ANTI-HUMAN TIM-3 MONOCLONAL ANTIBODY AND APPLICATION THEREOF
20220033501 · 2022-02-03
Inventors
- Ningning Song (Shanghai, CN)
- Qing Duan (Shanghai, CN)
- Lile Liu (Shanghai, CN)
- Tatchi Teddy Yang (Shanghai, CN)
- Lina Xu (Shanghai, CN)
- Hu LIU (Shanghai, CN)
- Peipei Wei (Shanghai, CN)
- Qian Wang (Shanghai, CN)
- Yuangdong WANG (Shanghai, CN)
- Xiaohui Shao (Shanghai, CN)
- Shaoping Hu (Shanghai, CN)
- Yu Zhang (Shanghai, CN)
- Jian Wu (Shanghai, CN)
- Meilling WANG (Shanghai, CN)
- Dongxu WANG (Shanghai, CN)
- Chaohui DAI (Shanghai, CN)
- Mengying WANG (Shanghai, CN)
Cpc classification
C12N5/10
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
A61K47/6803
HUMAN NECESSITIES
A61P37/06
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K47/68
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
A61P37/06
HUMAN NECESSITIES
Abstract
Provided are a high-affinity full human monoclonal antibody highly specifically targeting to TIM-3 and a preparation method therefor. The monoclonal antibody has a remarkable antitumor activity, and can be used for preparing a related diagnostic reagent or a pharmaceutical composition preventing or treating diseases related to TIM-3 dysfunction.
Claims
1. A heavy chain variable region of an antibody, wherein the heavy chain variable region comprises the following three complementarity determining regions or CDRs: VH-CDR1 shown in SEQ ID NO. 10n+3, VH-CDR2 shown in SEQ ID NO. 10n+4, and VH-CDR3 shown in SEQ ID NO. 10n+5; wherein each n is independently 0, 1, 2, 3, 4, 5 or 6; wherein any one of the above amino acid sequences further comprises a derivative sequence which is obtained through optional addition, deletion, modification and/or substitution of at least one amino acid and is capable of retaining the binding affinity to TIM-3.
2-4. (canceled)
5. An antibody, wherein the antibody comprises: (1) the heavy chain variable region of claim 1; and/or (2) the light chain variable region comprising the following three complementarity determining regions or CDRs: VL-CDR1 shown in SEQ ID NO. 10n+8, VL-CDR2 shown in SEQ ID NO. 10n+9, and VL-CDR3 shown in SEQ ID NO. 10n+10; wherein each n is independently 0, 1, 2, 3, 4, 5 or 6; wherein any one of the above amino acid sequences further comprises a derivative sequence which is obtained through optional addition, deletion, modification and/or substitution of at least one amino acid and is capable of retaining the binding affinity to TIM-3.
6. The antibody of claim 5, wherein the antibody comprises the heavy chain variable region and the light chain variable region; wherein, the heavy chain variable region and the light chain variable region comprise CDRs selected from the group consisting of: TABLE-US-00027 VH-CDR1 VH-CDR2 VH-CDR3 VL-CDR1 VL-CDR2 VL-CDR3 Sequence Sequence Sequence Sequence Sequence Sequence number number number number number number 3 4 5 8 9 10 13 14 15 18 19 20 23 24 25 28 29 30 33 34 35 38 39 40 43 44 45 48 49 50 53 54 55 58 59 60 63 64 65 68 69 70 wherein any one of the above amino acid sequences further comprises a derivative sequence which is obtained through optional addition, deletion, modification and/or substitution of at least one amino acid and is capable of retaining the binding affinity to TIM-3.
7. The antibody of claim 5, wherein the heavy chain variable region of the antibody comprises the amino acid sequence shown in SEQ ID NO. 1, 11, 21, 31, 41, 51 or 61; and/or the light chain variable region of the antibody comprises the amino acid sequence shown in SEQ ID NO. 6, 16, 26, 36, 46, 56 or 66.
8. The antibody of claim 6, wherein the antibody is selected from the group consisting of: TABLE-US-00028 VH VL sequence sequence Antibody number clone number number 1 7A4F10 1 6 2 18D2H2 11 16 3 134H3G6 21 26 4 215A8F2 31 36 5 34B6D8 41 46 6 39E5H1 51 56 7 57F4E5 61 66.
9. A recombinant protein, wherein the recombinant protein comprises: (i) the antibody of claim 5; and (ii) an optional tag sequence that assists expression and/or purification.
10. A polynucleotide, wherein the polynucleotide encodes a polypeptide selected from group consisting of: (1) the antibody of claim 5; and (2) the recombinant protein comprising the antibody.
11. The polynucleotide of claim 10, wherein the polynucleotide encoding the heavy chain variable region is shown in SEQ ID NO. 2, 12, 22, 32, 42, 52 or 62; and/or, the polynucleotide encoding the light chain variable region is shown in SEQ ID NO. 7, 17, 27, 37, 47, 57 or 67.
12. The polynucleotide of claim 11, wherein the polynucleotide encoding the heavy chain variable region and the polynucleotide encoding the light chain variable region are selected from the group consisting of: TABLE-US-00029 Sequence number of Sequence number of the polynucleotide the polynucleotide Clone encoding VH encoding VL 7A4F10 2 7 18D2H2 12 17 134H3G6 22 27 215A8F2 32 37 34B6D8 42 47 39E5H1 52 57 57F4E5 62 67.
13. A vector, wherein the vector comprises the polynucleotide of claim 10.
14. A genetically engineered host cell, wherein the host cell contains the vector of claim 13.
15. An antibody conjugate, wherein the antibody conjugate comprises: (a) an antibody moiety, which is selected from the group consisting of: the antibody of claim 5; and (b) a coupling moiety coupled to the antibody moiety, and the coupling moiety is selected from the group consisting of a detectable label, a drug, a toxin, a cytokine, a radionuclide, an enzyme, and a combination thereof.
16. An immune cell, which expresses or is exposed outside the cell membrane with the antibody of claim 5.
17. A pharmaceutical composition, wherein the pharmaceutical composition comprises: (i) an active ingredient, wherein the active ingredient is selected from the group consisting of: the antibody of claim 5, the recombinant protein comprising the antibody, the antibody conjugate comprising the antibody, the immune cell expressing the antibody, and a combination thereof; and (ii) a pharmaceutically acceptable carrier.
18. A method for the treatment of diseases associated with abnormal TIM-3 expression or function, comprising administering an effective amount of the antibody of claim 5, the recombinant protein comprising the antibody, the antibody conjugate comprising the antibody, the immune cell expressing the antibody, and a combination thereof, to a subject in need.
19. The method of claim 18, the disease associated with abnormal TIM-3 expression or function is cancer.
Description
DESCRIPTION OF THE FIGURES
[0195]
[0196]
[0197]
[0198]
[0199]
[0200]
[0201]
[0202]
[0203]
[0204]
[0205] TIM-3 extracellular domain protein in the enzyme-linked immunosorbent assay.
[0206]
[0207]
[0208]
[0209]
[0210]
[0211]
[0212]
MODES FOR CARRYING OUT THE PRESENT INVENTION
[0213] Through extensive and intensive studies, the inventors prepared TIM-3 antibodies by optimized hybridoma technology using human TIM-3 as immunogen. Specifically, the invention prepared fully human antibody using human antibody transgenic mouse technology and obtained leading antibody of the TIM-3 antibody. Then, through the preliminary production, purification and verification of the leading antibody, TIM-3 antibody with excellent biological characteristics such as high antibody affinity and significantly increasing IFN expression level in the activation reaction of human peripheral blood mononuclear cells was obtained. Then the amino acid sequences of heavy chain variable region and light chain variable region of the TIM-3 antibody were obtained by molecular biology sequencing. The TIM-3 antibody has high affinity with TIM-3 proteins of human origin and monkey origin, and can increase the expression level of IFN in human peripheral blood mononuclear cells induced by OKT3 activation. The present invention also provides uses of these antibodies, including but not limited to inhibiting the negative regulation of signaling pathways mediated by TIM-3 and its ligand, activating tumor-specific immune responses, and being used alone or in combination with anti-PD-1, CTLA-4 monoclonal antibodies or other anti-tumor drugs for tumor immunotherapy. The present invention has been completed on the basis of this.
[0214] Terms
[0215] In the present invention, “VH-CDR1” and “CDR-H1” can be used interchangeably and both refer to CDR1 of heavy chain variable region; “VH-CDR2” and “CDR-H2” can be used interchangeably and both refer to CDR2 of heavy chain variable region; “VH-CDR3” and “CDR-H3” can be used interchangeably and both refer to CDR3 of heavy chain variable region. “VL-CDR1” and “CDR-L1” can be used interchangeably and both refer to CDR1 of light chain variable region; “VL-CDR2” and “CDR-L2” can be used interchangeably and both refer to CDR2 of light chain variable region; “VL-CDR3” and “CDR-L3” can be used interchangeably and both refer to CDR3 of light chain variable region.
[0216] Antibody
[0217] As used herein, the term “antibody” or “immunoglobulin” is a heterotetrameric glycoprotein of about 150,000 Da having the same structural characteristics, which consists of two identical light chains (L) and two identical heavy chains (H). Each light chain is linked to a heavy chain via a covalent disulfide bond, and different immunoglobulin isotypes have different numbers of disulfide bonds between the heavy chains. There are also regularly spaced intrachain disulfide bonds in each heavy and each light chain. Each heavy chain has a variable region (VH) at one end, followed by a plurality of constant regions. Each light chain has a variable region (VL) at one end and a constant region at the other end; the constant region of a light chain pairs with the first constant region of a heavy chain, and the variable region of a light chain pairs with the variable region of a heavy chain. Special amino acid residues form an interface between the variable regions of a light chain and a heavy chain.
[0218] As used herein, the term “variable” means that antibodies are different from each other in terms of sequence in certain parts of variable regions, which is responsible for the binding and specificity of various specific antibodies to their specific antigens. However, the variability is not distributed evenly throughout the variable regions of an antibody. It is concentrated in three segments called complementarity determining regions (CDRs) or hypervariable regions in the light and heavy chain variable regions. The conserved parts of variable regions are called framework regions (FRs). The variable regions of the natural heavy and light chains each contain four FR regions, which are roughly in the β-folded configuration, connected by the three CDRs that form the connecting loop, and in some cases may form a partly β folded structure. The CDRs in each chain are closely linked together via the FR regions, and together with the CDRs of the other chain, form the antigen binding site of an antibody (see Kabat et al., NIH Publ. No. 91-3242, Vol. I, pp.
[0219] 647-669 (1991)). The constant regions are not directly involved in the binding of an antibody to an antigen, however, they exhibit different effector functions, such as involved in the antibody-dependent cytotoxicity of an antibody.
[0220] The light chains of vertebrate antibodies (immunoglobulins) can be classified into one of two distinct classes (referred to as κ and λ) based on the amino acid sequence of their constant regions. Immunoglobulins can be classified into different classes depending on the amino acid sequences of their heavy chain constant regions. There are mainly five classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, some of which can be further classified into subclasses (isotypes), such as IgG1, IgG2, IgG3, IgG4, IgA, and IgA2. The heavy chain constant regions corresponding to different classes of immunoglobulins are called a, δ, ε, γ, and μ, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known for those skilled in the art.
[0221] In general, the antigen binding characteristics of an antibody can be described by three specific regions located in the heavy and light chain variable regions, called complementarity determining regions (CDRs), which divide the variable region into four framework regions (FRs); the amino acid sequences of the four FRs are relatively conservative and are not directly involved in the binding reaction. These CDRs form a ring structure, and approach to each other in the steric structure by virtue of the β-sheets formed by the FRs between them, and the CDRs on the heavy chain and the CDRs on the corresponding light chain constitute the antigen-binding site of an antibody. By comparison of the amino acid sequences of antibodies of the same type, it can be determined which amino acids form FRs or CDRs.
[0222] The present invention includes not only an intact antibody, but also the fragments of the antibody having an immunological activity or a fusion protein formed by the antibody and another sequence. Therefore, the present invention also includes fragments, derivatives and analogs of the antibody.
[0223] In the present invention, antibodies include murine, chimeric, humanized or fully human antibodies as prepared by techniques well known to those skilled in the art. Recombinant antibodies, such as chimeric and humanized monoclonal antibodies, including human and non-human portions, can be obtained by standard DNA recombination techniques, all of which are useful antibodies. A chimeric antibody is a molecule in which different portions are derived from different animal species, for example, a chimeric antibody having a variable region from a monoclonal antibody from a mouse and a constant region from a human immunoglobulin (see, for example, U.S. Pat. Nos. 4,816,567 and 4,816,397, which are incorporated herein by reference in its entirety). A humanized antibody refers to an antibody molecule derived from a non-human species, which has one or more complementarity determining regions (CDRs) derived from a non-human species and framework regions derived from a human immunoglobulin molecule (see U.S. Pat. No. 5,585,089, which is incorporated herein by reference in its entirety). These chimeric and humanized monoclonal antibodies can be prepared by recombinant DNA techniques well known in the art.
[0224] In the present invention, an antibody may be monospecific, bispecific, trispecific, or multispecific.
[0225] In the present invention, the antibody of the present invention further includes a conservative variant thereof, which refers to a polypeptide formed by substitution of at most 10, preferably at most 8, more preferably at most 5, and most preferably at most 3 amino acids with amino acids having similar or analogous property, as compared to the amino acid sequence of the antibody of the present invention. These conservatively variant polypeptides are preferably produced by amino acid substitution according to Table 19.
TABLE-US-00005 TABLE 19 Preferred Initial residue Representative substitution substitution Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Lys; Arg Gln Asp (D) Glu Glu Cys (C) Ser Ser Gln (Q) Asn Asn Glu (E) Asp Asp Gly (G) Pro; Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe Leu Leu (L) Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Leu; Val; Ile; Ala; Tyr Leu Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala Leu
[0226] Anti-TIM-3 Antibody
[0227] In the present invention, the antibody is an anti-TIM-3 antibody. The present invention provides an antibody with high specificity and high affinity against TIM-3, which comprises a heavy chain and a light chain, wherein the heavy chain contains a heavy chain variable region (VH) amino acid sequence, and the light chain contains a light chain variable region (VL) amino acid sequence.
[0228] Preferably,
[0229] the heavy chain variable region (VH) has complementarity determining regions or CDRs selected from the group consisting of:
[0230] VH-CDR1 shown in SEQ ID NO. 10n+3,
[0231] VH-CDR2 shown in SEQ ID NO. 10n+4, and
[0232] VH-CDR3 shown in SEQ ID NO. 10n+5;
[0233] wherein each n is independently 0, 1, 2, 3, 4, 5 or 6;
[0234] the light chain variable region (VL) has complementarity determining regions or CDRs selected from the group consisting of:
[0235] VL-CDR1 shown in SEQ ID NO. 10n+8,
[0236] VL-CDR2 shown in SEQ ID NO. 10n+9, and
[0237] VL-CDR3 shown in SEQ ID NO. 10n+10;
[0238] wherein each n is independently 0, 1, 2, 3, 4, 5 or 6;
[0239] wherein any one of the above amino acid sequences further comprises a derivative sequence which is obtained through optional addition, deletion, modification and/or substitution of at least one amino acid and is capable of retaining TIM-3 binding affinity.
[0240] Preferably, the heavy chain variable region (VH) comprises the following three complementary determining regions or CDRs:
[0241] VH-CDR1 shown in SEQ ID NO. 10n+3,
[0242] VH-CDR2 shown in SEQ ID NO. 10n+4, and
[0243] VH-CDR3 shown in SEQ ID NO. 10n+5;
[0244] the light chain variable region (VL) comprises the following three complementary determining regions or CDRs:
[0245] VL-CDR1 shown in SEQ ID NO. 10n+8,
[0246] VL-CDR2 shown in SEQ ID NO. 10n+9, and
[0247] VL-CDR3 shown in SEQ ID NO. 10n+10;
[0248] wherein each n is independently 0, 1, 2, 3, 4, 5 or 6; preferably n is 0 or 1;
[0249] wherein any one of the above amino acid sequences further comprises a derivative sequence which is obtained through optional addition, deletion, modification and/or substitution of at least one amino acid and is capable of retaining the binding affinity to TIM-3.
[0250] In another preferred embodiment, the sequence with at least one amino acid added, deleted, modified and/or substituted in any of the above amino acid sequences is preferably an amino acid sequence having a homology or sequence identity of at least 80%, preferably at least 85%, more preferably at least 90%, most preferably at least 95% to the above amino acid sequence.
[0251] Method for determining sequence homology or identity that are well known to the ordinary skilled in the art includes, but are not limited to: Computer Molecular Biology, edited by Lesk, A. M., Oxford University Press, New York, 1988; Biocomputing; Biocomputing: Informatics and Genome Projects, edited by Smith, D. W., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, edited by Griffin, A. M. and Griffin, H. G., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987, and Sequence Analysis Primer, edited by Gribskov, M. and Devereux, J., M Stockton Press, New York, 1991 and Carillo, H. & Lipman, D., SIAM J. Applied Math., 48:1073(1988). The preferred method for determining identity is to obtain the greatest match between the sequences tested. Methods for determining identity are compiled into publicly available computer programs. Preferred computer program method for determining identity between two sequences includes, but are not limited to, the GCG software package (Devereux, J. et al., 1984), BLASTP, BLASTN, and FASTA (Altschul, S, F. et al., 1990). The BLASTX program is available to the public from NCBI and other sources (BLAST Handbook, Altschul, S. et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul, S. et al., 1990). The well-known Smith Waterman algorithm can also be used to determine identity.
[0252] The antibody in the present invention can be a full-length protein (such as IgG1, IgG2a, IgG2b or IgG2c), or a protein fragment containing an antigen-antibody binding domain (such as Fab, F(ab′), sdAb, ScFv fragments). The antibody in the present invention can be a wild-type protein, or a mutant protein that has achieved a certain effect through specific mutations, for example, using mutations to eliminate the effector function of the antibody.
[0253] Preferably, the antibody described herein is one or more of an antibody full-length protein, an antigen-antibody binding domain protein fragment, a bispecific antibody, a multispecific antibody, a single chain antibody fragment (scFv), a single domain antibody (sdAb) and a single-domain antibody, as well as a monoclonal antibody or a polyclonal antibody made from the above antibodies. The monoclonal antibody can be developed by a variety of approaches and technologies, including hybridoma technology, phage display technology, single lymphocyte gene cloning technology, etc. The mainstream is to prepare monoclonal antibodies from wild-type or transgenic mice through hybridoma technology.
[0254] The antibody full-length protein is a conventional antibody full-length protein in the art, which comprises a heavy chain variable region, a light chain variable region, a heavy chain constant region, and a light chain constant region. The heavy chain variable region and light chain variable region of the protein and human heavy chain constant region and human light chain constant region constitute a fully human antibody full-length protein. Preferably, the antibody full-length protein is IgG1, IgG2, IgG3 or IgG4.
[0255] The antibody of the present invention may be a double-chain or single-chain antibody, and may be selected from animal-derived antibodies, chimeric antibodies and humanized antibodies, more preferably be selected from humanized antibodies and human-animal chimeric antibodies, more preferably a fully humanized antibody.
[0256] The antibody derivative of the present invention may be a single-chain antibody, and/or an antibody fragment, for example, Fab, Fab′, (Fab′)2 or other antibody derivatives known in the art, etc., and may be any one or more of IgA, IgD, IgE, IgG and IgM antibodies or other subtype antibodies.
[0257] The single-chain antibody is a conventional single-chain antibody in the art, which comprises a heavy chain variable region, a light chain variable region and a short peptide of 15-20 amino acids.
[0258] In the present invention, the animal is preferably a mammal, such as mouse.
[0259] The antibody of the present invention may be a chimeric antibody, a humanized antibody, a CDR grafted and/or modified antibody that targets TIM-3, such as human TIM-3.
[0260] In above content of the present invention, the number of the added, deleted, modified and/or substituted amino acids, is preferably not more than 40%, more preferably not more than 35%, more preferably 1-33%, more preferably 5-30%, more preferably 10-25%, and more preferably 15-20% of the total number of the amino acids of the initial amino acid sequence.
[0261] In the above content of the present invention, more preferably, the number of the added, deleted, modified and/or substituted amino acids, may be 1-7, more preferably 1-5, more preferably 1-3, and more preferably 1-2.
[0262] In another preferred embodiment, the heavy chain variable region of the antibody has the amino acid sequence shown in SEQ ID NO. 1, 11, 21, 31, 41, 51 or 61.
[0263] In another preferred embodiment, the light chain variable region of the antibody has the amino acid sequence shown in SEQ ID NO. 6, 16, 26, 36, 46, 56 or 66.
[0264] In another preferred embodiment, the amino acid sequences of the heavy chain variable region and/or the light chain variable region of the antibody targeting TIM-3 are shown in the following Table 20:
TABLE-US-00006 TABLE 20 VH VL sequence sequence Antibody number number number 1 1 6 2 11 16 3 21 26 4 31 36 5 41 46 6 51 56 7 61 66
[0265] In another preferred embodiment, the antibody targeting TIM-3 is 7A4F10, 10D2H2, 134H3G6, 215A8F2, 34B6D8, 39E5H1 or 57F4E5.
[0266] In another preferred embodiment, the antibody targeting TIM-3 is 7A4F10.
[0267] In another preferred embodiment, the antibody targeting TIM-3 is 10D2H2.
[0268] Recombinant Protein
[0269] The invention also provides a recombinant protein comprising one or more of heavy chain CDR1 (VH-CDR1), heavy chain CDR2 (VH-CDR2) and heavy chain CDR3 (VH-CDR3) of a TIM-3 antibody, and/or one or more of light chain CDR1 (VL-CDR1), light chain CDR2 (VL-CDR2) and light chain CDR3 (VL-CDR3) of a TIM-3 antibody,
[0270] The sequences of the heavy chain CDR1-3 are as follows:
[0271] VH-CDR1 shown in SEQ ID NO. 10n+3,
[0272] VH-CDR2 shown in SEQ ID NO. 10n+4,
[0273] VH-CDR3 shown in SEQ ID NO. 10n+5;
[0274] The sequences of the light chain CDR1-3 are as follows:
[0275] VL-CDR1 shown in SEQ ID NO. 10n+8,
[0276] VL-CDR2 shown in SEQ ID NO. 10n+9, and
[0277] VL-CDR3 shown in SEQ ID NO. 10n+10;
[0278] wherein each n is independently 0, 1, 2, 3, 4, 5 or 6; preferably n is 0 or 1;
[0279] wherein any one of the above amino acid sequences further comprises a derivative sequence which is obtained through optional addition, deletion, modification and/or substitution of at least one amino acid and is capable of retaining the binding affinity to TIM-3.
[0280] In another preferred embodiment, the sequence with at least one amino acid added, deleted, modified and/or substituted in any of the above amino acid sequences is preferably an amino acid sequence having a homology or sequence identity of at least 80%, preferably at least 85%, more preferably at least 90%, most preferably at least 95% to the above amino acid sequence.
[0281] In another preferred embodiment, the recombinant protein according to the present invention comprises a heavy chain variable region of a TIM-3 antibody and/or a light chain variable region of a TIM-3 antibody, the heavy chain variable region of the antibody has the amino acid sequence shown in SEQ ID NO. 1, 11, 21, 31, 41, 51 or 61; and the light chain variable region of the antibody has the amino acid sequence shown in SEQ ID NO. 6, 16, 26, 36, 46, 56 or 66.
[0282] In another preferred embodiment, the recombinant protein according to the present invention comprises a heavy chain variable region of a TIM-3 antibody and a light chain variable region of a TIM-3 antibody, the heavy chain variable region of the antibody has the amino acid sequence shown in SEQ ID NO. 1, 11, 21, 31, 41, 51 or 61; and the light chain variable region of the antibody has the amino acid sequence shown in SEQ ID NO. 6, 16, 26, 36, 46, 56 or 66.
[0283] In another preferred embodiment, the amino acid sequence numbers of the recombinant protein as well as the heavy chain CDR1-3 and light chain CDR1-3 comprised therein are as shown in Table 21:
TABLE-US-00007 TABLE 21 Amino acid sequence numbers of heavy chain CDR1-3 and light chain CDR1-3 Recombinant Heavy chain protein Light chain protein protein Variable Variable numbers region VH-CDR1 VH-CDR2 VH-CDR3 region VL-CDR1 VL-CDR2 VL-CDR3 1 1 3 4 5 6 8 9 10 2 11 13 14 15 16 18 19 20 3 21 23 24 25 26 28 29 30 4 31 33 34 35 36 38 39 40 5 41 43 44 45 46 48 49 50 6 51 53 54 55 56 58 59 60 7 61 63 64 65 66 68 69 70
[0284] wherein any one of the above amino acid sequences further comprises a derivative sequence which is obtained through optional addition, deletion, modification and/or substitution of at least one amino acid and is capable of retaining the binding affinity to TIM-3.
[0285] Preferably, the recombinant protein further comprises an antibody heavy chain constant region and/or an antibody light chain constant region, wherein the antibody heavy chain constant region is conventional in the art, preferably a rat antibody heavy chain constant region or a human antibody heavy chain constant region, more preferably a human antibody heavy chain constant region. The antibody light chain constant region is conventional in the art, preferably a rat antibody light chain constant region or a human antibody light chain constant region, more preferably a human antibody light chain constant region.
[0286] The recombinant protein is a conventional protein in the art. Preferably, it is one or more of an antibody full-length protein, an antigen-antibody binding domain protein fragment, a bispecific antibody, a multispecific antibody, a single chain antibody fragment (scFv), a single domain antibody (sdAb) and a single-domain antibody, as well as a monoclonal antibody or a polyclonal antibody made from the above antibodies. The monoclonal antibody can be developed by a variety of approaches and technologies, including hybridoma technology, phage display technology, single lymphocyte gene cloning technology, etc. The mainstream is to prepare monoclonal antibodies from wild-type or transgenic mice through hybridoma technology.
[0287] The antibody full-length protein is a conventional antibody full-length protein in the art, which comprises a heavy chain variable region, a light chain variable region, a heavy chain constant region, and a light chain constant region. The heavy chain variable region and light chain variable region of the protein and human heavy chain constant region and human light chain constant region constitute a fully human antibody full-length protein. Preferably, the antibody full-length protein is IgG1, IgG2, IgG3 or IgG4.
[0288] The single-chain antibody is a conventional single-chain antibody in the art, which comprises a heavy chain variable region, a light chain variable region and a short peptide of 15-20 amino acids.
[0289] The antigen-antibody binding domain protein fragments are conventional antigen-antibody binding domain protein fragments in the art, which comprise a light chain variable region, a light chain constant region, and an Fd segment of heavy chain constant region. Preferably, the antigen-antibody binding domain protein fragments are Fab and F (ab′).
[0290] The single domain antibody is a conventional single domain antibody in the art, which comprises a heavy chain variable region and a heavy chain constant region.
[0291] The single-domain antibody is a conventional single-domain antibody in the art, which only comprises a heavy chain variable region.
[0292] Wherein, the preparation method of the recombinant protein is a conventional preparation method in the art. Preferably, the preparation method is: isolating and obtaining the protein from an expression transformant that recombinantly expresses the protein or obtaining the protein by artificially synthesizing a protein sequence. The method of isolating and obtaining the protein from an expression transformant that recombinantly expresses the protein is preferably as follows: cloning a nucleic acid molecule encoding the protein carrying a point mutation into a recombinant vector, and transforming the obtained recombinant vector into a transformant to obtain a recombinant expression transformant, and by culturing the obtained recombinant expression transformant, the recombinant protein can be obtained by separation and purification.
[0293] Nucleic Acid
[0294] The present invention also provides a nucleic acid encoding the above-mentioned antibody (e.g., an anti-TIM-3 antibody) or recombinant protein, or the heavy chain variable region or the light chain variable region of the anti-TIM-3 antibody.
[0295] Preferably, the nucleotide sequence of the nucleic acid encoding the heavy chain variable region is shown in SEQ ID NO. 2, 12, 22, 32, 42, 52 or 62 in the sequence listing; and/or, the nucleotide sequence of the nucleic acid encoding the light chain variable region is shown in SEQ ID NO. 7, 17, 27, 37, 47, 57 or 67 in the sequence listing.
[0296] More preferably, the nucleotide sequence of the nucleic acid encoding the heavy chain variable region is shown in SEQ ID NO. 2, 12, 22, 32, 42, 52 or 62 in the sequence listing; and, the nucleotide sequence of the nucleic acid encoding the light chain variable region is shown in SEQ ID NO. 7, 17, 27, 37, 47, 57 or 67 in the sequence listing.
[0297] The preparation method of the nucleic acid is a conventional preparation method in the art. Preferably, it comprises the following steps: obtaining the nucleic acid molecule encoding the above-mentioned protein by gene cloning technology, or obtaining the nucleic acid molecule encoding the above-mentioned protein by the method of artificial full-length sequence synthesis.
[0298] Those skilled in the art know that the base sequence encoding the amino acid sequence of the protein can be replaced, deleted, changed, inserted or added appropriately to provide a polynucleotide homolog. The homolog of the polynucleotide of the present invention can be prepared by replacing, deleting or adding one or more bases of the gene encoding the protein sequence within the scope of maintaining the activity of the antibody.
[0299] Vector
[0300] The present invention also provides a recombinant expression vector comprising the nucleic acid.
[0301] The recombinant expression vector can be obtained by conventional methods in the art, that is, by connecting the nucleic acid molecule of the present invention to various expression vectors, thus being constructed. The expression vector is one of a variety of conventional vectors in the art, as long as it can carry the above-mentioned nucleic acid molecule. The vector preferably includes: various plasmids, cosmids, phage or virus vectors and the like.
[0302] The present invention also provides a recombinant expression transformant comprising the above-mentioned recombinant expression vector.
[0303] Wherein, the preparation method of the recombinant expression transformant is a conventional preparation method in the art, preferably comprising: being obtained by transforming the recombinant expression vector into a host cell. The host cell is one of a variety of conventional host cells in the art, as long as the recombinant expression vector can replicate itself stably and the nucleic acid carried can be effectively expressed. Preferably, the host cell is E. coli TG1 or E. coli BL21 cell (for expressing single-chain antibodies or Fab antibodies), or HEK293 or CHO cell (for expressing full-length IgG antibodies). The above-mentioned recombinant expression plasmid is transformed into a host cell to obtain the preferred recombinant expression transformant of the present invention. The transformation method is a conventional transformation method in the art, preferably a chemical transformation method, a heat shock method or an electrotransformation method.
[0304] Antibody Preparation
[0305] The sequence of the DNA molecule for the antibody or a fragment thereof according to the present invention can be obtained by conventional techniques, for example, methods such as PCR amplification or genomic library screening. In addition, the sequences encoding light chain and heavy chain can be fused together, to form a single-chain antibody.
[0306] Once a relevant sequence is obtained, the relevant sequence can be obtained in bulk using a recombination method. This is usually carried out by cloning the sequence into a vector, transforming a cell with the vector, and then separating the relevant sequence from the proliferated host cell by conventional methods.
[0307] In addition, a relevant sequence can be synthesized artificially, especially when the fragment is short in length. Usually, several small fragments are synthesized first, and then are linked together to obtain a fragment with a long sequence.
[0308] At present, it is possible to obtain a DNA sequence encoding the antibody of the present invention (or fragments thereof, or derivatives thereof) completely by chemical synthesis. The DNA sequence can then be introduced into a variety of existing DNA molecules (or, for example, vectors) and cells known in the art. In addition, mutations can also be introduced into the protein sequences of the present invention by chemical synthesis.
[0309] The present invention further relates to a vector comprising said suitable DNA sequence and a suitable promoter or a control sequence. These vectors can be used to transform suitable host cells to enable them to express protein.
[0310] The host cell can be a prokaryotic cell, such as a bacterial cell; or a lower eukaryotic cell, such as a yeast cell; or a higher eukaryotic cell, such as a mammalian cell. Preferred animal cells include, but are not limited to, CHO-S, HEK-293 cells.
[0311] In general, under conditions suitable for expression of the antibody according to the present invention, the host cell obtained is cultured. Then, the antibody of the present invention is purified by using conventional immunoglobulin purification steps, for example, the conventional separation and purification means well known to those skilled in the art, such as protein A-Sepharose, hydroxyapatite chromatography, gel electrophoresis, dialysis, ion exchange chromatography, hydrophobic chromatography, molecular sieve chromatography or affinity chromatography.
[0312] The monoclonal antibody obtained can be identified by conventional means. For example, the binding specificity of a monoclonal antibody can be determined by immunoprecipitation or an in vitro binding assay (such as radioimmunoassay (RIA) or enzyme-linked immunosorbent assay (ELISA)). The binding affinity of a monoclonal antibody can be determined by, for example, the Scatchard analysis (Munson et al., Anal. Biochem., 107: 220 (1980)).
[0313] The antibody according to the present invention can be expressed in a cell or on the cell membrane, or is secreted extracellularly. If necessary, the recombinant protein can be separated and purified by various separation methods according to its physical, chemical, and other properties. These methods are well known to those skilled in the art. The examples of these methods comprise, but are not limited to, conventional renaturation treatment, treatment by protein precipitant (such as salt precipitation), centrifugation, cell lysis by osmosis, ultrasonic treatment, supercentrifugation, molecular sieve chromatography (gel chromatography), adsorption chromatography, ion exchange chromatography, high performance liquid chromatography (HPLC), and any other liquid chromatography, and the combination thereof.
[0314] Antibody-Drug Conjugate (ADC)
[0315] The present invention also provides an antibody-drug conjugate (ADC) based on the antibody according to the present invention.
[0316] Typically, the antibody-drug conjugate comprises the antibody and an effector molecule, wherein the antibody is conjugated to the effector molecule, and chemical conjugation is preferred. Preferably, the effector molecule is a therapeutically active drug. In addition, the effector molecule may be one or more of a toxic protein, a chemotherapeutic drug, a small-molecule drug or a radionuclide.
[0317] The antibody according to present invention and the effector molecule may be coupled by a coupling agent. Examples of the coupling agent may be any one or more of a non-selective coupling agent, a coupling agent utilizing a carboxyl group, a peptide chain, and a coupling agent utilizing a disulfide bond. The non-selective coupling agent refers to a compound that results in a linkage between an effector molecule and an antibody via a covalent bond, such as glutaraldehyde, etc. The coupling agent utilizing a carboxyl group may be any one or more of cis-aconitic anhydride coupling agents (such as cis-aconitic anhydride) and acyl hydrazone coupling agents (the coupling site is acyl hydrazone).
[0318] Certain residues on an antibody (such as Cys or Lys, etc.) are used to link a variety of functional groups, including imaging agents (such as chromophores and fluorophores), diagnostic agents (such as MRI contrast agents and radioisotopes), stabilizers (such as poly(ethylene glycol)) and therapeutic agents. An antibody can be conjugated to a functional agent to form a conjugate of the antibody-functional agent. A functional agent (e.g. a drug, a detection reagent, a stabilizer) is conjugated (covalently linked) to an antibody. A functional agent can be linked to an antibody either directly or indirectly via a linker.
[0319] Antibodies can be conjugated to drugs to form antibody-drug conjugates (ADCs). Typically, an ADC comprises a linker between a drug and an antibody. The linker can be a degradable or non-degradable linker. Typically, degradable linkers are easily degraded in an intracellular environment, for example, the linker is degraded at the target site, thereby releasing the drug from the antibody. Suitable degradable linkers include, for example, enzyme-degradable linkers, including peptidyl-containing linkers that can be degraded by protease (e.g. lysosomal protease or endosomal protease) in a cell, or sugar linkers, for example, glucuronide-containing linkers that can be degraded by glucuronidase. Peptidyl linkers may include, for example, dipeptides, such as valine-citrulline, phenylalanine-lysine or valine-alanine. Other suitable degradable linkers include, for example, pH sensitive linkers (e.g. linkers that are hydrolyzed at a pH of below 5.5, such as hydrazone linkers) and linkers that are degraded under reducing conditions (e.g. disulfide-bond linkers). A non-degradable linker typically releases a drug under conditions that the antibody is hydrolyzed by protease.
[0320] Prior to linkage to an antibody, a linker has a reactive group capable of reacting with certain amino acid residues, and the linkage is achieved by the reactive group. A thiol-specific reactive group is preferred, and includes, for example, a maleimide compound, a halogenated (e.g. iodo-, bromo- or chloro-substituted) amide; a halogenated (e.g. iodo-, bromo- or chloro-substituted) ester; a halogenated (e.g. iodo-, bromo- or chloro-substituted) methyl ketone, a benzyl halide (e.g. iodide, bromide or chloride); vinyl sulfone, pyridyl disulfide; a mercury derivative such as 3,6-di-(mercurymethyl)dioxane, wherein the counter ion is CH.sub.3COO.sup.−, Cl.sup.− or NO.sub.3.sup.−; and polymethylene dimethyl sulfide thiosulfonate. The linker may include, for example, a maleimide linked to an antibody via thiosuccimide.
[0321] A drug may be any cytotoxic drug which inhibits cell growth or immunosuppression. In an embodiment, an antibody is linked to a drug via a linker, and the drug has a functional group that can form a bond with the linker. For example, a drug may have an amino group, a carboxyl group, a thiol group, a hydroxyl group, or a ketone group that can form a bond with a linker. When a drug is directly linked to a linker, the drug has a reactive group before being linked to an antibody.
[0322] Useful drugs include, for example, anti-tubulin drugs, DNA minor groove binding agents, DNA replication inhibitors, alkylating agents, antibiotics, folic acid antagonists, antimetabolites, chemotherapy sensitizers, topoisomerase inhibitors, vinca alkaloids, etc. Examples of particularly useful cytotoxic drugs include, for example, DNA minor groove binding agents, DNA alkylating agents, and tubulin inhibitors; typical cytotoxic drugs include, for example, auristatins, camptothecins, docamycin/duocarmycins, etoposides, maytansines and maytansinoids (e.g. DM1 and DM4), taxanes, benzodiazepines or benzodiazepine containing drugs (e.g. pyrrolo[1,4]benzodiazepines (PBDs), indolinobenzodiazepines and oxazolidinobenzodiazepines), and vinca alkaloids.
[0323] In the present invention, a drug-linker can be used to form an ADC in a simple step. In other embodiments, a bifunctional linker compound can be used to form an ADC in a two-step or multi-step process. For example, a cysteine residue is reacted with the reactive moiety of a linker in a first step, and then the functional group on the linker is reacted with a drug in the subsequent step, so as to form an ADC.
[0324] In general, the functional group on a linker is selected so that it can specifically react with the suitable reactive group on a drug moiety. As a non-limiting example, an azide-based moiety can be used to specifically react with the reactive alkynyl group on a drug moiety. The drug is covalently bound to the linker by 1,3-dipolar cycloaddition between the azide and alkynyl group. Other useful functional groups include, for example, ketones and aldehydes (suitable for reacting with hydrazides and alkoxyamines), phosphines (suitable for reacting with azides); isocyanates and isothiocyanates (suitable for reacting with amines and alcohols); and activated esters, for example, N-hydroxysuccinimide esters (suitable for reacting with amines and alcohols). These and other linkage strategies, for example, those described in “Bioconjugation Technology” (2nd Edition (Elsevier)), are well known to those skilled in the art. Those skilled in the art could understand that when a complementary pair of reactive functional groups are selected for a selective reaction between a drug moiety and a linker, each member of the complementary pair can be used for the linker, and can also be used for the drug.
[0325] The present invention further provides a method for preparing an ADC, which may further comprise: under conditions sufficient to form an antibody-drug conjugate (ADC), binding an antibody to a drug-linker compound.
[0326] In certain embodiments, the method according to the present invention comprises: under conditions sufficient to form an antibody-linker conjugate, binding an antibody to a bifunctional linker compound. In these embodiments, the method according to the present invention further comprises: under conditions sufficient to covalently link the drug moiety to the antibody via a linker, binding the antibody-linker conjugate to the drug moiety.
[0327] In some embodiments, an antibody-drug conjugate (ADC) has a formula as follows:
##STR00001##
[0328] wherein:
[0329] Ab is an antibody,
[0330] LU is a linker;
[0331] D is a drug;
[0332] And the subscript p is a value selected from 1 to 8.
[0333] Applications
[0334] The present invention also provides use of the antibody, the antibody conjugate ADC, the recombinant protein, and/or immune cell of the present invention, for example for the preparation of diagnostic preparations or the preparation of drugs.
[0335] Preferably, the drug is for prevention and/or treatment of diseases associated with abnormal TIM-3 expression or function.
[0336] Uses of the antibody, the ADC, the recombinant protein, and/or the immune cell of the present invention include (but are not limited to):
[0337] (i) diagnosis, prevention and/or treatment of tumorigenesis, for tumor growth and/or metastasis, particularly, for a tumor with TIM-3 high expression; wherein the tumor includes (but not limited to): melanoma, mesothelioma, non-small cell lung cancer, breast cancer, liver cancer, synovial sarcoma, metastatic colon cancer, kidney cancer, bladder cancer, prostate cancer, ovarian cancer, chronic hepatitis C virus infection, advanced solid cancer, malignant tumors of digestive organs, endometrial carcinoma, recurrent melanoma, head and neck squamous cell carcinoma, skin T-cell lymphoma, fallopian tube cancer, peritoneal tumor, muscle invasive bladder cancer, extensive stage small cell lung cancer, adult acute myeloid leukemia, atypical chronic myelogenous leukemia, epithelial ovarian cell carcinoma, B-cell chronic lymphocytic leukemia, skin B-cell non-Hodgkin's lymphoma, intraocular lymphoma, choriocarcinoma of testis, neuroblastoma, esophageal cancer;
[0338] (ii) diagnosis, prevention and/or treatment of an autoimmune diseases, wherein the autoimmune disease includes (but not limited to): systemic lupus erythematosus, Ooro-ocular Sjogren's syndrome, rheumatoid arthritis, ankylosing spondylitis, scleroderma, polyarteritis nodosa, Wegener granuloma, hyperthyroidism, insulin-dependent diabetes mellitus, myasthenia gravis, pemphigus vulgaris, pemphigoid, and transplant rejection.
[0339] Use for Detection and Kits
[0340] The antibody or ADC thereof of the present invention can be used for detection, for example, for detecting samples, thereby providing diagnostic information.
[0341] In the present invention, the samples (specimens) used include cells, tissue samples and biopsy specimens. The term “biopsy” used in the present invention shall include all kinds of biopsy known to those skilled in the art. Therefore, the biopsy used in the present invention may include, for example, excision samples of tumors, tissue samples prepared by endoscopic methods or organ puncture or needle biopsy.
[0342] The samples used in the present invention include fixed or preserved cell or tissue samples.
[0343] The present invention also provides a kit comprising the antibody (or fragment thereof) of the present invention. In a preferred embodiment of the present invention, the kit further includes a container, an instruction for use, buffer, and the like. In a preferred embodiment, the antibody of the present invention can be immobilized on a detection plate.
[0344] Pharmaceutical Composition
[0345] The invention further provides a composition. In the preferred examples, the composition is a pharmaceutical composition comprising the antibody, or an active fragment, a fusion protein or an ADC thereof, or a corresponding immune cell, and a pharmaceutically acceptable carrier. In general, these substances may be formulated in a non-toxic, inert and pharmaceutically acceptable aqueous carrier medium, wherein the pH is generally about 5-8, preferably, pH is about 6-8, though the pH value may be varied depending on the nature of the substances to be formulated and the condition to be treated.
[0346] The formulated pharmaceutical composition may be administered by conventional routes, including (but not limited to): intratumoral, intraperitoneal, intravenous, or topical administration. Typically, the administration route of the pharmaceutical composition of the present invention is preferably injection or oral administration. The injection administration preferably includes intravenous injection, intramuscular injection, intraperitoneal injection, intradermal injection, or subcutaneous injection. The pharmaceutical composition is in one of a variety of conventional dosage forms in the art, preferably in solid, semi-solid or liquid form, and can be an aqueous solution, a non-aqueous solution or a suspension, and more preferably tablets, capsules, granules, injection or infusion, etc.
[0347] The antibody of the present invention can also be used for cell therapy by expressing the nucleotide sequence in a cell, for example, the antibody is used for chimeric antigen receptor T cell immunotherapy (CAR-T) and the like.
[0348] The pharmaceutical composition of the present invention is a pharmaceutical composition for prevention and/or treatment of diseases associated with abnormal TIM-3 expression or function.
[0349] The pharmaceutical composition according to the present invention can be directly used for binding to a TIM-3 protein molecule, and thus can be used for preventing and treating diseases such as tumors.
[0350] The pharmaceutical composition according to the present invention comprises a safe and effective amount (e.g. 0.001-99 wt %, preferably 0.01-90 wt %, more preferably 0.1-80 wt %) of the monoclonal antibody according to the present invention (or a conjugate thereof) and a pharmaceutically acceptable carrier or excipient. Such carriers include, but are not limited to, saline, buffer solution, glucose, water, glycerin, ethanol or the combination thereof. The pharmaceutical preparation should be matched to the method of administration. The pharmaceutical composition of the present invention can be prepared in the form of injection, for example, prepared by a conventional method using physiological saline or an aqueous solution containing glucose and other adjuvants. Pharmaceutical compositions such as injections and solutions are preferably prepared under sterile conditions. The dosage of active ingredient is therapeutically effective amount, for example from about 1 microgram per kilogram body weight to about 5 milligrams per kilogram body weight per day. Further, the polypeptide of the present invention can also be used in combination with the other therapeutic agents.
[0351] In the present invention, preferably, the pharmaceutical composition of the present invention further comprises one or more pharmaceutical carriers. The pharmaceutical carrier is a conventional pharmaceutical carrier in the art, and the pharmaceutical carrier can be any suitable physiologically or pharmaceutically acceptable pharmaceutical excipient. The pharmaceutical excipient is a conventional pharmaceutical excipient in the art, and preferably includes pharmaceutically acceptable excipients, fillers or diluents. More preferably, the pharmaceutical composition comprises 0.01-99.99% of the above-mentioned protein and 0.01-99.99% of the pharmaceutically acceptable carrier, wherein the percentage is the mass percentage of the pharmaceutical composition.
[0352] In the present invention, preferably, the administration amount of the pharmaceutical composition is an effective amount, and the effective amount is an amount that can alleviate or delay the progression of the disease, and the degenerative or traumatic condition. The effective amount can be determined on an individual basis and will be partly based on consideration of the symptoms to be treated and the results sought. Those skilled in the art can determine the effective amount by using the above-mentioned factors such as individual basis and using no more than conventional experiments.
[0353] When a pharmaceutical composition is used, a safe and effective amount of the immunoconjugate is administered to a mammal, wherein the safe and effective amount is usually at least about 10 micrograms per kilogram of body weight, and in most cases does not exceed about 50 mg/kg body weight, preferably the dose is about 10 micrograms/kg body weight to about 20 mg/kg body weight. Of course, the particular dose should also depend on various factors, such as the route of administration, patient healthy status, which are well within the skills of an experienced physician.
[0354] The present invention provides use of the above-mentioned pharmaceutical composition in the preparation of a medicine for preventing and/or treating diseases associated with abnormal TIM-3 expression or function. Preferably, the diseases associated with abnormal TIM-3 expression or function are cancers and autoimmune diseases.
[0355] Method and Composition for Detecting TIM-3 Protein in Sample
[0356] The present invention also provides a method for detecting TIM-3 protein in a sample (for example, detecting cells over-expressing TIM-3), which comprises the following steps: contacting the above-mentioned antibody with a sample to be tested in vitro, and detecting whether the above-mentioned antibody binds to the sample to be tested, to form an antigen-antibody complex.
[0357] The meaning of overexpression is conventional in the art, which refers to the overexpression of RNA or protein of TIM-3 protein in the sample to be tested (due to increased transcription, post-transcriptional processing, translation, post-translational processing and protein degradation changes), and local overexpression and increased functional activity (such as in the case of increased enzymatic hydrolysis of the substrate) due to changes in protein transport mode (increased nuclear localization).
[0358] In the present invention, the detection method for detecting whether an antigen-antibody complex is formed is a conventional detection method in the art, preferably a flow cytometry (FACS) detection.
[0359] The present invention provides a composition for detecting TIM-3 protein in a sample, which comprises the above-mentioned antibody, recombinant protein, antibody conjugate, immune cell, or a combination thereof as an active ingredient. Preferably, it also comprises a compound composed of the functional fragments of the above-mentioned antibody as an active ingredient.
[0360] On the basis of conforming to common knowledge in the art, the above-mentioned preferred conditions can be combined arbitrarily to obtain preferred embodiments of the present invention.
[0361] The main advantages of the invention are: [0362] (1) The invention obtained fully human antibodies using rat-human chimeric antibody transgenic mice, and the obtained antibodies have a series of excellent characteristics: [0363] 1) the variable region sequences are different from the existing antibody (homology <92%); [0364] 2) the obtained antibodies have strong affinity; [0365] 3) the obtained antibodies have good activity of stimulating T cell activation;
[0366] (2) The transgenic mice used in the present invention can obtain fully human antibodies more easily than wild-type mice, therefore the immunogenicity of antibodies are reduced. And compared with transgenic mice of fully human antibodies, the number of antibodies obtained is larger, and the antibodies have strong affinity, good sequence diversity and high activity.
[0367] (3) Compared with antibodies obtained from phage library, the antibody of the present invention obtained by hybridoma technology has high affinity and good sequence expression.
[0368] (4) The invention has obtained antibodies with different sequences, which can specifically bind to TIM-3 with a binding activity lower than nanomolar. By reversing the inhibition of TIM-3 on the activation activity of T cells, T cells are activated to secrete IFN.
[0369] The invention is further illustrated by the following specific examples. It is to be understood that these examples are for illustrative purposes only and are not intended to limit the scope of the invention. The experimental methods without detailed conditions in the following examples are generally in accordance with the conditions described in the conventional conditions such as Sambrook. J et al. “Guide to Molecular Cloning Laboratory” (translated by Huang Peitang et al., Beijing: Science Press, 2002), or in accordance with the conditions recommended by the manufacturer (for example, product manuals). Percentages and parts are by weight unless otherwise stated. The experimental materials and reagents used in the following examples are commercially available unless otherwise specified.
[0370] The room temperature described in the examples is a conventional room temperature in the art, and is generally 10-30° C.
Example 1 Preparation of TIM-3 Specific Antibody
[0371] (1) Preparation of Immunogen
[0372] Immunogens including extracellular domain TIM-3 protein, TIM-3 recombinant cell line, expression plasmid of TIM-3 DNA vector and other immunogens are prepared.
[0373] Immunogen 1), the amino acid sequence 22-200 of the extracellular region of human TIM-3 protein (as shown in SEQ ID NO. 71 in the sequence listing) was cloned into the pCpC vector with human IgG Fc fragment (hFc) (purchased from Invitrogen, V044-50) and plasmids were prepared according to the established standard molecular biology methods. For specific methods, see Sambrook, J., Fritsch, E. F., and Maniatis T. (1989). Molecular Cloning: A Laboratory Manual, Second Edition (Plainview, N.Y.: Cold Spring Harbor Laboratory Press). HEK293 cells (purchased from Invitrogen) were transiently transfected (PEI, Polysciences) and expanded using FreeStyle™ 293 (Invitrogen) at 37° C. After 4 days, the cell culture was collected, and the cell components were removed by centrifugation to obtain the culture supernatant containing the extracellular region of TIM-3 protein. The culture supernatant was loaded onto a protein A affinity chromatography column (Mabselect Sure, purchased from GE Healthcare), and an ultraviolet (UV) detector was used to monitor the change in ultraviolet absorbance (A280 nm). After the sample was loaded, the protein affinity chromatography column was washed with PBS phosphate buffer (pH 7.2) until the UV absorption value returned to the baseline, and then eluted with 0.1M glycine hydrochloric acid (pH 2.5). The TIM-3 protein with hFc tag (CLTA-4-hFc) eluted from the protein affinity chromatography column was collected and dialyzed overnight with PBS phosphate buffer (pH 7.2) in a refrigerator at 4° C. The dialyzed protein was aseptically filtered by a 0.22 micron filter and stored at −80° C. after subpackage to obtain purified immunogen human TIM-3-hFc protein. The immunogen TIM-3-hFc protein needed a series of quality control tests before use, such as tests of protein concentration, purity, molecular weight and biological activity.
[0374] Among them, the binding activity of the immunogen TIM-3-hFc and the commercial anti-TIM-3 antibody is detected by ELISA, specifically:
[0375] The hFc-labeled TIM-3 protein (TIM-3-hFc, i.e., the immunogen) was diluted with PBS to 1 μg/mL, and added 100W/well to the ELISA microplate, and incubated overnight at 4° C. After blocked with ELISA blocking solution (containing 1% BSA, pH 7.4 PBS phosphate buffer solution, wherein the percentage is the mass percentage) at 37° C. for two hours, the plated was added with gradient dilution of commercially available anti-TIM-3 antibody, and incubated at 37° C. for 1 hour. The commercially available anti-TIM-3 antibody was purchased from the R&D system under trade number MAB2365. HRP (horseradish peroxidase) labeled secondary antibody was added, and after incubation at room temperature for 30 minutes, 100 microliters/well of TMB color development solution was added. After incubated at room temperature for 15 minutes, the plate was added with 50 microliters of IN hydrochloric acid to stop the color reaction, and read with an ELISA plate reader for the OD450 nm reading. The plate needed to be washed after each step. Wherein the negative control antibody was rat IgG, and the results are shown in
TABLE-US-00008 TABLE 1 Binding activity of TIM-3-hFc protein to its commercially available antibody Commercially Antibody available concentration anti-TIM-3 Coating antigen (nM) antibody Rat IgG hTIM-3-hFC 66.7 3.48 3.44 0.72 0.70 1 μg/ml 13.34 3.45 3.42 0.63 0.63 2.67 3.32 3.42 0.69 0.58 0.53 3.52 3.38 0.63 0.65 0.11 3.23 3.27 0.60 0.59 0.021 1.78 1.75 0.55 0.58 0.0043 0.92 0.86 0.63 0.59 0 0.60 0.59 0.61 0.59
[0376] The results shows that the binding of TIM-3 to commercially available antibody against TIM-3 protein at protein level changed with the concentration of antibody.
[0377] Immunogen 2), the human TIM-3 full-length amino acid sequence was cloned into pIRES vector (purchased from Clontech) and the plasmid was prepared. After plasmid transfection on HEK293 cell line and CHOK1 cell line (both purchased from Invitrogen) (transfection was preformed using X-treme GENE HP DNA Transfection Reagent, which was purchased from Roche, Cat #06 366 236 001, and operated according to the instructions), cells were selectively cultured in DMEM medium containing 10% (w/w) FBS and containing 0.5 μg/ml puromycin for 2 weeks. Subcloning was conducted in 96-well culture plate by a limiting dilution method, and the plate was placed at 37° C., 5% (v/v) CO.sub.2. After about 2 weeks, some of the monoclonal wells were selected and amplified into 6-well plates. The amplified clones were stained with known TIM-3 antibodies and screened by flow cytometry. The monoclonal cell line with better growth and higher fluorescence intensity were continued to be expanded in culture and cryopreserved in liquid nitrogen, to obtain the immunogen TIM-3 recombinant cell line. The specific selection results are shown in Table 2 and
TABLE-US-00009 TABLE 2 The FACS screening detection results of HEK293 cells transfected with TIM-3 gene IgG control Anti-TIM-3 mAb Recombinant Gated Gated Number cell clone ID (%) MFI (%) MFI 1 1B6 0.88 26 95.46 11684 2 1A5 0.79 22 94.57 12657 3 3C3 0.89 22 98.02 15499 4 3D2 0.95 22 99.01 13486 5 4C5 0.85 24 99.42 11235
[0378] Immunogen 3), TIM-3 full-length amino acid sequence cDNA was cloned into a pCDNA3.1 vector and coated on a 1.0 um gold colloidal bullet, and immunized with Helios gene gun (Bio-rad). The detailed method was developed according to the instructions of Helios gene gun.
[0379] (II) Preparation of Hybridoma Cells and Screening of Antibody
[0380] Harbour transgenic mice are introduced with human immunoglobulin variable region genes and rat immunoglobulin constant region genes, while the Ig expression of the mice own is silenced (F. G. Franklin, et al, patent #WO 2010/070263 A1). The transgenic mice can produce immune response and antibody titer equivalent to that produced by normal mice (such as Balb/c) after being immunized with antigen.
[0381] A. 6-8 weeks old Harbour human antibody transgenic mice (purchased from Beijing Weitong Lihua Company) were used for immunization by immunogen 1), and the mice were raised under SPF conditions. At the initial immunization, the immunogen TIM-3-hFc protein was emulsified with Freund's complete adjuvant and then injected intraperitoneally with 0.25 ml, that is, 100 micrograms of immunogen protein was injected into each mouse. During the booster immunization, immunogen protein was emulsified with Freund's incomplete adjuvant and then injected intraperitoneally with 0.25 ml, that is, 50 micrograms of immunogen protein was injected into each mouse. The interval between the initial immunization and the first boosting immunization was 2 weeks. After that, the intervals between each boosting immunization were 3 weeks. Blood was collected 1 week after each boosting immunization, and the antibody titer and specificity of immunogen protein in the serum were detected by ELISA and FACS. The results are shown in
TABLE-US-00010 TABLE 3 Detection of serum antibody titer in mice after TIM-3-hFC protein immunization by ELISA OD.sub.450 nm Serum dilution Batch 1:100 1:10.sup.3 1:10.sup.4 1:10.sup.5 1:10.sup.6 1:10.sup.7 Blank control 146 (TB2) 2.79 2.75 1.69 0.84 0.6 0.55 0.6 147 (TB2) 2.86 2.75 1.3 0.8 0.58 0.61 0.6 148 (TB2) 2.9 2.82 1.14 0.88 0.83 0.69 0.59 149 (TB2) 2.93 2.61 1.18 0.71 0.85 0.64 0.61 150 (TB2) 2.9 2.66 1.54 0.71 0.58 0.59 0.6
[0382] Table 3 shows that the serum of mice immunized with TIM-3-hFc had different degrees of binding to the immunogen, showing antigen-antibody reaction, with the highest dilution being about 10,000. Wherein, the blank control was 1% (w/w) BSA, and the batch referred to the mice serum on the seventh day after the second boosting immunization. The data in the table is the value of OD.sub.450nm.
[0383] B. 6-8 weeks old Harbour human antibody transgenic mice (purchased from Beijing Weitong Lihua Company) were used for immunization by immunogen 2), and the mice were raised under SPF conditions. The obtained HEK293-h TIM-3 stable cell line containing human TIM-3 was expanded to a confluence of 90% in a T-75 cell culture flask, and the medium was aspirated. Cells were washed with DMEM basal medium (purchased from Invitrogen) twice, and then treated with enzyme-free cell dissociation solution (purchased from Invitrogen) at 37° C. until the cells were detached from the wall of the culture dish, and then the cells were collected. Cells were washed twice with DMEM basal medium and counted, and then diluted with phosphate buffer (pH 7.2) to 2×10.sup.7 cells per ml. Each mouse was intraperitoneally injected with 0.5 ml of cell suspension during each immunization. The interval between the first and the second immunization was 2 weeks. After that, the intervals between each subsequent immunization were 3 weeks. Except for the initial immunization, blood was collected one week after each immunization, and the antibody titer and specificity in the serum were detected by ELISA.
[0384] C. 6-8 weeks old Harbour human antibody transgenic mice (purchased from Beijing Weitong Lihua Company) were used for immunization by immunogen 3), and the mice were raised under SPF conditions. All mice were immunized with the gene gun through the abdomen for 3-4 times, 3-4 shots each time, 1.0 μg cDNA amount per shot. The interval between the first immunization and the first booster immunization was 2 weeks. After that, the intervals between each subsequent immunization were 3 weeks. Blood was collected 7 days after each boost, and the antibody titer in the serum was detected by ELISA.
[0385] Usually, the ELISA titer of most mice can reach more than 1: 1000 after 2-3 times of immunizations. Table 3 and
[0386] The results show that: after 3 times of immunization with the immunogen, most mice had an ELISA titer of more than 1:100, indicating that mice had a better humoral immune response to the immunogen, and their spleen cells can be used for Hybridoma cell preparation.
[0387] Mice whose titers meet the requirements can be selected for cell fusion and hybridoma preparation. Before cell fusion, each mouse was injected intraperitoneally with 50-100 micrograms of purified TIM-3-hFc, for the last immunization. After 3-5 days, the mice were sacrificed and splenocytes were collected. Cells were washed 3 times by centrifugation at 1000 revolutions per minute in DMEM basal medium, and then mixed with mouse myeloma cells SP2/0 (purchased from ATCC) at a ratio of 5:1 according to the number of viable cells. High-efficiency electrofusion or PEG method (see METHODS IN ENZYMOLOGY, VOL. 220) was used for cell fusion. The fused cells were diluted into DMEM medium containing 20% fetal bovine serum and 1×HAT, wherein the percentage was the mass percentage. Then the cell solution was added as 1×10.sup.5/200 microliters per well to a 96-well cell culture plate, and put in a 5% CO.sub.2, 37° C. incubator, wherein the percentage was the volume percentage. After 14 days, ELISA and Acumen (microwell plate cell detection method) were used to screen the supernatants in cell fusion plate. The positive clones with OD.sub.450nm>1.0 in ELISA and MFI value >100 in Acumen were expanded to a 24-well plate, in the medium of DMEM (Invitrogen) containing 10% (w/w) of fetal bovine serum, and cultured at 37° C. and 5% (v/v) CO.sub.2. After 3 days of culture, the culture solution expanded in the 24-well plate was centrifuged. The supernatant was collected, and the supernatant was analyzed for antibody subtypes. The binding activity of the antibody to TIM-3 protein and TIM-3 positive cells was determined by ELISA and FACS.
[0388] According to the results of 24-well plate screening, hybridoma cells with OD.sub.450nm>1.0 in the ELISA experiment and MFI value>50 in the FACS experiment were selected as qualified positive clones. The qualified hybridoma cells were selected to subclone in a 96-well plate by limiting dilution method, and cultured in a DMEM medium (purchased from Invitrogen) containing 10% (w/w) FBS, at 37° C., 5% (v/v) CO.sub.2. 10 days after subcloning, ELISA and Acumen were used for preliminary screening, and positive monoclones were selected and amplified to a 24-well plate to continue culture. After 3 days, the positive antigen binding was determined by FACS to evaluate the biological activity (the evaluation standard was OD.sub.450nm>1.0 in ELISA experiment, MFI value >100 in FACS experiment).
[0389] According to the test results of the 24-well plate samples, the positive clones were expanded in DMEM (purchased from Invitrogen) medium containing 10% (w/w) FBS at 37° C. and 5% (v/v) CO.sub.2. The cells were suspended in freezing solution [DMEM containing 20% (w/w) FBS and 10% (w/w) DMSO], and cryopreserved in liquid nitrogen according to conventional methods, to obtain hybridoma cells of the present invention, which can be used for subsequent antibody production, purification and amino acid sequence determination.
Example 2 Identification of Chimeric Antibody
[0390] (I) Enzyme-Linked Immunosorbent Assay (ELISA) Detection of the Binding of Antibodies to TIM-3 Protein
[0391] The amino acid sequence 22-200 of the extracellular domain of the human TIM-3 protein described in the step of Example 1 (as shown in SEQ ID NO. 71 in the sequence listing) was cloned into a pCpC vector having a human IgG Fc fragment (hFc), and transfected into HEK293 cells. The cell culture medium was collected, and purified to obtain the human TIM-3 protein with hFc tag (herein referred to as hTIM-3-hFc protein). The amino acid sequence 22-201 of the extracellular domain of the monkey TIM-3 protein (as shown in SEQ ID NO. 72 in the sequence listing) was cloned into a pCpC vector having a human IgG Fc fragment (hFc), and transfected into HEK293 cells. The cell culture medium was collected, and purified to obtain the monkey TIM-3 protein with hFc tag (herein referred to as cTIM-3-hFc protein). The amino acid sequence 22-191 of the extracellular domain of murine TIM-3 protein (as shown in SEQ ID NO. 73 in the sequence listing) was cloned into a pCpC vector having a human IgG Fc fragment (hFc), and transfected into HEK293 cells. The cell culture medium was collected, and purified to obtain the murine TIM-3 protein with hFc tag (herein referred to as mTIM-3-hFc protein). Purified human, monkey, and mouse TIM-3 extracellular domain proteins (hTIM-3-hFc, cTIM-3-hFc, and mTIM-3-hFc) were diluted with PBS to a final concentration of 1.0 μg/ml and then added to a 96-well ELISA plate with 100 μl per well. The plate was sealed with plastic film and incubated overnight at 4° C. The plate was washed 4 times with the plate washing solution (PBS+0.01% Tween20) on the next day, and added with the blocking solution (PBS+0.01% Tween20+1% BSA) and sealed at room temperature for 1-2 hours. The blocking solution was poured out. 50-100 μl of the antibody sample to be tested was added to each well. The plate was incubated at 37° C. for 1-2 hours, and washed 2-3 times with plate washing solution (PBS+0. 01% Tween20). HRP (horseradish peroxidase) labeled secondary antibody was added. The plate was incubated at 37° C. for 1-2 hours, and washed 2-3 times with plate washing solution (PBS+0. 01% Tween20). 1000 of TMB substrate was added to each well. After incubated at room temperature for 15-30 minutes, the plate was added with 1000 of stop solution (1.0N HCl) to each well. An ELISA plate reader (TiterMax 384plus, Molecular Device) was used to read the A450 nm value. The results are shown in
TABLE-US-00011 TABLE 4 Activity of TIM-3 antibodies reacting with human TIM-3 extracellular domain protein in the enzyme-linked immunosorbent assay. OD450 Antibody concentration (nM) Clone ID 66.667 6.6667 0.6667 0.0667 0.0067 0.0007 0.0001 0 7A4F10 3.08 2.92 0.86 0.21 0.13 0.12 0.12 0.11 18D2H2 2.93 2.86 1.33 0.35 0.16 0.12 0.12 0.11 34B6D8 3.42 3.40 3.41 1.62 0.33 0.15 0.12 0.12 39E5H1 3.39 3.34 3.41 1.78 0.42 0.16 0.13 0.12 57F4E5 3.26 3.29 3.31 2.83 0.63 0.19 0.13 0.12 134H3G6 3.15 2.57 0.69 0.20 0.13 0.13 0.12 0.12 215A8F2 3.17 3.15 3.06 1.00 0.28 0.14 0.12 0.11 Mouse IgG control 0.22 0.13 0.13 0.12 0.12 0.12 0.11 0.11
TABLE-US-00012 TABLE 5 Activity of TIM-3 antibodies reacting with monkey TIM-3 extracellular domain protein in the enzyme-linked immunosorbent assay. OD450 Antibody concentration (nM) Clone ID 66.667 6.6667 0.6667 0.0667 0.0067 0.0007 0.0001 0 7A4F10 3.46 3.12 1.35 0.70 0.57 0.55 0.54 0.54 18D2H2 3.44 3.34 1.89 0.74 0.62 0.54 0.53 0.55 34B6D8 3.52 3.55 3.44 1.92 0.78 0.61 0.57 0.58 39E5H1 3.47 3.50 3.41 1.98 0.85 0.61 0.57 0.59 57F4E5 3.47 3.48 3.45 2.68 1.13 0.64 0.58 0.56 134H3G6 3.43 3.02 1.22 0.64 0.56 0.55 0.54 0.55 215A8F2 3.49 3.45 3.26 1.50 0.70 0.55 0.52 0.57 Mouse IgG control 0.68 0.58 0.55 0.54 0.57 0.55 0.54 0.55
TABLE-US-00013 TABLE 6 Activity of TIM-3 antibodies reacting with mouse TIM-3 extracellular domain protein in the enzyme-linked immunosorbent assay. OD450 Antibody concentration (nM) Clone ID 66.667 6.6667 0.6667 0.0667 0.0067 0.0007 0.0001 0 7A4F10 0.66 0.67 0.67 0.62 0.64 0.64 0.65 0.63 18D2H2 0.85 0.69 0.66 0.67 0.63 0.64 0.64 0.62 34B6D8 1.10 0.74 0.65 0.68 0.65 0.65 0.62 0.66 39E5H1 0.90 0.68 0.66 0.68 0.64 0.63 0.64 0.62 57F4E5 0.74 0.69 0.64 0.64 0.68 0.67 0.63 0.64 134H3G6 0.70 0.67 0.66 0.65 0.64 0.62 0.64 0.64 215A8F2 0.77 0.68 0.65 0.67 0.64 0.67 0.63 0.63 Mouse IgG control 0.75 0.65 0.66 0.64 0.62 0.67 0.63 0.60
[0392] (II) Detection of the Binding of Antibodies to TIM-3 Expressing Cells by Flow Cytometry (FACS)
[0393] The pIRES plasmid containing the full-length nucleotide sequence encoding human TIM-3 as described in Example 1 was transfected into CHOK1 cell line to obtain a CHOK1 stable cell line containing human TIM-3 (herein referred to as CHOK1-hTIM-3 stable cell line). The pIRES plasmid containing the full-length gene of monkey TIM-3 was transfected into CHOK1 cell line to construct a CHOK1 stable cell line containing monkey TIM-3 (herein referred to as CHOK1-cTIM-3 stable cell line). The CHOK1-hTIM-3 stable cell line and CHOK1-cTIM-3 stable cell line were expanded to a confluence of 90% in a T-75 cell culture flask. The medium was aspirated, and the cells were washed with HBSS (Hanks' Balanced Salt Solution) 1-2 times, and then treated with an enzyme-free cell dissociation solution (Versene solution: Life technology) and the cells were collected. The cells were washed with HBSS buffer for 1-2 times. After counted, the cells were diluted with HBSS to 1-2×10.sup.6 cells per ml, added with 1% goat serum blocking solution, incubated on ice for 20-30 minutes, and then washed with HBSS by centrifugation 2 times. The collected cells were suspended in the FACS buffer (HBSS+1% BSA) to 2×10.sup.6 cells/ml, added as 100 microliters per well to a 96-well FACS reaction plate, added with 100 microliters per well of the antibody sample to be tested, incubated on ice for 1-2 hours. The plate was washed twice with the FACS buffer by centrifugation, added with 100 microliters of fluorescent (Alexa 488)-labeled secondary antibodies per well, and incubated on ice for 0.5-1.0 hours. The plate was washed 2-3 times with FACS buffer by centrifugation, added with 100 μl fixative solution (4% Paraformaldehyde) per well to suspend the cells. 5-10 minutes later, it was washed 1-2 times with FACS buffer by centrifugation. The cells were suspended with 100 microliters of FACS buffer, FACS (FACSCalibur, BD) was used for detection and the results were analyzed. The results are shown in
TABLE-US-00014 TABLE 7 Binding reaction of TIM-3 antibody to CHOK1-hTIM-3 detected by FACS Mean fluorescence intensity Antibody concentration (nM) Clone ID 200 40 8 1.6 0.32 0.064 0.013 0 7A4F10 145.2 144.2 56.2 15.4 6.8 4.3 3.3 2.9 18D2H2 211.9 185.4 106.9 40.2 15.6 6.6 4.2 2.9 57F4E5 484.9 484.6 478.4 389.5 176.7 58.1 21.2 2.9 134H3G6 261.3 229.6 139.0 50.0 17.7 8.2 4.7 3.0 215A8F2 612.6 610.3 607.5 213.5 55.6 18.7 8.6 3.0 rIgG control 3.8 3.3 3.1 3.0 3.0 3.0 3.0 3.0
TABLE-US-00015 TABLE 8 Binding reaction of TIM-3 antibody to CHOK1-cTIM-3 detected by FACS Mean fluorescence intensity Antibody concentration (nM) Clone ID 200 40 8 1.6 0.32 0.064 0.013 0 7A4F10 146.7 163.3 90.0 29.1 11.3 5.9 4.1 3.2 18D2H2 203.2 186.2 92.2 35.8 14.4 6.9 4.3 3.2 57F4E5 675.2 698.6 704.0 460.5 184.8 59.6 22.2 3.2 134H3G6 283.4 332.1 194.9 83.5 28.8 11.6 6.2 3.2 215A8F2 961.1 975.6 732.6 330.3 107.5 34.7 13.6 3.2 rIgG control 4.8 3.7 3.8 3.6 3.5 3.4 3.3 3.2
[0394] (III) Detection of the Effect of TIM-3 Antibody on Lymphocyte Activity by Lymphocyte Stimulation Test
[0395] In the lymphocyte stimulation test, TIM-3 antibodies block the binding of TIM-3 protein and its receptor to relieve the inhibition of T lymphocyte activity, thereby stimulating the proliferation of T cells.
[0396] 1. Isolation of Peripheral Blood Monocytes Lymphocyte PBMCs from the Whole Blood Using Ficoll
[0397] The freshly obtained whole blood was diluted with phosphate buffer PBS at a volume ratio of 1:1, to obtain diluted whole blood. A sterile pipette was used to gently spread the diluted whole blood on the surface of Ficoll (purchased from GE Healthcare). The volume ratio of Ficoll to diluted whole blood was 3:4. The solution was mixed without shaking, gradient centrifuged at 400 g at room temperature 20° C. for 30 minutes. The solution in the centrifuge tube after centrifugation was divided into three layers, wherein the upper layer was plasma and the middle layer was milky white, which was mononuclear lymphocytes. A sterile pipette was used to gently aspirate the middle layer cells, collected in a new centrifuge tube, diluted to three times of volume with PBS phosphate buffer, and centrifuged at 100 g at room temperature for 10 minutes, then the suprenatant was discarded. The lymphocytes were resuspended to 10 mL in PBS phosphate buffer, and the previous steps were repeated to remove the platelets. Finally, the lymphocytes were resuspended in 10 mL of multi-component RPMI1640 medium (purchased from Invitrogen) containing 10% fetal bovine serum for use, namely peripheral blood mononuclear lymphocytes PBMCs, and the percentages were mass percentages.
[0398] 2. Pre-Stimulation of PBMC Cells Mediated by OKT3
[0399] Commercial OKT3 antibody (eBioscience Cat #16-0037-81) was diluted with PBS to a final concentration of 1.0 μg/ml and then added to a 6-well cell culture plate at 2 ml per well. The plate was sealed with plastic film, incubated overnight at 4° C., and washed with PBS three times the next day. The isolated PBMC cells were inoculated into the 6-well plate, and cultured in an incubator at 37° C., 5% CO.sub.2 for 72 hours.
[0400] 3. CHOK1-OS8 Cells Treated with Mitomycin
[0401] The single chain variable fragment (scFv) of anti-human CD3 monoclonal antibody OKT3 was fused to the C-terminal domain (113-220) of mouse CD8a to construct a T cell conjugate, i.e. a membrane dislocation chimeric antibody (OS8). The C-terminal domain of the mouse CD8a includes a hinge, a transmembrane and cytoplasmic domain, so that the anti-CD3 scFv fragment can be dislocated to the cell surface as a T cell activator. The plasmid expressing the recombinant fusion protein OS8 was transfected into a CHOK1 cell line to obtain a CHOK1 stable cell line expressing OS8 (a T cell activating molecule) on the cell surface (hereinafter referred to as a CHOK1-OS8 stable cell line). Before use, CHOK1-OS8 cells were treated with 10 μg/mL mitomycin at 37° C. for 2 hours, and washed three times with PBS to remove residual mitomycin.
[0402] 2. Stimulation Test of PBMC Mediated by CHOK1-OS8
[0403] Before the test, the TIM-3 antibody to be tested diluted in equal volume ratio was prepared to obtain a sample solution to be tested.
[0404] The pre-stimulated peripheral blood mononuclear lymphocytes PBMCs were plated with 1×10.sup.5 cells, 100 microliters per well, on a 96-well cell culture plate, and then the test sample solution was added to the culture plate and incubated at room temperature for 30 minutes. Finally, CHOK1-OS8 cells were added at 2.5×10.sup.4 cells of 50 μl per well to a 96-well cell culture plate, ensuring a volume of 200 μl per reaction well. The reaction plate was placed in a 37° C., 5% CO.sub.2 incubator. After 20 hours of culture, the supernatant was collected to obtain cell supernatant, and cryopreserved at −20° C. The percentage was volume percentage.
[0405] 5. Detection of Cytokine Interleukin IFN in Cell Supernatant
[0406] The enzyme-linked immunosorbent assay (ELISA) of the cytokine interferon IFN-γ in cell supernatant was preformed using the R&D system related detection kit human IFN-γ DuoSet ELISA (DY285), and operated in accordance with the instructions. All test reagents except the tested antibodies were provided by the test kit.
[0407] The detection of enzyme-linked immunosorbent assay (ELISA) of the content of cytokine IFN-γ in cell supernatant was preformed using double antibody sandwich ELISA kit (purchased from R&D Systems, IFN-γ Cat #DY285). The experimental operation was strictly in accordance with the requirements of the kit instructions, and all test reagents were provided by the kit. The specific experiment was briefly described as follows. The IFN-γ polyclonal antibody was coated on the ELISA microwell plate, sealed with plastic film and incubated overnight at 4° C. The plate was washed 4 times with the plate washing solution on the next day, and added with the blocking solution and blocked at room temperature for 1-2 hours. The plate was washed 4 times with the plate washing solution. The cell supernatant obtained in step 4 was used as the test sample. The standard and the test sample were incubated at room temperature for 2 hours. 400 microliters of washing solution was added to each well, the plate washing was repeated 4 times. Then horseradish peroxidase-labeled antibody against human IFN-γ was added, and incubated for 2 hours at room temperature to form an immune complex with the IFN-γ on the microplate and the microwells were washed. The substrate was added for color development, protected from light at room temperature for 30 minutes. Finally the stop solution was added, and the absorbance at A450 nm was measured with a microplate reader.
[0408] The effect of TIM-3 antibody on IFN-γ secretion in the PBMC stimulation experiment was detected. The results are shown in
TABLE-US-00016 Table 9 Effect of TIM-3 antibody on IFN-γ secretion in OKT3-dependent PBMC activation experiment IFN production, pμg/ml 10 μg/ml 1 μg/ml 0.1 μg/ml 0.001 μg/ml 0.001 μg/ml Clone ID N = 1 N = 2 N = 1 N = 2 N = 1 N = 2 N = 1 N = 2 N = 1 N = 2 7A4F10 847.5 1010.7 1010.4 1157.0 757.7 873.4 672.1 718.6 666.3 756.4 134H3G6 1073.2 1231.3 1266.0 1132.9 1204.6 1133.9 862.3 932.3 809.7 792.8 215A8F2 943.0 1065.3 1019.3 1072.1 840.1 901.0 781.6 752.7 790.8 740.9 rIgG control 619.6 582.5 693.5 573.8 717.5 663.7 737.7 786.3 727.4 714.3
[0409] The results show that the antibodies to be tested can enhance IFN-γ secretion of PBMC in the PBMC lymphocyte stimulation experiment.
Example 3 Determination of Amino Acid Sequences of Light and Heavy Chain Variable Regions
[0410] Isolation of total RNA: After the supernatant obtained from the subclonal culture of Example 1 was tested for antigen binding (that is, after the verification and activity determination in Example 2), 5×10.sup.7 hybridoma cells were collected by centrifugation, added with 1 mL Trizol and mixed well and transferred to a 1.5 mL centrifuge tube, and allowed to stand at room temperature for 5 minutes. The tube was added with 0.2 mL chloroform, shaked for 15 seconds, let stand for 2 minutes, and centrifuged at 12000 g at 4° C. for 5 minutes. The supernatant was taken and transferred to a new 1.5 mL centrifuge tube. 0.5 mL of isopropanol was added, and the liquid in the tube was gently mixed, and let stand at room temperature for 10 minutes. After centrifuge at 12000 g for 15 minutes at 4° C., the supernatant was discarded. 1 mL of 75% ethanol (the percentage was volume percentage) was added, and the precipitate was gently washed, centrifuged at 12000 g at 4° C. for 5 minutes. The supernatant was discarded, and the precipitate was dried, and added with DEPC-treated H.sub.2O for dissolution (55° C. water bath to promote dissolution for 10 minutes). The total RNA was obtained.
[0411] Reverse transcription and PCR: 1 μg of total RNA was taken, and a 20 ul system was configured, added with reverse transcriptase and reacted at 42° C. for 60 minutes, and the reaction was terminated at 7° C. for 10 minutes. 50 μl PCR system was configured, comprising 1 μl cDNA, 25 pmol of each primer, 1 μl DNA polymerase and a matching buffer system, 250 μmol dNTPs. PCR program was set, comprising pre-denaturation 95° C. 3 min, denaturation 95° C. 30s, annealing 55° C. 30s, extension 72° C. 35s, and extension at 72° C. for 5 min after 35 cycles. And the PCR product was obtained. The kit used for reverse transcription was PrimeScript RT Master Mix, purchased from Takara, and the catalog number was RR036; the kit used for PCR was Q5 ultra-fidelity enzyme, purchased from NEB, and the catalog number was M0492.
[0412] Cloning and sequencing: 5 μl of PCR product was taken for agarose gel electrophoresis detection, and the column recovery kit was used to purify the positive samples. Wherein, the recovery kit was NucleoSpin® Gel & PCR Clean-up, purchased from MACHEREY-NAGEL, and the catalog number was 740609. Ligation reaction was performed in a 10 μl of reaction system containing sample 50 ng, T vector 50 ng, ligase 0.5 μl and buffer 1 μl and reacted for half an hour at 16° C. to obtain the ligation product. Wherein, the ligation kit was T4 DNA ligase, purchased from NEB, and the catalog number was M0402. 5 μl of ligation product was taken and added into 100 μl of competent cells (Ecos 101competent cells, purchased from Yeastern, catalog number FYE607) in ice bath for 5 minutes. Then heat shock was carried out in a 42° C. water bath for 1 minute, and put back on ice for 1 minute, added with 650 μl of antibiotic-free SOC medium, resuscitated on a 37° C. shaker at 200 RPM for 30 minutes. 200 μl of the culture was taken and spreaded on LB solid medium containing antibiotics and incubated overnight at 37° C. in an incubator. The next day, the primers M13F and M13R on the T vector were used to configure a 30 μl PCR system to perform colony PCR. A pipette tip was used to dip the colony into the PCR reaction system and pipette, and 0.5 μl was aspirated onto another piece of 100 nM ampicillin LB solid petri dish to save the strain. After the PCR reaction, 5 μl was taken out for agarose gel electrophoresis detection, and the positive samples were sequenced. Wherein, the steps of sequencing can be found in Kabat, Sequences of Proteins of Immunological Interest, National Institutes of Health, Bethesda, Md. (1991).
[0413] The sequencing results are shown in the sequence information of the present invention in the appendix, and the sequence information of the heavy chain CDR1-3 and light chain CDR1-3 of 7 clones is shown in Table 18.
Example 4 Transformation and Preparation of Fully Human Antibody IgG
[0414] (I) Plasmid construction and preparation: purified TIM-3 antibody from the culture supernatant of hybridoma cells had been obtained in Example 2, and according to the sequencing results of Example 3, the sequences of heavy chain variable region and light chain variable region of TIM-3 antibody was clear. The heavy chain variable region sequence of the TIM-3 antibody was recombined into an expression vector containing the signal peptide and the human heavy chain antibody IgG4 constant region (the expression vector was purchased from Invitrogen), and the light chain variable region sequence of the TIM-3 antibody was recombined into an expression vector containing the signal peptide and the human antibody light chain kappa constant region. The recombinant plasmid was obtained and verified by sequencing (the sequencing method was the same as that in Example 3). Plasmids with a mass of more than 500n were extracted using alkaline lysis kit (purchased from MACHEREY-NAGEL) to increase the purity, filtered through a 0.22 μm filter membrane (purchased from Millopore) for transfection.
[0415] (2) Cell Transfection:
[0416] (II) Cell transfection: 293E cells (purchased from Invitrogen) were cultured in Freestyle 293 expression medium (purchased from Invitrogen). The shaker was set to 37° C., 130 RPM, and 8% CO.sub.2 (v/v) concentration.
[0417] During transfection, Freestyle 293 expression medium was added with 10% (v/v) F68 (purchased from Invitrogen) to a final concentration of 0.1% (v/v), to obtain Freestyle 293 expression culture containing 0.1% (v/v) F68, that is, medium A.
[0418] 5 mL of medium A was taken and mixed well with 200 μg/mL PEI (purchased from Sigma), to obtain medium B. 5 mL of medium A was taken and mixed well with 100 μg/mL of the recombinant plasmid obtained in step (I) to obtain medium C. 5 minutes later, medium B and medium C were combined and mixed, and the mixture was let stand for 15 minutes to obtain a mixture D. 10 mL of mixture D was slowly added into 100 mL of Freestyle 293 expression medium containing 293E cells, until the cell density of 293E was 1.5×10.sup.6/mL, and it was shaked while being added, to avoid excessive aggregation of PEI. And the mixture was placed in a shaker for culture. Peptone was added the next day to a final concentration of 0.5% (w/v). On days 5-7, the antibody titer of the culture medium was measured. On days 6-7, the supernatant was collected by centrifugation (3500 RPM, 30 minutes) and filtered through a 0.22 μm filter to obtain the filtered cell supernatant for purification.
[0419] (III) Antibody purification: For continuously used endotoxin-free chromatography columns and Protein A stuffing (purchased from GE), 0.1M NaOH was used for washing for 30 minutes, or 5 column volumes of 0.5M NaOH was used for washing. For long-term unused column materials and chromatography columns, at least 1M NaOH was used for soaking for 1 hour, and non-endotoxic water was used for rinsing to neutrality, and the column material was washed with 10 column volume of 1% (v/v) Tritonx100. 5 column volumes of PBS (PBS phosphate buffer, pH 7.2) was used for equilibrate. The filtered cell supernatant obtained in step (II) was loaded on the column, and the flow-through liquid was collected if necessary. After the samples were loaded, the column was washed with 5 column volume of PBS. Elution was performed with 5 column volumes of 0.1M pH3.0 Glycine-HCl, and the eluate was collected, and neutralized with 0.5 column volume of 1M Tris-HCl (1.5M NaCl) with pH 8.5. And fully human TIM-3 antibody was obtained. All the above-mentioned solutions required a fresh configuration. The fully human TIM-3 antibodies were harvested, and then dialyzed for 4 hours in 1×PBS to avoid endotoxin contamination. After dialysis, spectrophotometry or a kit was used to determine the concentration, and HPLC-SEC was used to determine the purity of the antibody, and an endotoxin detection kit (purchased from Lonza) was used to detect the content of antibody endotoxin.
Example 5 Identification of Fully Human TIM-3 Antibody
[0420] (I) Enzyme-Linked Immunosorbent Assay (ELISA) Detection of the Binding of Antibodies to TIM-3 Protein
[0421] The results are shown in
TABLE-US-00017 TABLE 10 Activity of fully human TIM-3 antibodies reacting with human TIM-3 extracellular domain protein in the enzyme-linked immunosorbent assay. OD450 Antibody concentration (nM) Clone ID 66.667 6.6667 0.6667 0.0667 0.0067 0.0007 0.0001 0 7A4F10 3.02 3.01 2.75 1.69 0.32 0.11 0.08 0.08 18D2H2 2.78 2.61 2.58 1.57 0.32 0.11 0.08 0.07 34B6D8 3.10 2.99 3.11 1.58 0.29 0.11 0.09 0.09 39E5H1 3.01 2.95 3.01 1.33 0.25 0.10 0.08 0.08 57F4E5 3.06 2.91 2.89 1.22 0.23 0.11 0.08 0.08 134H3G6 2.77 2.81 2.74 1.28 0.27 0.10 0.10 0.08 215A8F2 3.08 2.86 2.88 1.29 0.27 0.10 0.08 0.08 hIgG control 0.14 0.08 0.07 0.07 0.07 0.07 0.07 0.07
TABLE-US-00018 TABLE 11 Activity of fully human TIM-3 antibodies reacting with monkey TIM-3 extracellular domain protein in the enzyme-linked immunosorbent assay. OD450 Antibody concentration (nM) Clone ID 66.667 6.6667 0.6667 0.0667 0.0067 0.0007 0.0001 0 7A4F10 3.26 3.12 2.46 0.68 0.18 0.14 0.13 0.13 18D2H2 3.27 3.30 3.16 1.56 0.33 0.15 0.14 0.13 34B6D8 3.39 3.39 3.37 1.71 0.37 0.19 0.17 0.17 39E5H1 3.38 3.35 3.23 1.37 0.30 0.18 0.17 0.16 57F4E5 3.42 3.29 3.15 1.34 0.32 0.18 0.17 0.16 134H3G6 3.11 3.19 3.10 1.30 0.30 0.15 0.14 0.13 215A8F2 3.24 3.28 3.05 1.37 0.33 0.15 0.13 0.13 hIgG control 0.43 0.18 0.15 0.13 0.13 0.14 0.13 0.13
TABLE-US-00019 TABLE 12 Activity of fully human TIM-3 antibodies reacting with mouse TIM-3 extracellular domain protein in the enzyme-linked immunosorbent assay. OD450 Antibody concentration (nM) Clone ID 66.667 6.6667 0.6667 0.0667 0.0067 0.0007 0.0001 0 7A4F10 0.99 0.36 0.25 0.22 0.23 0.22 0.22 0.23 18D2H2 0.81 0.31 0.22 0.22 0.22 0.21 0.21 0.22 34B6D8 1.38 0.44 0.27 0.25 0.24 0.24 0.23 0.24 39E5H1 1.28 0.41 0.26 0.24 0.23 0.23 0.23 0.24 57F4E5 1.55 0.54 0.28 0.33 0.23 0.23 0.24 0.24 134H3G6 0.94 0.36 0.23 0.21 0.22 0.21 0.22 0.22 215A8F2 1.08 0.38 0.24 0.31 0.22 0.21 0.21 0.21 hIgG control 0.73 0.30 0.22 0.21 0.21 0.21 0.22 0.23
[0422] The results show that the fully human TIM-3 antibody can bind to the extracellular domain protein of human and monkey TIM-3, but cannot bind to mouse TIM-3 protein. The activity of each antibody is equivalent, which indicates that the antibody has strong binding ability with TIM-3.
[0423] (II) Detection of the Binding of Antibodies to TIM-3 Expressing Cells by Flow Cytometry (FACS)
[0424] The results are shown in
TABLE-US-00020 TABLE 13 Binding reaction of fully human TIM-3 antibody to CHOK1-hTIM-3 detected by FACS Mean fluorescence intensity Antibody concentration (nM) Clone ID 40 8 1.6 0.32 0.064 0.013 0 7A4F10 312.8 307.6 282.3 90.1 28.8 9.7 2.8 18D2H2 256.7 267.5 232.4 93.1 32.9 11.6 2.8 34B6D8 220.9 218.9 211.5 76.9 22.2 9.2 2.9 39E5H1 263.7 233.7 190.7 73.1 27.0 9.2 2.8 57F4E5 147.0 154.3 155.5 69.7 23.7 9.6 2.9 134H3G6 218.3 229.0 207.2 96.6 34.5 13.5 2.8 215A8F2 283.1 297.9 235.3 73.6 20.5 8.2 2.9 hIgG control 5.0 4.5 3.1 2.9 2.8 2.8 2.8
TABLE-US-00021 TABLE 14 Binding reaction of fully human TIM-3 antibody to CHOK1-cTIM-3 detected by FACS Mean fluorescence intensity Antibody concentration (nM) Clone ID 40 8 1.6 0.32 0.064 0.013 0 7A4F10 336.1 325.2 176.8 52.7 17.2 7.1 2.8 18D2H2 461.9 475.1 332.7 126.8 44.0 14.8 2.8 34B6D8 336.2 340.0 265.9 108.6 35.4 12.7 2.9 39E5H1 336.9 348.8 315.1 131.8 42.3 14.8 3.0 57F4E5 269.2 258.6 207.0 80.6 30.6 11.4 2.9 134H3G6 376.1 400.9 326.0 133.9 46.4 16.8 2.9 215A8F2 365.8 362.4 251.5 92.5 29.9 11.5 2.8 hIgG control 6.0 3.7 3.2 3.1 2.9 2.8 2.9
[0425] The results show that the fully human TIM-3 antibody can bind to human and monkey TIM-3 proteins on the cell surface to varying degrees.
[0426] (III) Detection of TIM-3 Antibody Blocking of the Binding of TIM-3 to its Ligand Phosphatidylserine by TIM-3 Receptor Ligand Binding Assay
[0427] Jurkat cells were treated with 1 μM staurosporine at 37° C. for 2 hours to induce apoptosis. The presence of phosphatidylserine was detected by Annexin V-FITC cell apoptosis detection kit. The hTIM-3-hFc strongly bound to staurosporine-treated Jurkat cells, but did not bind to untreated Jurkat cells. The cells were washed 1-2 times with PBS buffer, and after cell counting, the cells were diluted to 1-2×10.sup.6 cells per milliliter with binding buffer, and added to a 96-well FACS reaction plate at 100 microliters per well. The antibody sample to be tested and 2 μg/ml hTIM-3-hFc protein were prepared with binding buffer, and mixed equally in volume. The mixture was incubated at room temperature for 30 minutes, then the FACS reaction plate incubated with apoptotic cells was centrifuged to discard the supernatant, and the above mixture was added to the apoptotic cells at 100 microliters per well and incubated at room temperature for 1 hour. The plate was washed twice with the binding buffer by centrifugation, added with 100 microliters of fluorescent (Alexa 488)-labeled secondary antibodies per well, and incubated for half an hour. The plate was washed 2-3 times with the binding buffer by centrifugation, added with 100 microliters of PBS per well to suspend cells, and detected using FACS (FACS Calibur, BD) and the results were analyzed. The results are shown in Table 15 and
TABLE-US-00022 TABLE 15 Fully human TIM-3 antibody blocks binding of TIM-3 protein to its receptor phosphatidylserine Inhibition ratio (%) Antibody concentration (nM) Clone number 200 66.667 22.222 7.407 2.469 0.823 0.274 0 7A4F10 56.9 60.5 62.1 62.4 23.7 5.7 0.9 0.5 18D2H2 56.1 62.3 63.9 64.9 27.4 3.9 5.4 1.4 134H3G6 37.6 52.3 58.4 60.1 10.9 6.1 8.0 5.5 215A8F2 52.1 57.2 61.8 59.5 5.8 −4.4 0.3 1.6 hIgG control −7.8 9.6 −2.8 0.5 −3.9 2.8 −20.0 −2.5
[0428] The results show that the antibody can inhibit the binding of TIM-3 protein to its receptor phosphatidylserine to varying degrees, and the activity of the antibody was equivalent.
[0429] (IV) Detection of the Effect of TIM-3 Antibody on Lymphocyte Activity by Lymphocyte Stimulation Test
[0430] In the lymphocyte stimulation test, TIM-3 antibodies block the binding of TIM-3 protein and its receptor to relieve the inhibition of T lymphocyte activity, thereby stimulating the proliferation of T cells.
[0431] Results are shown in
TABLE-US-00023 TABLE 16 Effect of fully human TIM-3 antibodies on IFN-γ secretion in lymphocyte activation assay (donor X) IFN-γ production, pμg/ml 10 μg/ml 1 μg/ml 0.1 μg/ml 0 0 Clone ID N = 1 N = 2 N = 1 N = 2 N = 1 N = 2 N = 1 N = 2 N = 1 N = 2 7A4F10 2904.8 2356.6 2922.9 2784.1 2933.9 2732.6 2338.1 2365.3 2289.5 2230.5 18D2H2 2809.9 3074.1 3003.0 3137.4 2659.2 2647.8 2282.7 2587.8 2335.2 2165.8 34B6D8 2977.2 3331.7 2930.3 3549.0 2772.6 2818.4 2598.7 2541.4 2281.4 2394.9 39E5H1 3153.1 3127.9 3071.7 3004.5 2699.5 2881.6 2581.1 2459.7 2193.1 2372.7 57F4E5 3078.7 3341.3 3545.5 3148.9 2800.7 2983.1 2870.2 2741.8 2158.9 2395.5 134H3G6 3462.7 3476.0 3251.9 2894.0 2606.8 2724.7 2386.8 2425.9 2506.7 2365.6 215A8F2 2997.2 2471.5 2779.9 2031.9 2409.1 3167.6 2098.3 2302.3 1974.4 2397.0 hIgG1 Control 2034.4 2020.2 2091.5 2072.5 2040.8 2063.9 2260.5 1900.1 2003.8 2315.0
TABLE-US-00024 TABLE 17 Effect of fully human TIM-3 antibodies on IFN-γ secretion in lymphocyte activation assay (donor Y) IFN-γ production, pμg/ml 10 μg/ml 1 μg/ml 0.1 μg/ml 0 0 Clone ID N = 1 N = 2 N = 1 N = 2 N = 1 N = 2 N = 1 N = 2 N = 1 N = 2 7A4F10 3341.3 3891.2 3325.1 3219.3 3154.5 3224.3 2248.1 2157.7 2176.4 2089.1 18D2H2 3048.9 3126.2 3106.3 2864.8 2540.8 2750.3 2203.9 2235.7 2125.7 2051.7 34B6D8 3515.2 3631.6 3045.6 3825.5 2887.5 2899.5 2127.3 2304.1 1823.3 2043.8 39E5H1 3497.1 4116.1 3401.2 3599.3 2712.9 2712.9 2094.1 1951.0 1843.7 2101.2 57F4E5 3960.3 3661.6 3547.3 3612.7 3214.3 2866.6 2310.4 2048.6 2151.4 2096.7 134H3G6 3403.1 3910.9 3196.6 3226.0 2215.4 2546.4 2025.1 2256.6 1806.4 2121.3 215A8F2 3141.5 2791.8 3321.2 2556.3 2598.1 2341.0 1991.1 1996.8 2381.0 2071.5 hIgG control 1926.8 1982.5 2186.2 1769.0 2097.4 2016.0 1985.2 2160.5 1997.4 2068.7
[0432] The results show that the antibody to be tested can enhance IFN-γ secretion of PBMC to varying degrees in PBMC lymphocyte stimulation test.
[0433] (V) Antibody Affinity Test
[0434] First, AHC sensor was selected, and the sensor was balanced with buffer solution for 10 min, then the antibody to be tested was diluted to 5 μg/ml with buffer solution, and the antibody was solidified with the sensor for 3-5 min, with a signal value of 1-2 nm. The sensor was balanced again with buffer solution for 3 minutes, and then the antigen protein was diluted to 100 nM (the highest concentration was tentatively 100 nM) to bind and dissociate the antibody coupled by the sensor. If enough signal value was obtained, the antigen protein was diluted by several concentration gradients to analyze the binding and dissociation of antibody and antigen. At that end of each cycle, the sensor surface was regenerated with 10 mM, pH 1.5 Glycine. The kinetic rate constant needed to be subtracted the blank control, and the data was fitted with the global fit analysis method 1:1 combination model. The dissociation equilibrium rate constant (KD) was calculated according to the following formula: KD=kd/ka. The results are shown in Table 18.
TABLE-US-00025 TABLE 18 Analysis and determination of anti-TIM-3 antibody affinity Clone ID Ka (1/Ms) Kd (1/s) KD (M) 7A4F10 1.11E+06 1.13E−03 1.01E−09 18D2H2 1.22E+06 3.13E−03 2.58E−09 34B6D8 1.15E+06 1.20E−03 1.05E−09 39E5H1 1.06E+06 1.55E−03 1.46E−09 57F4E5 1.60E+06 3.97E−03 2.48E−09 134H3G6 1.19E+06 4.83E−03 4.05E−09 215A8F2 9.65E+05 1.28E−04 1.33E−10
[0435] The results show that the KD values of the obtained fully human TIM-3 antibodies were all at the level of nanomolecular (nM) level, indicating that these antibodies had good affinity to human TIM-3 ECD. Among them, 215A8F2 antibody had the best affinity for human TIM-3 ECD.
Discussion
[0436] Fully Human Antibody
[0437] The application of monoclonal antibodies is one of the most successful and transformative treatments in cancer treatment in the past 20 years. Compared with traditional chemical drugs, antibody drugs have higher specificity and lower toxicity. Although monoclonal antibody drugs have achieved continuous success, they still face many challenges.
[0438] The biggest defect of a murine monoclonal antibody is the HAMA (human anti-mouse antibody) response it induces. Therefore, murine monoclonal antibodies have great limitations in the diagnosis and treatment of tumors, organ transplantation and other diseases; chimeric antibodies still retain 30% of the murine sequence, which can cause different degrees of HAMA response. Clinically, different chimeric antibodies have different degrees of immunogenicity; humanized antibodies are also called transplantation antibodies. Simple CDR transplantation often leads to a decrease in antigen-antibody affinity. Because it still has at least 10% heterologous protein, its clinical application is still limited to varying degrees. Therefore, it is necessary to further develop a more perfect therapeutic antibody, a fully human antibody.
[0439] In 1994, the American companies Abgenix and Genpham reported the use of transgenic mice to prepare fully human antibodies, thus solving the problem of human antibody preparation research that the human body cannot be immunized at will. Since then, the technology for preparing fully human antibodies has continued to develop and mature, and the obtained human monoclonal antibodies have strong anti-tumor activity. H2L2 transgenic mouse is provided under license by Harbour Medicine (Shanghai) Co., Ltd., based on the transgenic mouse technology developed by Professor Frank Grosveld's laboratory of Rotterdam University Medical Center (Rotterdam, Netherlands), which can produce a traditional tetrameric antibody consisting of two heavy chains and two light chains (H2L2) with complete human variable regions. The antibodies produced have mature affinity, fully humanized variable regions, and have excellent solubility. Genetically engineered mouse technology is one of the main tools for producing fully human antibodies.
[0440] Immunotherapy
[0441] Cancer immunotherapy refers to a treatment that uses the immune system to fight cancer. Recently, cancer immunotherapy has attracted much attention. It has become a new method of cancer treatment besides surgery, chemotherapy and radiotherapy. Immune checkpoints refer to some inhibitory signal pathways in the immune system, which prevent tissue damage by regulating the persistence and intensity of immune responses in peripheral tissues, and participate in maintaining tolerance to self-antigens. The use of inhibitory signaling pathways of immune checkpoints to inhibit T cell activity is an important mechanism for tumors to escape immune killing. Blocking immune checkpoints is one of many effective strategies to activate anti-tumor immunity.
[0442] Inhibitors of immune checkpoint proteins have the potential to treat various tumor types (such as metastatic melanoma, lung cancer, breast cancer, renal cell carcinoma, etc.). Recent research on cancer immunotherapy has shown promising results, especially for metastatic cancer cases. In addition, cancer immunotherapy has great potential in the treatment of blood cancers, including Hodgkin's lymphoma, multiple myeloma, myelodysplastic syndrome, and non-Hodgkin's lymphoma. The side effects caused by immune checkpoint inhibitors are negligible, reversible and controllable, and effective immune checkpoint inhibitors can significantly improve the overall survival of cancer patients. Immune checkpoint inhibitors can also be used in combination with targeted therapy or conventional radiotherapy and chemotherapy, and this combination therapy can effectively treat many types of cancer, and may be the hope of treating or curing a variety of cancers.
[0443] At present, the clinical research of TIM-3 antibody is mainly used in the treatment of malignant solid tumor and lymphoma, and it is also mainly concentrated on its combined use with other therapies or target drugs to develop antibodies with a wide range of indications to expand its applicable clinical symptoms, including unresectable metastatic melanoma, advanced solid cancer, breast cancer, endometrial cancer, ovarian cancer, kidney cancer, pancreatic cancer, recurrent glioblastoma, head and neck cancer, bladder cancer, metastasis rectal cancer, gastrointestinal stromal tumors, acinar cell carcinoma, high-grade malignant solid tumors, non-small cell lung cancer, etc.
[0444] The Technical Scheme of the Present Invention has the Advantage that:
[0445] Therapeutic monoclonal antibodies can be developed by various technologies and approaches, including hybridoma technology, phage display technology, and single lymphocyte gene cloning technology and so on. However, the preparation of monoclonal antibodies from wild-type or transgenic mice by hybridoma technology is still the mainstream of the preparation methods of therapeutic monoclonal antibodies. According to the latest advances in monoclonal antibody technology, the present invention adopts optimized hybridoma technology to prepare the required anti-TIM-3 antibody.
[0446] (1) Antibodies can be obtained by immunizing wild-type mice, but mouse antibodies need to be humanized to obtain humanized antibodies. The disadvantage is that the modified antibody may be more immunogenic and the structure of the antibody may be changed resulting in loss of activity or poor manufacturability.
[0447] (2) Antibodies can obtained by immunizing fully human transgenic mice, but the number or affinity of the obtained antibodies will be poor.
[0448] (3) Antibody expression and activity screening can be carried out by constructing immunized mouse antibody library with phage display technology, but the random recombination of antibody heavy and light chains will result in poor production of the formed antibodies.
[0449] (4) Antibodies can be expressed and screened by phage display technology by constructing a human antibody library. But the affinity of the obtained antibody will be poor because it has not been immunized.
[0450] All literatures mentioned in the present application are incorporated herein by reference, as though each one is individually incorporated by reference. In addition, it should also be understood that, after reading the above teachings of the present invention, those skilled in the art can make various changes or modifications, equivalents of which falls in the scope of claims as defined in the appended claims.
[0451] The sequence information of the present invention (including the amino acid sequence of the CDR region in the TIM-3 antibody of the present invention and its sequence number, and the amino acid and gene sequence of the heavy/light chain variable region in the TIM-3 antibody of the present invention and its sequence number) is shown in Table 18 below.
TABLE-US-00026 TABLE 18 SEQ ID NO. Name Sequence 1 7A4F10 EVQLLESGGGLVQPGGSLRLSCAASGFTFRTHLISWVRQAPGKGLE VH-aa WVAAITGSGGSTYYADSVKGRFIISRDNSKNTLFLQMNSLRAEDTA VYYCAKDGGSGSYDDFWGQGTLVTVSS 2 7A4F10 gaagtgcaactgttggagtctgggggaggcttggtacagcctggggggtccctgagactctcctgtgcgg VH-nt cctctggattcacctttaggacccatctcataagttgggtccgccaggctccagggaagggactggagtgg gtcgcagctataactggtagtggtggtagcacatactacgcagactccgtgaagggccggttcatcatctc cagagacaattccaagaacacgctgtttctgcaaatgaacagcctgagagccgaagacacggccgtatat tactgtgcgaaagatgggggttcggggagttatgatgacttctggggccagggaaccctggtcaccgtct cctca 3 7A4F10 THLIS VH-CDR1 4 7A4F10 AITGSGGSTYYADSVKG VH-CDR2 5 7A4F10 DGGSGSYDDF VH-CDR3 6 7A4F10 ETVLTQSPVTLSLSPGERATLSCRASQSVGSYLAWYQQKPGQAPRLL VL-aa IYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWP PTFGQGTKVEIK 7 7A4F10 gaaactgtgttgacacagtctccagtcaccctgtctttgtctccaggggaaagagccaccctctcctgcag VL-nt ggccagtcagagtgttggcagctacttagcctggtaccaacagaaacctggccaggctcccaggctcctc atctatgatgcatccaacagggccactggcatcccagccaggttcagtggcagtgggtctgggacagact tcactctcaccatcagcagcctagagcctgaagattttgcagtttattactgtcagcagcgtagcaactggc ctccgacgttcggccaagggaccaaggtggaaatcaaa 8 7A4F10 RASQSVGSYLA VL-CDR1 9 7A4F10 DASNRAT VL-CDR2 10 7A4F10 QQRSNWPPT VL-CDR3 11 18D2H2 EVQLVESGGDLVQPGGSLRLSCAASGFTFSTYWMTWVRQAPGRGL VH-aa EWVANIKQDGSAKYYVDSVKGRFTLSRDDAKNSLYLQMNSLRAED TAVYYCARGSNWFDYWGQGTLVTVSS 12 18D2H2 gaggtgcagctggtggagtctgggggagacttggtccagcctggggggtccctgagactctcctgtgca VH-nt gcctctggattcacctttagtacctattggatgacgtgggtccgccaggctccagggaggggactggagtg ggtggccaacattaaacaagatggaagtgcgaaatactatgtggactctgtgaagggccgattcaccctct ccagagacgacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggctgtgt attactgtgcgagagggagcaactggtttgactactggggccagggaaccctggtcaccgtctcctca 13 18D2H2 TYWMT VH-CDR1 14 18D2H2 NIKQDGSAKYYVDSVKG VH-CDR2 15 18D2H2 GSNWFDY VH-CDR3 16 18D2H2 ETVMTQSPATLSVSPGERATLSCRANQNVYSNLAWYQQKPGQAPR VL-aa LLIYDASTRATGFPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNN WPLTFGGGTKVEIK 17 18D2H2 gaaacagtgatgacgcagtctccagccaccctgtctgtgtctccaggggaaagagccaccctctcctgca VL-nt gggccaatcagaatgtttacagcaacttagcctggtaccagcagaaacctggccaggctcccaggctcct catctatgatgcatccaccagggccactggtttcccagccaggttcagtggcagtgggtctgggacagagt tcactctcaccatcagcagcctgcagtctgaagattttgcagtttattactgtcagcagtataataactggccg ctcactttcggcggagggaccaaggtggagatcaaa 18 18D2H2 RANQNVYSNLA VL-CDR1 19 18D2H2 DASTRAT VH-CDR2 20 18D2H2 QQYNNWPLT VH-CDR3 21 134H3G6 EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSWMTWVRQAPGKGL VH-aa EWVANIKQAGTEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAED TAVYYCNSGSNYFDYWGQGTLVTVSS 22 134H3G6 gaggtgcagctggtggagtctgggggaggcttggtccagcctggggggtccctgagactctcctgtgca VH-nt gcctctggattcacctttagtaactcttggatgacctgggtccgccaggctccagggaaggggctggagtg ggtggccaacataaagcaagctggaactgagaaatactatgtggactctgtgaagggccgattcaccatct ccagagacaacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggctgtgt attactgtaatagtgggagcaactactttgactactggggccagggaaccctggtcaccgtctcctca 23 134H3G6 NSWMT VH-CDR1 24 134H3G6 NIKQAGTEKYYVDSVKG VH-CDR2 25 134H3G6 GSNYFDY VH-CDR3 26 134H3G6 EIVMTQSPATLSVSPGERATLSCRARQNFYSNLAWYQQKPGQAPRL VL-aa LIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNW PLTFGGGTKVEIK 27 134H3G6 gaaatagtaatgacgcagtctccagccaccctgtctgtgtctccaggggaaagagccaccctctcctgca VL-nt gggccagacagaatttttacagcaacttagcctggtaccaacagaaacctggccaggctcccaggctcct catctatggtgcatccaccagggccactggtatcccagccaggttcagtggcagtgggtctgggacagag ttcactctcaccatcagcagcctgcagtctgaagattttgcagtttattactgtcagcagtataataactggcc tctcactttcggcggagggaccaaggtggagatcaaa 28 134H3G6 RARQNFYSNLA VL-CDR1 29 134H3G6 GASTRAT VL-CDR2 30 134H3G6 QQYNNWPLT VL-CDR3 31 215A8F2 QVQLQQWGAGLLKPSETLSLTCTVYGGSFSGYYWNWIRQPPGKGL VH-aa EWLGEINHSGSTNYNPSLKRRVTISVDTSKNQFSLKLSSVTAADTAV YYCARVYYYGPFDFWGQGTLVTVSS 32 215A8F2 caggtgcagctacagcagtggggcgcaggactgttgaagccttcggagaccctgtccctcacctgcact VH-nt gtctatggtgggtccttcagtggttactactggaactggatccgccagcccccagggaaggggctggagt ggcttggggaaatcaatcatagtggaagcaccaactacaacccgtccctcaagagacgagtcaccatatc agtggacacgtccaagaaccagttctccctgaagctgagctctgtgaccgccgcggacacggctgtgtat tactgtgcgagggtgtattattatggcccttttgacttctggggccagggaaccctggtcaccgtctcctca 33 215A8F2 GYYWN VH-CDR1 34 215A8F2 EINHSGSTNYNPSLKR VH-CDR2 35 215A8F2 VYYYGPFDF VH-CDR3 36 215A8F2 DIVMTQSPDSLAVSLGERATINCKSSQSVLYRSNNKNYLAWYQQKP VL-aa GQPPKLLIYWASTRESGVPDRFSGSGPGTDFTLTINSLQAEDVAVYY CQQYYSTPYTFGQGTKLEIK 37 215A8F2 gacatcgtgatgacccagtctccagactccctggctgtgtctctgggcgagagggccaccatcaactgca VL-nt agtccagccagagtgttttatacaggtccaacaataagaactacttagcttggtaccagcagaaaccagga cagcctcctaagctgctcatttactgggcatctacccgggaatccggggtccctgaccgattcagtggcag cgggcctgggacagatttcactctcaccatcaacagcctgcaggctgaagatgtggcagtttattactgtca gcaatattatagtactccgtacacttttggccaggggaccaagctggagatcaaa 38 215A8F2 KSSQSVLYRSNNKNYLA VL-CDR1 39 215A8F2 WASTRES VL-CDR2 40 215A8F2 QQYYSTPYT VL-CDR3 41 34B6D8 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMTWVRQAPGKRL VH-aa EWVANIKQGGGDKYYVDSVKGRFTISTDNAKNSLYLQMNSLRAED TAVYYCARGSNWFDPWGQGTLVTVSS 42 34B6D8 gaggtgcagctggtggagtctgggggaggcttggtccagcctggggggtccctgcgtctctcctgtgca VH-nt gcctctggattcacctttagtacctattggatgacctgggtccgccaggctccagggaagcggctggagtg ggtggccaacataaagcaaggtggaggtgataaatactatgtggactctgtgaagggccgattcaccatct ccacagacaacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggctgtgt attactgtgcgagagggtccaactggttcgacccctggggccagggaaccctggtcaccgtctcctca 43 34B6D8 TYWMT VH-CDR1 44 34B6D8 NIKQGGGDKYYVDSVKG VH-CDR2 45 34B6D8 GSNWFDP VH-CDR3 46 34B6D8 EIVMTQSPATLSMSPGERATLSCRASQSVYDNLAWYQQKPGQAPRL VL-aa LIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFALYYCQQYTHW PITFGQGTRLEIK 47 34B6D8 gaaatagtgatgacgcagtctccagccaccctgtctatgtctccaggggaaagagccaccctctcctgca VL-nt gggccagtcagagtgtttacgacaacttagcctggtaccagcagaaacctggccaggctcccaggctcct catctatggtgcatccaccagggccactggtatcccagccaggttcagtggcagtgggtctgggacagag ttcactctcaccatcagcagcctgcagtctgaagattttgcactttattactgtcagcagtatactcactggcc gatcaccttcggccaagggacacgactggagattaaa 48 34B6D8 RASQSVYDNLA VL-CDR1 49 34B6D8 GASTRAT VL-CDR2 50 34B6D8 QQYTHWPIT VL-CDR3 51 39E5H1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGL VH-aa EWVANIKRGGSERYYVDSVKGRFTISGDNAKNSVYLQMNSLRAED TAVYYCARGSNWFDPWGQGTLVTVSS 52 39E5H1 gaggtgcagctggtggagtctgggggaggcttggtccagcctggggggtccctgagactctcctgtgca VH-nt gcctctggattcacctttagtagctattggatgagctgggtccgccaggctccagggaagggactggagtg ggtggccaacataaagcgaggtggaagtgagagatactatgtggactctgtgaagggccgattcaccatc tccggagacaacgccaagaactcagtgtatctgcaaatgaacagcctgagagccgaggacacggctgtg tattactgtgcgagaggctccaactggttcgacccctggggccagggaaccctggtcaccgtctcctca 53 39E5H1 SYWMS VH-CDR1 54 39E5H1 NIKRGGSERYYVDSVKG VH-CDR2 55 39E5H1 GSNWFDP VH-CDR3 56 39E5H1 ETVMTQSPAILSVSPGERATLSCRASQSVYSNLAWYQQKLGQAPRL VL-aa LIYDASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNW PITFGQGTRLEIK 57 39E5H1 gaaacagtgatgacgcagtctccagccatcctgtctgtgtctccaggggaaagagccaccctctcctgca VL-nt gggccagtcagagtgtttacagcaacttagcctggtaccaacagaaacttggccaggctcccaggctcct catctatgatgcatccaccagggccactggtatcccagccaggttcagtggcagtgggtctgggacagag ttcactctcaccatcagcagcctgcagtctgaagattttgcagtttattactgtcagcagtataataactggcc gatcaccttcggccaagggacacgactggagattaaa 58 39E5H1 RASQSVYSNLA VL-CDR1 59 39E5H1 DASTRAT VL-CDR2 60 39E5H1 QQYNNWPIT VL-CDR3 61 57F4E5 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGL VH-aa EWVANIKQDGSEKYYVDSVKGRFTISRDSAKNSLYLQMNSLRAEDT AMYFCARDSNFFDYWGQGTLVTVSS 62 57F4E5 gaggtgcagctggtggagtctgggggaggcttggtccagcctggggggtccctgagactctcctgtgca VH-nt gcctctggattcacctttagtagctattggatgagctgggtccgccaggctccagggaaggggctggagt gggtggccaacataaagcaagatgggagtgagaaatactatgtggactctgtgaagggccgattcaccat ctccagagacagcgccaagaactcactgtatcttcaaatgaacagcctgagagccgaggacacggctat gtatttctgtgcgagagactccaacttctttgactactggggccagggaaccctggtcaccgtctcctca 63 57F4E5 SYWMS VH-CDR1 64 57F4E5 NIKQDGSEKYYVDSVKG VH-CDR2 65 57F4E5 DSNFFDY VH-CDR3 66 57F4E5 ETVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQRKPGQAPRL VL-aa LIYFSSTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNW PLTFGGGTKVEIK 67 57F4E5 gaaacagtgatgacgcagtctccagccaccctgtctgtgtctccaggggaaagagccaccctctcctgca VL-nt gggccagtcagagtgttagcagcaacttagcctggtaccagcggaaacctggccaggctcccaggctcc tcatctatttttcatccaccagggccactggaatcccagccaggttcagtggcagtgggtctgggacagag ttcactctcaccatcagcagcctgcagtctgaagattttgcagtttattactgtcagcagtataataactggcc gctcactttcggcggagggaccaaggtggagatcaaa 68 57F4E5 RASQSVSSNLA VL-CDR1 69 57F4E5 FSSTRAT VL-CDR2 70 57F4E5 QQYNNWPLT VL-CDR3 71 Amino MFSHLPFDCVLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP acid VCWGKGACPVFECGNVLRTDERDVNYWTSRYWLNGDFRKGDVSLTI sequence ENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTRQRDFTA of AFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDS human GATIRIGIYIGAGICAGLALIFKWYSHSKEKIQNLSLISLPPSGLANAVAE TIM-3 GIRSE ENIYTIEENVYEVEEPNEYYCYVSSRQQPSQPLGCRFAMP protein 72 Amino MFSHLPFDCVLLLLLLLTRSSEVEYIAEVGQNAYLPCSYTPAPPGNLVP acid VCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSL sequence TIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRD of LTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRD monkey SGATIRTAIYIAAGISAGLALIFGALIFKWYSHSKEKTQNLSLISLANIPPS TIM-3 GLANAVE protein AEGIRSEENIYTIEDVYEVEEPNEYYCYVSSGQQPSQPLGCRVAMP 73 Amino MFSGLTLNCVLLLLQLLLARSLEDGYKVEVGKNAYLPCSYTLPTSGTL acid VSYTLPTSGTLVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQ sequence LKGDLKDLDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKA of mouse AKVTPAQTAHGDSTTASPRTTLTTERNGSETQTLVTLHNNNGTKISTW TIM-3 ADEIKDSGETIRTAHIGVGVSAGLTLALIIGVLILKWYSCKKKLSSSLITL protein ANLPPGGLANAG AVRIRSEENIYTIEENVYEVENSNEYYCYVNSQQPS Note: 1. Wherein VH-CDR1 is heavy chain variable region-CDRl, VH-CDR2 is heavy chain variable region-CDR2, and VH-CDR3 is heavy chain variable region-CDR3; wherein, VL-CDR1 is light chain variable region-CDRl, VL-CDR2 is light chain variable region-CDR2, and VL-CDR3 is light chain variable region-CDR3. 2. VH-aa refers to the amino acid sequence of the heavy chain variable region, and VH-nt refers to the gene sequence of the heavy chain variable region; VL-aa refers to the amino acid sequence of the light chain variable region, and VL-nt refers to the gene sequence of the heavy chain variable region.