.
[0066] The presence or absence of PD-L1 can be determined using an agent that is capable of detecting PD-L1 protein, such as an anti-PD-L1 antibody. Thus, in some embodiments, a tumor can be identified as a PD-L1 negative tumor by subjecting a tumor sample to Western blot, fluorescence-activated cell sorting (FACS), or immunohistochemistry (IHC) using such an agent.
[0067] In some embodiments, IHC can be used to quantitate the amount of PD-L1 in a tumor sample, using for example, a tumor proportion score (TPS). A TPS (%) is equal to [Number of PD-L1-stained tumor cells/total number of viable tumor cells]×100. As provided herein, a PD-L1 negative tumor can be a tumor with a TPS score of less than 5%. As provided herein, a PD-L1 negative tumor can be a tumor with a TPS score of less than 1%.
[0068] The presence or absence of PD-L1 can be determined using an agent that is capable of detecting PD-L1 mRNA. Thus, in some embodiments, a tumor can be identified as a PD-L1 negative tumor by subjecting a tumor sample to quantitative reverse transcriptase (RT)-polymerase chain reaction (PCR), RNA-Seq, or microarray.
[0069] In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient about 70 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient about 42 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient about 21 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient about 7 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient about 2.1 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient about 0.7 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient about 0.21 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient about 0.07 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks.
[0070] In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient 70 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient 42 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient 21 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient 7 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient 2.1 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient 0.7 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient 0.21 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient 0.07 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks.
[0071] In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient about 0.07 mg to about 70 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks. In one aspect, a method of treating a PD-L1 negative tumor in a patient comprises administering to the patient about 7 mg to about 70 mg of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) e.g., once every three weeks.
[0072] According to the methods provided herein, a of a CD80 ECD fusion protein (e.g., comprising the amino acid sequence set forth in SEQ ID NO:5) can be administered intravenously.
[0073] According to the methods provided herein, the PD-L1 negative tumor can be, for example a solid tumor, including e.g., an advanced or metastatic solid tumor. In certain instances, the PD-L1 negative tumor is not a primary central nervous system tumor.
[0074] In certain instances, the PD-L1 negative tumor is a renal cell carcinoma.
[0075] In certain instances, the PD-L1 negative tumor is a melanoma.
[0076] In certain instances, the PD-L1 negative tumor is a colorectal cancer, breast cancer, gastric cancer, non-small cell lung cancer, small cell lung cancer, melanoma, squamous cell carcinoma of the head and neck, ovarian cancer, pancreatic cancer, renal cell carcinoma, hepatocellular carcinoma, bladder cancer, or endometrial cancer.
[0077] The patient to be treated according to the methods provided herein may have received prior therapy with at least one PD-1/PD-L1 antagonist selected from a PD-1 antagonist and a PD-L1 antagonist. The PD-1/PD-L1 antagonist can be, for example, nivolumab, pembrolizumab, atezolizumab, durvalumab, or avelumab. The PD-1/PDL-1 antagonist may have been administered in an advanced or metastatic setting. In some embodiments, the tumor is non-responsive to such treatment or recurrent during or after such treatment. In other instances, the patient to be treated according to the methods provided herein has not received prior therapy with a PD-1/PDL-1 antagonist.
[0078] The patient to be treated according to the methods provided herein may have received prior therapy with an anti-angiogenic agent. The anti-angiogenic agent can be, for example, sunitinib, sorafenib, pazopanib, axitinib, tivozanib, ramucirumab, or bevacizumab. The anti-angiogenic agent may have been administered in an advanced or metastatic setting.
[0079] The patient to be treated according to the methods provided herein, for example a patient with a melanoma, may have a BRAF mutation. The patient may have received prior therapy with a BRAF inhibitor. The BRAF inhibitor can be, for example, vemurafenib and dabrafenib. The BRAF inhibitor may have been administered in an advanced or metastatic setting.
[0080] The tumor to be treated according to the methods provided herein can be recurrent or progressive after a therapy selected from surgery, chemotherapy, radiation therapy, and a combination thereof.
[0081] The tumor to be treated according to the methods provided herein can be resistant or non-responsive to a PD-1/PD-L1 antagonist, such as nivolumab, pembrolizumab, atezolizumab, durvalumab, or avelumab. The tumor to be treated according to the methods provided herein can be resistant or non-responsive to an anti-angiogenic agent, such as sunitinib, sorafenib, pazopanib, axitinib, tivozanib, ramucirumab, or bevacizumab. The tumor to be treated according to the methods provided herein can be resistant or non-responsive to a BRAF inhibitor, such as vemurafenib or dabrafenib.
[0082] The tumor to be treated according to the methods provided herein can be refractory to a PD-1/PD-L1 antagonist, such as nivolumab, pembrolizumab, atezolizumab, durvalumab, or avelumab. The tumor to be treated according to the methods provided herein can be refractory to an anti-angiogenic agent, such as sunitinib, sorafenib, pazopanib, axitinib, tivozanib, ramucirumab, or bevacizumab. The tumor to be treated according to the methods provided herein can be refractory to a BRAF inhibitor, such as vemurafenib or dabrafenib.
[0083] The tumor to be treated according to the methods provided herein can be recurrent after treatment with a PD-1/PD-L1 antagonist, such as nivolumab, pembrolizumab, atezolizumab, durvalumab, or avelumab. The tumor to be treated according to the methods provided herein can be recurrent after treatment with an anti-angiogenic agent, such as sunitinib, sorafenib, pazopanib, axitinib, tivozanib, ramucirumab, or bevacizumab. The tumor to be treated according to the methods provided herein can be recurrent after treatment with a BRAF inhibitor, such as vemurafenib or dabrafenib.
EXAMPLES
[0084] The examples discussed below are intended to be purely exemplary of the invention and should not be considered to limit the invention in any way. The examples are not intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (for example, amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
Example 1: Murine CD80 ECD Fusion Molecules (mCD80-Fc) Do Not Engage PD-L1
[0085] Adult murine splenocytes from both BALB/c and C57Bl/6 strains were used to determine if a mouse surrogate fusion protein comprising the extracellular domain (ECD) of murine CD80 linked to the Fc domain of mouse IgG2a wild type (mCD80-Fc) engages CD80 ligands.
[0086] Mouse splenocytes were prepared from adult BALB/c and C56Bl/6 mice by methods known to those of ordinary skill in the art. The splenocytes (2-4×10.sup.6 cells/mL) were pelleted by centrifugation and the media discarded. The mCD80-Fc was added at various concentrations (0-1000 μg/mL) and incubated for 40 minutes on ice. Paraformaldehyde (4%) was added to the splenocytes and incubated for 10 minutes at room temperature. The splenocytes were washed and pelleted by centrifugation, followed by addition of biotin-labeled anti-mouse IgG in FACS buffer and further incubation for 20 minutes at room temperature. A mixture of streptavidin-Alexa488 and antibodies directed to CTLA-4, PD-L1, and CD28 were added. Quantum Simply Cellular Bang beads were used to develop a standard curve for mCD80-Fc molecules. Data from the samples was acquired on a BD LSRII or BD LSRFortessa and analyzed using FlowJo, Excel, and Graphpad Prism.
[0087] FACS analysis was performed to determine the engagement of mCD80-Fc to CD11b+ dendritic cells, CD11b− dendritic cells, macrophages, NK cells, CD4+ T cells, CD8+ T cells.
[0088]
[0089] PD-L1 was detected on all immune cells tested, with the highest expression on macrophages. There were no changes in the amount of free PD-L1, even with increasing concentrations of mCD80-Fc, demonstrating that there is no interaction between mCD80-Fc and PD-L1 (
[0090] In contrast, CD4+ and CD8+ T cells are the only immune cells evaluated that displayed CD28 expression. With increasing concentrations of mCD80-Fc, there was a significant decrease in the amount of free CD28, demonstrating that mCD80-Fc binds to CD28 (
[0091] These results demonstrate that mCD80-Fc primarily binds CD4+ T cells and CD8+ T cells from BALB/c and C57Bl/6 splenocytes via CD28 engagement, and not PD-L1 engagement.
Example 2: Human CD80 ECD Fusion Molecules (hCD80-Fc) do not Engage PD-L1
[0092] Chinese Hamster Ovary (“CHO”) cells were evaluated for hCD80-Fc engagement of human CD80 ligands. CHO cells were engineered to express human CTLA-4, PD-L1, CD28, or all three CD80 ligands (i.e., CHO-CTLA4/PD-L1/CD28; “CHO-3”). The protocol for determining hCD80-Fc engagement to ligands is the same as was performed in Example 1.
[0093]
[0094] These results show that hCD80-Fc engages CTLA-4 and CD28, but not PD-L1. With respect to the CHO-3 cell line, hCD80-Fc bound both CTLA-4 and CD28 at similar levels as in the singly-expressing CHO cell lines.
[0095] Human PBMCs were evaluated for hCD80-Fc engagement on B cells (CD19+), monocytes (CD14+), NK cells (CD56+), and T cells (CD3+CD4+ or CD3+CD8+).
[0096] PD-L1 was detected on T cells and monocytes, but CD28 was detected primarily on CD4+ and CD8+ T cells.
[0097] Human in vitro-expanded CD4+ Teff and CD4+ Tregs were evaluated for hCD80-Fc engagement of CTLA-4, PD-L1, and CD28. Human in vitro-expanded CD4+ Teff and CD4+ Tregs have been shown to express CTLA-4, PD-L1, and CD28 (
Example 3: mCD80-Fc Inhibits Growth of Tumors that do not Express PD-L1 in a CT26 Syngeneic Mouse Model
[0098] The data from Examples 1 and 2 demonstrate that CD80 does not engage with PD-L1. Thus, to determine if PD-L1 engagement is needed for mCD80-Fc to exert its anti-tumor activity, CT26 PD-L1 knock-out tumor cells were used in an in vivo syngeneic mouse model. Unlike xenograft models, syngeneic mouse models possess a functional immune system and therefore are useful in evaluating cancer immunotherapies, which function by harnessing the endogenous immune response. CT26 is a murine colorectal carcinoma derived from BALB/c mice that expresses high levels of PD-L1. In this study, a genetically-engineered CT26 tumor (CT26 PD-L1 KO) that does not express PD-L1 was used. Immuno-competent BALB/c mice were inoculated with CT26 PD-L1 KO tumor cells. The mice were placed into three groups for treatment with the following: (1) Mouse IgG2a (control); (2) mCD80-Fc; or (3) untreated control. The mice were treated with 0.3 mg/kg mouse IgG2a (group 1) or 0.3 mg/kg mCD80-Fc (group 2) on days 4, 7, and 11 (days post-inoculation) by intravenous injection. See Table 1. The average tumor size when treatment began was 90 mm.sup.3. The study concluded on day 21.
TABLE-US-00001 TABLE 1 Dosing Mice Group Treatment (mg/kg, schedule, route) (n) 1 Mouse 0.3 mg/kg on D4, D7, 15 IgG2a D11 200 μL IV 2 mCD80-Fc 0.3 mg/kg on D4, D7, 15 D11 200 μL IV 3 n/a n/a 15
[0099]
[0100] The invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described will become apparent to those skilled in the art from the foregoing description and accompanying figures. Such modifications are intended to fall within the scope of the appended claims.
[0101] All references (e.g., publications or patents or patent applications) cited herein are incorporated herein by reference in their entirety and for all purposes to the same extent as if each individual reference (e.g., publication or patent or patent application) was specifically and individually indicated to be incorporated by reference in its entirety for all purposes.
[0102] Other embodiments are within the following claims.
TABLE-US-00002 TABLE OF SEQUENCES The table below provides a listing of certain sequences referenced herein. SEQ. ID. NO. Description Sequence 1 Human CD80 VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQ ECD sequence KEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS (without signal IVILALRPSDEGTYECVVLKYEKDAFKREHLAEV sequence) TLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPH LSWLENGEELNAINTTVSQDPETELYAVSSKLDF NMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEH FPDN 2 Mouse CD80 VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYW ECD sequence QKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTY (without signal SLIILGLVLSDRGTYSCVVQKKERGTYEVKHLAL sequence) VKLSIKADFSTPNITESGNPSADTKRITCFASGGFP KPRFSWLENGRELPGINTTISQDPESELYTISSQLD FNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPP DSKN 3 Fc human EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDT IgG1 LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 4 Mouse CD80 VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYW ECD mouse Fc QKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTY IgG2a (Fc SLIILGLVLSDRGTYSCVVQKKERGTYEVKHLAL portion VKLSIKADFSTPNITESGNPSADTKRITCFASGGFP underlined) KPRFSWLENGRELPGINTTISQDPESELYTISSQLD FNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPP DSKNEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPK IKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVN NVEVHTAQTQTHREDYNSTLRVVSALPIQHQDW MSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQ VYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVE WTNNGKTELNYKNTEPVLDSDGSYFMYSKLRV EKKNWVERNSYSCSVVHEGLHNHEITTKSFSRTP GK 5 Human CD80 VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQ ECD Human KEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS Fc IgG1 WT IVILALRPSDEGTYECVVLKYEKDAFKREHLAEV (Fc portion TLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPH underlined) LSWLENGEELNAINTTVSQDPETELYAVSSKLDF NMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEH FPDNEPKSSDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK 6 human PD-L1 FT VTVPKDLYVV EYGSNMTIEC (mature, KFPVEKQLDL AALIVYWEME DKNIIQFVHG without signal EEDLKVQHSS YRQRARLLKD QLSLGNAALQ sequence) ITDVKLQDAG VYRCMISYGG ADYKRITVKV NAPYNKINQR ILVVDPVTSE HELTCQAEGY PKAEVIWTSS DHQVLSGKTT TTNSKREEKI FNVTSTLRIN TTTNEIFYCT FRRLDPEENH TAELVIPELP LAHPPNERTH LVILGAILLC LGVALTFIFR LRKGRMMDVK KCGIQDTNSK KQSDTHLEET