ANTI-IL13R ALPHA2 ANTIBODIES
20220033508 · 2022-02-03
Inventors
Cpc classification
C07K2317/24
CHEMISTRY; METALLURGY
A61K47/6801
HUMAN NECESSITIES
C07K16/2866
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
This disclosure relates to antibodies that specifically bind to the Interleukin-13 receptor subunit alpha-2 (IL13Rα2) protein, and associated uses and methods for production.
Claims
1. An antibody that binds to Interleukin-13 receptor subunit alpha-2 (IL13Rα2), which comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 3.
2. The antibody according to claim 1, wherein the antibody further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 4.
3. The antibody according to claim 1, wherein the antibody binds IL13Rα2 with an affinity (K.sub.D) no greater than 5×10.sup.−10 M.
4. The antibody according to claim 1, wherein the antibody competitively inhibits the binding to IL13Rα2 of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2.
5. The antibody according to claim 1, wherein the antibody binds IL13Rα2 with higher affinity (K.sub.D) than an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2.
6. The antibody according to claim 1, wherein the antibody has immunogenicity in a human subject that is lower than that of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2.
7. The antibody according to claim 1, wherein the antibody has improved stability properties as compared to an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2.
8. The antibody according to claim 1, wherein the antibody comprises a constant region of isotype IgG1, IgG2, IgG3 or IgG4, or a mutated IgG constant region.
9. The antibody of claim 8, wherein the constant region is human.
10. The antibody according to claim 1, wherein the antibody is a Fab, a Fab′, a F(ab′)2, or an scFv.
11. An antibody drug conjugate comprising the antibody according to claim 1 conjugated to a drug moiety.
12. The antibody drug conjugate of claim 11, wherein the drug moiety comprises a pyrollobenzodiazepine dimer.
13. A pharmaceutical composition comprising the antibody of claim 1 and a pharmaceutically acceptable diluent, carrier, or excipient.
14. A method of treating cancer in a subject, comprising administering the antibody of claim 1 to a subject in need thereof.
15. A method of treating cancer in a subject, comprising administering the antibody drug conjugate of claim 11 to a subject in need thereof.
16. A method of treating cancer in a subject, comprising administering the pharmaceutical composition of claim 13 to a subject in need thereof.
17. A polynucleotide encoding an antibody according to claim 1.
18. A vector comprising the polynucleotide of claim 17.
19. A host cell comprising the vector according to claim 18.
20. A pharmaceutical composition comprising the antibody drug conjugate of claim 11 and a pharmaceutically acceptable diluent, carrier, or excipient.
21. The vector of claim 18, which is an expression vector.
22. The host cell of claim 19, which is prokaryotic, eukaryotic, or mammalian.
Description
SUMMARY OF THE FIGURES
[0067]
[0068] Sequence comparison of murine “Clone 47” and “HuCL47” heavy (VH) and light (VK) chain variable domains. CDRs are underlined.
[0069]
[0070] Comparison of murine Clone47, humanised variant HuCL47, and isotype control B12 antibodies binding to NCI-H1299 Cells.
[0071]
[0072] ELISA binding comparison of murine Clone47, humanised variant HuCL47, and isotype control B12 antibodies.
DETAILED DESCRIPTION
[0073] Aspects and embodiments of the present disclosure will now be discussed with reference to the accompanying figures. Further aspects and embodiments will be apparent to those skilled in the art. All documents mentioned in this text are incorporated herein by reference.
[0074] Humanised Antibodies
[0075] The present disclosure provides humanised anti-IL13Rα2 antibodies.
[0076] “Clone 47” is a murine anti-IL13Rα2 antibody described in Balyasnikova et al (J Biol Chem. 2012 Aug. 31; 287(36): 30215-30227). Beginning from the heavy and light chain sequences of murine Clone 47 (SEQ ID NO: 1 and SEQ ID NO: 2 respectively), the present authors have generated a number of humanised heavy and light chain sequences with a view to creating antibodies that have lower immunogenicity in a human individual than chimeric antibodies comprising the heavy and light chain sequences of the murine antibody.
[0077] Surprisingly, it was found that certain humanised variants so produced show improved affinity for human IL13Rα2 as compared to the chimeric Clone 47. The humanised antibodies of the disclosure may also possess one or more additional advantageous properties—such as improved stability and/or cell killing activity—as outlined in the following.
[0078] Thus, the present disclosure provides an antibody that binds to IL13Rα2, wherein the antibody comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 3 (VHA; HuCL47 VH); SEQ ID NO: 5 (VHAback); SEQ ID NO: 6 (VHA1); SEQ ID NO: 7 (VHA2); and SEQ ID NO: 8 (VHA3). In some preferred embodiments, the antibody may comprise a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 3 (VHA; HuCL47 VH).
[0079] In some embodiments the antibody may further comprise a light chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 4 (VKA; HuCL47 VL); SEQ ID NO: 9 (VKAback); SEQ ID NO: 10 (VKA1); and SEQ ID NO: 11 (VKA2). In some preferred embodiments, the antibody may comprise a light chain variable region comprising the amino acid sequence of SEQ ID NO: 4 (VKA; HuCL47 VL).
[0080] In some embodiments of the disclosure, the antibody may comprise a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 4; SEQ ID NO: 9; SEQ ID NO: 10; or SEQ ID NO: 11.
[0081] In some embodiments of the disclosure, the antibody may comprise a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 4; SEQ ID NO: 9; SEQ ID NO: 10; or SEQ ID NO: 11.
[0082] In some embodiments of the disclosure, the antibody may comprise a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 4; SEQ ID NO: 9; SEQ ID NO: 10; or SEQ ID NO: 11.
[0083] In some embodiments of the disclosure, the antibody may comprise a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 4; SEQ ID NO: 9; SEQ ID NO: 10; or SEQ ID NO: 11.
[0084] In some embodiments of the disclosure, the antibody may comprise a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 4; SEQ ID NO: 9; SEQ ID NO: 10; or SEQ ID NO: 11.
[0085] Thus, specifically contemplated embodiments of the disclosure include antibodies which may comprise: [0086] i) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0087] ii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0088] iii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0089] iv) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0090] v) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0091] vi) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0092] vii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0093] viii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0094] ix) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0095] x) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0096] xi) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0097] xii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0098] xiii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0099] xiv) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0100] xv) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0101] xvi) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0102] xvii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0103] xviii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0104] xix) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; and [0105] xx) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11.
[0106] Some preferred specifically contemplated embodiments of the disclosure include antibodies which comprise: [0107] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3 (VHA; HuCL47 VH), and a light chain variable region having the amino acid sequence of SEQ ID NO: 4 (VKA; HuCL47 VL); [0108] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3 (VHA; HuCL47 VH), and a light chain variable region having the amino acid sequence of SEQ ID NO: 10 (VKA1); [0109] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3 (VHA; HuCL47 VH), and a light chain variable region having the amino acid sequence of SEQ ID NO: 11 (VKA2); [0110] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5 (VHAback), and a light chain variable region having the amino acid sequence of SEQ ID NO: 4 (VKA; HuCL47 VL); [0111] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5 (VHAback), and a light chain variable region having the amino acid sequence of SEQ ID NO: 10 (VKA1); [0112] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5 (VHAback), and a light chain variable region having the amino acid sequence of SEQ ID NO: 11 (VKA2); and [0113] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 (VHA3), and a light chain variable region having the amino acid sequence of SEQ ID NO: 11 (VKA2).
[0114] Other preferred embodiments of the disclosure include antibodies which comprise: [0115] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3 (VHA; HuCL47 VH), and a light chain variable region having the amino acid sequence of SEQ ID NO: 4 (VKA; HuCL47 VL); [0116] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5 (VHAback), and a light chain variable region having the amino acid sequence of SEQ ID NO: 4 (VKA; HuCL47 VL); and [0117] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 (VHA3), and a light chain variable region having the amino acid sequence of SEQ ID NO: 11 (VKA2).
[0118] In some particularly preferred embodiments of the disclosure the antibody comprises a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4. Such antibodies may be referred to herein as “huCL47”.
[0119] The antibodies of the disclosure are humanised or fully human antibodies, or comprise variable domains that are humanised or fully human. The antibodies of the disclosure may be isolated humanised or fully human antibodies. In some embodiments, the antibodies of the disclosure may further comprise an antibody constant region derived from one or more human antibodies.
[0120] In one embodiment, the present invention provides an antibody that binds to Interleukin-13 receptor subunit alpha-2 (IL13Rα2), comprising a heavy chain comprising the complementarity determining regions (CDRs) shown in SEQ ID NO:13, SEQ ID NO: 14 and SEQ ID: NO 15; and/or a light chain comprising (i) the CDRs shown in SEQ ID NO:16, SEQ ID NO: 17 and SEQ ID: NO 18; and (ii) a serine residue at position 30 (numbering with reference to SEQ ID NO: 3) wherein at least the variable regions are fully human. In one embodiment the antibody is fully human, including the constant regions. In a related embodiment the present invention provides an antibody conjugate comprising said antibody and pyrollobenzodiazepine dimer. In one embodiment the light chain is a human kappa light chain.
[0121] Antigen Binding
[0122] The antibodies described herein are antibodies which specifically bind to IL13Rα2.
[0123] As used herein, “bind to IL13Rα2” and “binds IL13Rα2” are used to mean the antibody binds IL13Rα2 with a higher affinity than a non-specific partner such as Bovine Serum Albumin (BSA, Genbank accession no. CAA76847, version no. CAA76847.1 GI:3336842, record update date: Jan. 7, 2011 02:30 PM). In some embodiments the antibody binds IL13Rα2 with an association constant (Ka) at least 2, 3, 4, 5, 10, 20, 50, 100, 200, 500, 1000, 2000, 5000, 104, 105 or 106-fold higher than the antibody's association constant for BSA, when measured at physiological conditions.
[0124] In some embodiments, the IL13Rα2 polypeptide corresponds to the amino acid sequence disclosed at UniProt accession no: Q14627 (entry version 190) or a fragment thereof. In some embodiments, the IL13Rα2 polypeptide corresponds to an amino acid sequence having at least 70%, 80%, 90%, 95%, 99% or 100% sequence identity with the full-length of the amino acid sequence disclosed at UniProt accession no: Q14627 (entry version 190) or a fragment thereof. In some embodiments, the IL13Rα2 polypeptide has the sequence of SEQ ID NO: 12.
[0125] Antibody affinity Surprisingly, the present authors have found that the process of humanisation increases the affinity of the humanised antibodies for human IL13Rα2 as compared to the chimeric (Ch) Clone 47, as determined in a Biacore binding assay (see Example 2).
[0126] Thus, the antibodies of the invention can bind IL13Rα2 with high affinity. For example, in some embodiments the humanised antibodies of the disclosure may bind IL13Rα2 with dissociation constant (K.sub.D) no greater than 10.sup.−6 M, no greater than 5×10.sup.−6 M, no greater than 10.sup.−7 M, no greater than 5×10.sup.−7 M, no greater than 10.sup.−8 M, no greater than 5×10.sup.−8 M, no greater than 10.sup.−9 M, no greater than 5×10.sup.−9 M, no greater than 10.sup.−10 M, no greater than 5×10.sup.−10 M, no greater than 10.sup.−11 M, no greater than 5×10.sup.−11 M, no greater than 10.sup.−12 M, no greater than 5×10.sup.−12 M, no greater than 10.sup.−13 M, no greater than 5×10.sup.−13 M, no greater than 10.sup.−14 M, no greater than 5×10.sup.−14 M, no greater than 10.sup.−15 M, or no greater than 5×10.sup.−15 M.
[0127] In some embodiments the humanised antibodies of the disclosure may bind IL13Rα2 with dissociation constant (K.sub.D) no greater than 0.52, 0.51, 0.50, 0.49, 0.48, 0.47, 0.46, 0.45, 0.44, 0.43, 0.42, 0.41, or 0.40 nM. In some embodiments, the humanised antibodies of the disclosure may bind IL13Rα2 with dissociation constant (K.sub.D) no greater than 0.40, 0.35, 0.30, 0.25, 0.20, 0.15, or no greater than 0.10 nM.
[0128] In some embodiments, the humanised antibodies of the disclosure may bind IL13Rα2 with dissociation constant (K.sub.D) from 10.sup.−8 M to 10-10 M, from 10.sup.−10 M to 10.sup.−12 M, from 10.sup.−12 M to 10.sup.−14 M, or from 10.sup.−14 M to 10.sup.−16 M. In some embodiments, the humanised antibodies of the disclosure may bind IL13Rα2 with dissociation constant (K.sub.D) from 5×10.sup.−10 to 5×10.sup.−11 M.
[0129] Suitable methods for determining antibody affinity will be well known to the skilled person—for example enzyme-linked immunosorbent assay (ELISA) and surface plasmon resonance (SPR) techniques. In some embodiments, the K.sub.D may be determined and calculated by the methods described in the Examples.
[0130] In some embodiments the humanised antibodies may competitively inhibit the in vivo and/or in vitro binding to human IL13Rα2 of the murine “Clone 47” antibody. In some embodiments, humanised antibodies may competitively inhibit the in vivo and/or in vitro binding to human IL13Rα2 of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2.
[0131] In some embodiments an equimolar dose of the humanised antibodies of the disclosure may competitively inhibit at least 20% of the binding the murine “Clone 47” antibody, such as at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% of the binding.
[0132] Percentage binding may be measured by, for example, a competitive ELISA assay where % inhibition of binding is calculated as [(1−absorbance of test sample)/(absorbance of negative control)].
[0133] In some embodiments the humanised antibodies of the disclosure may have a higher affinity for a human IL13Rα2 antigen than the murine “Clone 47” antibody. In some embodiments the humanised antibodies of the disclosure may have a higher affinity for a human IL13Rα2 antigen than an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2.
[0134] In some embodiments the K.sub.D of the humanized antibody with the human IL13Rα2 antigen will be no more than 0.9 of the K.sub.D of the murine “Clone 47” antibody/an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2. For example the K.sub.D of the humanized antibody with the human IL13Rα2 antigen may be no more than 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2, 0.1, 0.05, 0.01, or 0.001 of the K.sub.D of one or more of the antibodies described above. In some preferred embodiments, the K.sub.D may be no more than 0.5, or no more than 0.2 of the K.sub.D of one or more of the antibodies described above.
[0135] Antibody Isoelectric Point (PI)
[0136] A molecule carries no net charge when the pH of its surroundings equals the molecules pI. The net charge of a molecule affects the solubility of the molecule, with biological molecules such as proteins typically having minimum solubility in water or salt solutions at the pH that corresponds to their pI. Thus, proteins whose pI is 7.35-7.45 are at their minimum solubility in human blood, whose pH is typically in the range 7.35-7.45.
[0137] When the pH of its surroundings is below the protein's pI, then the molecule carries a net positive charge. When the pH of its surroundings is above the protein's pI, then the molecule carries a net negative charge. In general, higher net positive charge of an antibody results in increased tissue retention and blood clearance with shorter half-life, while lower pI/lower net positive charge results in decreased tissue retention and longer half-life (Boswell et al, Bioconjug Chem. 2010 Dec. 15; 21 (12):2153-63).
[0138] In some embodiments the humanised antibodies of the disclosure may have a pI less than the murine “Clone 47” antibody. In some embodiments the humanised antibodies of the disclosure may have a pI less than an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2. In some embodiments the humanised antibodies of the disclosure may have a pI of no more than 9.0, such as no more than 8.5, no more than 8.0, or no more than 7.5. In some embodiments the humanised antibodies of the disclosure may have a pI of no more than 8.9, 8.8, 8.7, 8.6, 8.5, 8.4, 8.3, 8.2, or 8.1. In some embodiments the humanised antibodies of the disclosure may have a pI of no more than 7.9, 7.8, or 7.7.
[0139] In some embodiments the humanised antibodies of the disclosure may have a pI greater than the murine “Clone 47” antibody. In some embodiments the humanised antibodies of the disclosure may have a pI greater than an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2. In some embodiments the humanised antibodies of the disclosure may have a pI of at least 7.5, such as at least 8.0, at least 8.5, or at least 9.0. In some embodiments the humanised antibodies of the disclosure may have a pI of at least 7.5, 7.6, 7.7, 7.8, 7.9, or 8.0. In some preferred embodiments the humanised antibodies of the disclosure may have a pI of at least 7.6. In some preferred embodiments the humanised antibodies of the disclosure may have a pI of at least 7.63.
[0140] Antibody stability Surprisingly, the present authors have found that the process of humanisation may increase the stability of the humanised antibodies, as determined by binding to IL13Rα2 following incubation at 4° C. or 45° C. for 8 days as assessed by ELISA (see Example 2).
[0141] Thus, the antibodies of the disclosure may have improved stability properties as compared to a non-humanised anti-IL13Rα2 antibody or other humanised anti-IL13Rα2 antibodies. In some embodiments, the humanised antibodies may have improved stability properties as compared an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2.
[0142] Suitable means for assessing stability properties are well known to the skilled person—for example, protein thermal shift and temperature stability assays. In some embodiments, stability properties of the humanised antibodies of the disclosure may be determined by one or more of the methods described in the Examples. In some embodiments, stability properties of the humanised antibodies of the disclosure may be determined by binding to IL13Rα2 following incubation at 4° C. or 45° C. for 8 days, as assessed by ELISA.
[0143] In some embodiments, the humanised antibodies of the disclosure may exhibit less than a 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50% decrease in binding affinity to IL13Rα2 following incubation at 45° C. for 8 days. In some embodiments, the humanised antibodies of the disclosure may exhibit less than a 4 fold reduction, for example, less than 3.5 fold, less than 3 fold, less than 2.5 fold, less than 2 fold, or less than 1.5 fold reduction in binding affinity to L13Rα2 following incubation at 45° C. for 8 days.
[0144] Cell Killing Activity/Cytotoxicity
[0145] In some cases the humanised antibodies of the disclosure and/or antibody-drug conjugates comprising the humanised antibodies of the disclosure may have high cell killing activity—for example, as determined by EC50 values.
[0146] In some embodiments the humanised antibodies and/or antibody-drug conjugates of the disclosure may have an EC50 that is lower than the murine “Clone 47” antibody antibody or an antibody-drug conjugate comprising the murine “Clone 47” antibody. In some embodiments the humanised antibodies and/or antibody-drug conjugates of the disclosure may have an EC50 that is lower than an antibody or antibody-drug conjugate comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2. In some embodiments the humanised antibodies and/or antibody-drug conjugates of the disclosure may have an EC50 that is at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100% lower than that of one or more of the antibodies/conjugates described above. Suitable means for determining cell killing activity/cytotoxicity and EC50 values are well known to the skilled person. In some embodiments, these may be determined by the methods described in the Examples.
[0147] Inhibition of Tumour Growth
[0148] In some cases the humanised antibodies of the disclosure and/or antibody-drug conjugates comprising the humanised antibodies of the disclosure may arrest or reduce the rate of growth of IL13Rα2-expressing tumours.
[0149] In some embodiments the humanised antibodies of the disclosure may inhibit tumour growth by at least 10% compared to a control tumour. That is, the volume of the antibody treated tumour is no more than 90% of the volume of the control tumour. For example, in some embodiments the antibodies of the disclosure may inhibit tumour growth by at least 20% compared to a control tumour, such as at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%.
[0150] In some embodiments, the tumour inhibitory effect of the humanised antibodies of the disclosure may be greater than that of the murine “Clone 47” antibody antibody or an antibody-drug conjugate comprising the murine “Clone 47” antibody. In some embodiments, the tumour inhibitory effect of the humanised antibodies of the disclosure may be greater than that of an antibody or antibody-drug conjugate comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2.
[0151] In some embodiments the tumour inhibitory effect of the humanised antibodies of the disclosure may be greater than that of one or more of the antibodies described above. In some embodiments the tumour inhibitory effect of the humanised antibodies of the disclosure may be at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100% higher than that of one or more of the antibodies described above. Suitable means for determining the effects of the humanised antibodies of the disclosure on tumour growth are well known to the skilled person.
[0152] Antibody Immunogenicity
[0153] The humanised antibodies of the disclosure have reduced immunogenicity in a human subject as compared to a non-humanised antibody of the same specificity (for example, a mouse antibody precursor prior to humanisation). In some embodiments the humanised antibodies of the disclosure may have immunogenicity in a human subject lower than an otherwise identical antibody or antibody fragment comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2.
[0154] Low or reduced immunogenicity can be characterized by the ability to treat patients for extended periods with measurable alleviation of symptoms and low and/or acceptable toxicity. Low or acceptable immunogenicity and/or high affinity, as well as other suitable properties, can contribute to the therapeutic results achieved. “Reduced immunogenicity” is defined herein as raising significant HAHA, HACA or HAMA responses in less 90%, such as less than 80%, less than 70%, less than 60%, less than 50%, less than 40%, less than 30%, less than 20%, less than 10% of the proportion of patients who show a significant HAHA, HACA or HAMA response when treated with the antibodies described above.
[0155] Antibody Production
[0156] The present disclosure also provides methods and means of producing the humanised antibodies of the disclosure.
[0157] Accordingly, in another aspect the disclosure provides nucleic acid molecules encoding the humanised antibodies, along with nucleic acid molecules complementary to nucleic acid molecules encoding the humanised antibodies.
[0158] In another aspect, the disclosure provides a pharmaceutical composition comprising an antibody pf the disclosure, optionally further comprising a pharmaceutically acceptable carrier or excipient.
[0159] In another aspect the disclosure provides a vector, such as an expression vector, comprising a nucleic acid of the disclosure.
[0160] In another aspect, the disclosure provides host cells transfected with a vector of the disclosure. The host cells may be prokaryotic or eukaryotic. For example, the cells may be bacterial, fungal, insect, or mammalian (such as mouse, primate or human).
[0161] In another aspect the disclosure provides a method of making the antibodies by culturing the host cells of the disclosure.
[0162] In some cases, when expressed in a host cell of the disclosure, the humanised antibodies of the disclosure may be expressed at a higher level, or with higher productivity or yield, as compared to a non-humanised anti-IL13Rα2 antibody or other humanised anti-IL13Rα2 antibodies.
[0163] In some embodiments the humanised antibodies of the disclosure may be expressed at a higher level, or with higher productivity or yield, than an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2. In some embodiments the humanised antibodies of the disclosure may be expressed at a higher level, or with higher productivity or yield, than an antibody comprising [0164] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3 (VHA) and a light chain variable region having the amino acid sequence of SEQ ID NO: 9 (VKAback); [0165] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5 (VHAback) and a light chain variable region having the amino acid sequence of SEQ ID NO: 9 (VKAback); [0166] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6 (VHA1) and a light chain variable region having the amino acid sequence of SEQ ID NO: 4 (VKA); [0167] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6 (VHA1) and a light chain variable region having the amino acid sequence of SEQ ID NO: 9 (VKAback); [0168] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6 (VHA1) and a light chain variable region having the amino acid sequence of SEQ ID NO: 10 (VKA1); [0169] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6 (VHA1) and a light chain variable region having the amino acid sequence of SEQ ID NO: 11 (VKA2); [0170] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7 (VHA2) and a light chain variable region having the amino acid sequence of SEQ ID NO: 4 (VKA); [0171] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7 (VHA2) and a light chain variable region having the amino acid sequence of SEQ ID NO: 9 (VKAback); [0172] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7 (VHA2) and a light chain variable region having the amino acid sequence of SEQ ID NO: 10 (VKA1); [0173] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7 (VHA2) and a light chain variable region having the amino acid sequence of SEQ ID NO: 11 (VKA2); [0174] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 (VHA3) and a light chain variable region having the amino acid sequence of SEQ ID NO: 4 (VKA); [0175] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 (VHA3) and a light chain variable region having the amino acid sequence of SEQ ID NO: 9 (VKAback); and [0176] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 (VHA3) and a light chain variable region having the amino acid sequence of SEQ ID NO: 10 (VKA1).
[0177] In some embodiments the humanised antibodies of the disclosure may be expressed at a higher level, or with higher productivity or yield, than one or more of the antibodies described above when expressed in the same host cell type and cultured under the same conditions. In some embodiments the level of expression or productivity or yield may be at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100% higher than one or more of the antibodies described above when expressed in the same host cell type and cultured under the same conditions. In some embodiments the level of expression or productivity or yield may be at least 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200% higher than one or more of the antibodies described above when expressed in the same host cell type and cultured under the same conditions. Suitable means for determining the level of expression of recombinant proteins are well known to the skilled person, for example, ELISA and Western Blot techniques. In some embodiments, the level of expression/productivity/yield may be determined by the methods described in the Examples.
[0178] In some cases, when expressed in a host cell of the disclosure, the humanised antibodies of the disclosure may have a lower level of aggregation or fragmentation, as compared to a non-humanised anti-IL13Rα2 antibody or other humanised anti-IL13Rα2 antibodies. In some embodiments the humanised antibodies of the disclosure may have a lower level of aggregation or fragmentation than an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2. In some embodiments the humanised antibodies of the disclosure may have a lower level of aggregation or fragmentation than a non-humanised anti-IL13Rα2 antibody or other humanised anti-IL13Rα2 antibodies when expressed in the same host cell type and cultured under the same conditions. In some embodiments the level of aggregation or fragmentation may be at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100% lower when expressed in the same host cell type and cultured under the same conditions. In some embodiments the level of aggregation or fragmentation may be at least 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200% lower when expressed in the same host cell type and cultured under the same conditions. Suitable means for determining aggregation or fragmentation of recombinant proteins are well known to the skilled person, for example, size exclusion chromatography (SEC). In some embodiments, the level of aggregation or fragmentation may be determined by the methods described in the Examples.
Definitions
[0179] Antibody
[0180] The term “antibody” herein is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies (e.g., bispecific antibodies), intact antibodies and antibody fragments, so long as they exhibit the desired biological activity, for example, the ability to bind IL13Rα2. Antibodies may be murine, human, humanized, chimeric, or derived from other species. An antibody is a protein generated by the immune system that is capable of recognizing and binding to a specific antigen. (Janeway, C., Travers, P., Walport, M., Shlomchik (2001) Immuno Biology, 5th Ed., Garland Publishing, New York). A target antigen generally has numerous binding sites, also called epitopes, recognized by CDRs on multiple antibodies. Each antibody that specifically binds to a different epitope has a different structure. Thus, one antigen may have more than one corresponding antibody. An antibody includes a full-length immunoglobulin molecule or an immunologically active portion of a full-length immunoglobulin molecule, i.e., a molecule that contains an antigen binding site that immunospecifically binds an antigen of a target of interest or part thereof, such targets including but not limited to, cancer cell or cells that produce autoimmune antibodies associated with an autoimmune disease. The immunoglobulin can be of any type (e.g. IgG, IgE, IgM, IgD, and IgA), class (e.g. IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass, or allotype (e.g. human G1m1, G1 m2, G1 m3, non-G1 m1 [that, is any allotype other than G1m1], G1 m17, G2m23, G3m21, G3m28, G3m11, G3m5, G3m13, G3m14, G3m10, G3m15, G3m16, G3m6, G3m24, G3m26, G3m27, A2m1, A2m2, Km1, Km2 and Km3) of immunoglobulin molecule. The immunoglobulins can be derived from any species, including human, murine, or rabbit origin.
[0181] “Antibody fragments” comprise a portion of a full length antibody, generally the antigen binding or variable region thereof. Examples of antibody fragments include Fab, Fab′, F(ab′)2, and scFv fragments; diabodies; linear antibodies; fragments produced by a Fab expression library, anti-idiotypic (anti-Id) antibodies, CDR (complementary determining region), and epitope-binding fragments of any of the above which immunospecifically bind to cancer cell antigens, viral antigens or microbial antigens, single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
[0182] The term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e. the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts.
[0183] Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations which include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies. The modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al (1975) Nature 256:495, or may be made by recombinant DNA methods (see, U.S. Pat. No. 4,816,567). The monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991) Nature, 352:624-628; Marks et al. (1991) J. Mol. Biol., 222:581-597 or from transgenic mice carrying a fully human immunoglobulin system (Lonberg (2008) Curr. Opinion 20(4):450-459).
[0184] Monoclonal antibodies include “chimeric” antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; and Morrison et al (1984) Proc. Natl. Acad. Sci. USA, 81:6851-6855). Chimeric antibodies include “primatized” antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g. Old World Monkey or Ape) and human constant region sequences.
[0185] An “intact antibody” herein is one comprising VL and VH domains, as well as a light chain constant domain (CL) and heavy chain constant domains, CH1, CH2 and CH3. The constant domains may be native sequence constant domains (e.g. human native sequence constant domains) or amino acid sequence variant thereof. The intact antibody may have one or more “effector functions” which refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody. Examples of antibody effector functions include C1q binding; complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; and down regulation of cell surface receptors such as B cell receptor and BCR.
[0186] Depending on the amino acid sequence of the constant domain of their heavy chains, intact antibodies can be assigned to different “classes.” There are five major classes of intact antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into “subclasses” (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2. The heavy-chain constant domains that correspond to the different classes of antibodies are called α, δ, ε, γ, and μ, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
[0187] Humanized
[0188] As used herein “humanized” antibodies include any combination of the herein described anti-IL13Rα2 antibodies. In these antibodies framework residues from the chimeric MSAb-1 and X09.2 antibodies have been largely replaced with the corresponding residues from human immunoglobulins. As many of the human amino acid residues as possible are retained, but critical human residues may be modified as necessary to support the antigen binding site formed by the CDRs and recapitulate the antigen binding potency of the chimeric antibodies. Such changes or variations optionally and preferably retain or reduce the immunogenicity in humans or other primate species relative to non-modified antibodies.
[0189] A “humanized antibody” refers to a polypeptide comprising at least a portion of a modified variable region of a human antibody wherein a portion of the variable region, preferably a portion substantially less than the intact human variable domain, has been substituted by the corresponding sequence from a non-human species and wherein the modified variable region is linked to at least another part of another protein, preferably the constant region of a human antibody. The expression “humanized antibodies” includes human antibodies in which one or more complementarity determining region (“CDR”) amino acid residues and/or one or more framework region (“FW” or “FR”) amino acid residues are substituted by amino acid residues from analogous sites in rodent or other non-human antibodies. The expression “humanized antibody” also includes an immunoglobulin amino acid sequence variant or fragment thereof that comprises an FR having substantially the amino acid sequence of a human immunoglobulin and a CDR having substantially the amino acid sequence of a non-human immunoglobulin.
[0190] “Humanized” forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. Or, looked at another way, a humanized antibody is a human antibody that also contains selected sequences from non-human (e.g. murine) antibodies in place of the human sequences. A humanized antibody can include conservative amino acid substitutions or non-natural residues from the same or different species that do not significantly alter its binding and/or biologic activity. Such antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulins.
[0191] There are a range of humanisation techniques, including ‘CDR grafting’, ‘guided selection’, ‘deimmunization’, ‘resurfacing’ (also known as ‘veneering’), ‘composite antibodies’, ‘Human String Content Optimisation’ and framework shuffling.
[0192] CDR Grafting
[0193] In this technique, the humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient antibody are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, camel, bovine, goat, or rabbit having the desired properties (in effect, the non-human CDRs are ‘grafted’ onto the human framework). In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues (this may happen when, for example, a particular FR residue has significant effect on antigen binding).
[0194] Furthermore, humanized antibodies can comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications are made to further refine and maximize antibody performance. Thus, in general, a humanized antibody will comprise all of at least one, and in one aspect two, variable domains, in which all or all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), or that of a human immunoglobulin.
[0195] Guided Selection
[0196] The method consists of combining the VH or VL domain of a given non-human antibody specific for a particular epitope with a human VH or VL library and specific human V domains are selected against the antigen of interest. This selected human VH is then combined with a VL library to generate a completely human VH×VL combination. The method is described in Nature Biotechnology (N.Y.) 12, (1994) 899-903.
[0197] Composite Antibodies
[0198] In this method, two or more segments of amino acid sequence from a human antibody are combined within the final antibody molecule. They are constructed by combining multiple human VH and VL sequence segments in combinations which limit or avoid human T cell epitopes in the final composite antibody V regions. Where required, T cell epitopes are limited or avoided by, exchanging V region segments contributing to or encoding a T cell epitope with alternative segments which avoid T cell epitopes. This method is described in US 2008/0206239 A1.
[0199] Deimmunization
[0200] This method involves the removal of human (or other second species) T-cell epitopes from the V regions of the therapeutic antibody (or other molecule). The therapeutic antibodies V-region sequence is analysed for the presence of MHC class II-binding motifs by, for example, comparison with databases of MHC-binding motifs (such as the “motifs” database hosted at www.wehi.edu.au). Alternatively, MHC class II-binding motifs may be identified using computational threading methods such as those devised by Altuvia et al. (J. Mol. Biol. 249 244-250 (1995)); in these methods, consecutive overlapping peptides from the V-region sequences are testing for their binding energies to MHC class II proteins. This data can then be combined with information on other sequence features which relate to successfully presented peptides, such as amphipathicity, Rothbard motifs, and cleavage sites for cathepsin B and other processing enzymes.
[0201] Once potential second species (e.g. human) T-cell epitopes have been identified, they are eliminated by the alteration of one or more amino acids. The modified amino acids are usually within the T-cell epitope itself, but may also be adjacent to the epitope in terms of the primary or secondary structure of the protein (and therefore, may not be adjacent in the primary structure). Most typically, the alteration is by way of substitution but, in some circumstances amino acid addition or deletion will be more appropriate.
[0202] All alterations can be accomplished by recombinant DNA technology, so that the final molecule may be prepared by expression from a recombinant host using well established methods such as Site Directed Mutagenesis. However, the use of protein chemistry or any other means of molecular alteration is also possible.
[0203] Resurfacing
[0204] This method involves: [0205] (a) determining the conformational structure of the variable region of the non-human (e.g. rodent) antibody (or fragment thereof) by constructing a three-dimensional model of the non-human antibody variable region; [0206] (b) generating sequence alignments using relative accessibility distributions from x-ray crystallographic structures of a sufficient number of non-human and human antibody variable region heavy and light chains to give a set of heavy and light chain framework positions wherein the alignment positions are identical in 98% of the sufficient number of non-human antibody heavy and light chains; [0207] (c) defining for the non-human antibody to be humanized, a set of heavy and light chain surface exposed amino acid residues using the set of framework positions generated in step (b); [0208] (d) identifying from human antibody amino acid sequences a set of heavy and light chain surface exposed amino acid residues that is most closely identical to the set of surface exposed amino acid residues defined in step (c), wherein the heavy and light chain from the human antibody are or are not naturally paired; [0209] (e) substituting, in the amino acid sequence of the non-human antibody to be humanized, the set of heavy and light chain surface exposed amino acid residues defined in step (c) with the set of heavy and light chain surface exposed amino acid residues identified in step (d); [0210] (f) constructing a three-dimensional model of the variable region of the non-human antibody resulting from the substituting specified in step (e); [0211] (g) identifying, by comparing the three-dimensional models constructed in steps (a) and (f), any amino acid residues from the sets identified in steps (c) or (d), that are within 5 Angstroms of any atom of any residue of the complementarity determining regions of the non-human antibody to be humanized; and [0212] (h) changing any residues identified in step (g) from the human to the original non-human amino acid residue to thereby define a non-human antibody humanizing set of surface exposed amino acid residues; with the proviso that step (a) need not be conducted first, but must be conducted prior to step (g).
[0213] Superhumanization
[0214] The method compares the non-human sequence with the functional human germline gene repertoire. Those human genes encoding canonical structures identical or closely related to the non-human sequences are selected. Those selected human genes with highest homology within the CDRs are chosen as FR donors. Finally, the non-human CDRs are grafted onto these human FRs. This method is described in patent WO 2005/079479 A2.
[0215] Human String Content Optimization
[0216] This method compares the non-human (e.g. mouse) sequence with the repertoire of human germline genes and the differences are scored as Human String Content (HSC) that quantifies a sequence at the level of potential MHC/T-cell epitopes. The target sequence is then humanized by maximizing its HSC rather than using a global identity measure to generate multiple diverse humanized variants (described in Molecular Immunology, 44, (2007) 1986-1998).
[0217] Framework Shuffling
[0218] The CDRs of the non-human antibody are fused in-frame to cDNA pools encompassing all known heavy and light chain human germline gene frameworks. Humanised antibodies are then selected by e.g. panning of the phage displayed antibody library. This is described in Methods 36, 43-60 (2005).
[0219] Sequence Modifications
[0220] The sequences of the antibody heavy chain variable regions and/or the light chain variable regions disclosed herein may be modified by substitution, insertion or deletion. Amino acid sequences that are substantially the same as the sequences described herein include sequences comprising conservative amino acid substitutions, as well as amino acid deletions and/or insertions. A conservative amino acid substitution refers to the replacement of a first amino acid by a second amino acid that has chemical and/or physical properties (e.g., charge, structure, polarity, hydrophobicity/hydrophilicity) that are similar to those of the first amino acid. Preferred conservative substitutions are those wherein one amino acid is substituted for another within the groups of amino acids indicated herein below: [0221] Amino acids having polar side chains (Asp, Glu, Lys, Arg, His, Asn, Gin, Ser, Thr, Tyr, and Cys) [0222] Amino acids having non-polar side chains (Gly, Ala, Val, Leu, Ile, Phe, Trp, Pro, and Met) [0223] Amino acids having aliphatic side chains (Gly, Ala Val, Leu, Ile) [0224] Amino acids having cyclic side chains (Phe, Tyr, Trp, His, Pro) [0225] Amino acids having aromatic side chains (Phe, Tyr, Trp) [0226] Amino acids having acidic side chains (Asp, Glu) [0227] Amino acids having basic side chains (Lys, Arg, His) [0228] Amino acids having amide side chains (Asn, Gln) [0229] Amino acids having hydroxy side chains (Ser, Thr) [0230] Amino acids having sulphur-containing side chains (Cys, Met), [0231] Neutral, weakly hydrophobic amino acids (Pro, Ala, Gly, Ser, Thr) [0232] Hydrophilic, acidic amino acids (Gin, Asn, Glu, Asp), and [0233] Hydrophobic amino acids (Leu, Ile, Val)
[0234] Particular preferred conservative amino acids substitution groups are: Val-Leu-Ile, Phe-Tyr, Lys-Arg, Ala-Val, and Asn-Gln.
[0235] In some embodiments, the antibodies of the disclosure may comprise a heavy chain having an amino acid sequence with 80% or more amino acid sequence identity (for example, about 85% or more, 86% or more, 87% or more, 88% or more, 89% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more sequence identity) to a heavy chain described herein. In some embodiments, the antibodies of the disclosure may comprise a light chain having an amino acid sequence with 80% or more amino acid sequence identity (for example, about 85% or more, 86% or more, 87% or more, 88% or more, 89% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more sequence identity) to a light chain described herein.
[0236] In some embodiments, the antibodies of the disclosure may comprise a heavy chain having an amino acid sequence identical to the amino acid sequence of a heavy chain described herein, except that it includes 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid modifications (e.g., substitutions, insertions and/or deletions) relative to the amino acid sequence of the heavy chain described herein. In some embodiments, the antibodies of the disclosure may comprise a light chain having an amino acid sequence identical to the amino acid sequence of a light chain described herein, except that it includes 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid modifications (e.g., substitutions, insertions and/or deletions) relative to the amino acid sequence of the light chain described herein.
[0237] Antibody production Humanized antibodies, fragments and regions can be produced by cloning DNA segments encoding the H and L chain antigen-binding regions of the anti-IL13Rα2 antibody, and joining these DNA segments to DNA segments including CH and CL regions, respectively, to produce full length immunoglobulin-encoding genes.
[0238] For full-length antibody molecules, the immunoglobulin cDNAs can be obtained from mRNA of hybridoma cell lines. Antibody heavy and light chains are cloned in a mammalian expression vector system. Assembly is documented with DNA sequence analysis. The antibody construct can be expressed in human or other mammalian host cell lines. The construct can be validated by transient transfection assays and immunoassay of the expressed antibody. Stable cell lines with the highest productivity can be isolated and screened using rapid assay methods.
[0239] Methods of Treatment
[0240] The antibodies and conjugates of the present disclosure may be used in a method of therapy. Also provided is a method of treatment, comprising administering to a subject in need of treatment a therapeutically-effective amount of an antibody or conjugate compound of the invention. The term “therapeutically effective amount” is an amount sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g. decisions on dosage, is within the responsibility of general practitioners and other medical doctors.
[0241] Antibodies and conjugates of the disclosure may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated. Examples of treatments and therapies include, but are not limited to, chemotherapy (the administration of active agents, including, e.g. drugs, such as chemotherapeutics); surgery; and radiation therapy.
[0242] A “chemotherapeutic agent” is a chemical compound useful in the treatment of cancer, regardless of mechanism of action. Classes of chemotherapeutic agents include, but are not limited to: alkylating agents, antimetabolites, spindle poison plant alkaloids, cytotoxic/antitumor antibiotics, topoisomerase inhibitors, antibodies, photosensitizers, and kinase inhibitors. Chemotherapeutic agents include compounds used in “targeted therapy” and conventional chemotherapy.
[0243] Examples of chemotherapeutic agents include: erlotinib (TARCEVA®, Genentech/OSI Pharm.), docetaxel (TAXOTERE®, Sanofi-Aventis), 5-FU (fluorouracil, 5-fluorouracil, CAS No. 51-21-8), gemcitabine (GEMZAR®, Lilly), PD-0325901 (CAS No. 391210-10-9, Pfizer), cisplatin (cis-diamine, dichloroplatinum(II), CAS No. 15663-27-1), carboplatin (CAS No. 41575-94-4), paclitaxel (TAXOL®, Bristol-Myers Squibb Oncology, Princeton, N.J.), trastuzumab (HERCEPTIN®, Genentech), temozolomide (4-methyl-5-oxo-2,3,4,6,8-pentazabicyclo [4.3.0] nona-2,7,9-triene-9-carboxamide, CAS No. 85622-93-1, TEMODAR®, TEMODAL®, Schering Plough), tamoxifen ((Z)-2-[4-(1,2-diphenylbut-1-enyl)phenoxy]-N,N-dimethylethanamine, NOLVADEX®, ISTUBAL®, VALODEX®), and doxorubicin (ADRIAMYCIN®), Akti-1/2, HPPD, and rapamycin.
[0244] More examples of chemotherapeutic agents include: oxaliplatin (ELOXATIN®, Sanofi), bortezomib (VELCADE®, Millennium Pharm.), sutent (SUNITINIB®, SU11248, Pfizer), letrozole (FEMARA®, Novartis), imatinib mesylate (GLEEVEC®, Novartis), XL-518 (Mek inhibitor, Exelixis, WO 2007/044515), ARRY-886 (Mek inhibitor, AZD6244, Array BioPharma, Astra Zeneca), SF-1126 (PI3K inhibitor, Semafore Pharmaceuticals), BEZ-235 (PI3K inhibitor, Novartis), XL-147 (PI3K inhibitor, Exelixis), PTK787/ZK 222584 (Novartis), fulvestrant (FASLODEX®, AstraZeneca), leucovorin (folinic acid), rapamycin (sirolimus, RAPAMUNE®, Wyeth), lapatinib (TYKERB®, GSK572016, Glaxo Smith Kline), lonafarnib (SARASAR™, SCH 66336, Schering Plough), sorafenib (NEXAVAR®, BAY43-9006, Bayer Labs), gefitinib (IRESSA®, AstraZeneca), irinotecan (CAMPTOSAR®, CPT-11, Pfizer), tipifarnib (ZARNESTRA™, Johnson & Johnson), ABRAXANE™ (Cremophor-free), albumin-engineered nanoparticle formulations of paclitaxel (American Pharmaceutical Partners, Schaumberg, II), vandetanib (rINN, ZD6474, ZACTIMA®, AstraZeneca), chloranmbucil, AG1478, AG1571 (SU 5271; Sugen), temsirolimus (TORISEL®, Wyeth), pazopanib (GlaxoSmithKline), canfosfamide (TELCYTA®, Telik), thiotepa and cyclosphosphamide (CYTOXAN®, NEOSAR®); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphoramide and trimethylomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analog topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogs); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogs, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, chlorophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosoureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g. calicheamicin, calicheamicin gamma1I, calicheamicin omegal1 (Angew Chem. Intl. Ed. Engl. (1994) 33:183-186); dynemicin, dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, nemorubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogs such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfornithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products, Eugene, Oreg.); razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2′,2″-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (“Ara-C”); cyclophosphamide; thiotepa; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; vinorelbine (NAVELBINE®); novantrone; teniposide; edatrexate; daunomycin; aminopterin; capecitabine (XELODA®, Roche); ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; and pharmaceutically acceptable salts, acids and derivatives of any of the above.
[0245] Also included in the definition of “chemotherapeutic agent” are: (i) anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX®; tamoxifen citrate), raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and FARESTON® (torernifine citrate); (ii) aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASE® (megestrol acetate), AROMASIN® (exemestane; Pfizer), formestanie, fadrozole, RIVISOR® (vorozole), FEMARA® (letrozole; Novartis), and ARIMIDEX® (anastrozole; AstraZeneca); (iii) anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; as well as troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); (iv) protein kinase inhibitors such as MEK inhibitors (WO 2007/044515); (v) lipid kinase inhibitors; (vi) antisense oligonucleotides, particularly those which inhibit expression of genes in signaling pathways implicated in aberrant cell proliferation, for example, PKC-alpha, Raf and H-Ras, such as oblimersen (GENASENSE®, Genta Inc.); (vii) ribozymes such as VEGF expression inhibitors (e.g., ANGIOZYME®) and HER2 expression inhibitors; (viii) vaccines such as gene therapy vaccines, for example, ALLOVECTIN®, LEUVECTIN®, and VAXID®; PROLEUKIN® rIL-2; topoisomerase 1 inhibitors such as LURTOTECAN®; ABARELIX® rmRH; (ix) anti-angiogenic agents such as bevacizumab (AVASTIN®, Genentech); and pharmaceutically acceptable salts, acids and derivatives of any of the above.
[0246] Also included in the definition of “chemotherapeutic agent” are therapeutic antibodies such as alemtuzumab (Campath), bevacizumab (AVASTIN®, Genentech); cetuximab (ERBITUX®, ImoIone); panitumumab (VECTIBIX®, Amgen), rituximab (RITUXAN®, Genentech/Biogen Idec), ofatumumab (ARZERRA®, GSK), pertuzumab (PERJETA™, OMNITARG™, 2C4, Genentech), trastuzumab (HERCEPTIN®, Genentech), tositumomab (Bexxar, Corixia), and the antibody drug conjugate, gemtuzumab ozogamicin (MYLOTARG®, Wyeth).
[0247] Humanized monoclonal antibodies with therapeutic potential as chemotherapeutic agents include: alemtuzumab, apolizumab, aselizumab, atlizumab, bapineuzumab, bevacizumab, bivatuzumab mertansine, cantuzumab mertansine, cedelizumab, certolizumab pegol, cidfusituzumab, cidtuzumab, daclizumab, eculizumab, efalizumab, epratuzumab, erlizumab, felvizumab, fontolizumab, gemtuzumab ozogamicin, inotuzumab ozogamicin, ipilimumab, labetuzumab, lintuzumab, matuzumab, mepolizumab, motavizumab, motovizumab, natalizumab, nimotuzumab, nolovizumab, numavizumab, ocrelizumab, omalizumab, palivizumab, pascolizumab, pecfusituzumab, pectuzumab, pertuzumab, pexelizumab, ralivizumab, ranibizumab, reslivizumab, reslizumab, resyvizumab, rovelizumab, ruplizumab, sibrotuzumab, siplizumab, sontuzumab, tacatuzumab tetraxetan, tadocizumab, talizumab, tefibazumab, tocilizumab, toralizumab, trastuzumab, tucotuzumab celmoleukin, tucusituzumab, umavizumab, urtoxazumab, and visilizumab.
[0248] Pharmaceutical compositions according to the present disclosure, and for use in accordance with the present disclosure, may comprise, in addition to the active ingredient, i.e. an antibody or conjugate compound of the disclosure, a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material will depend on the route of administration, which may be oral, or by injection, e.g. cutaneous, subcutaneous, or intravenous.
[0249] Pharmaceutical compositions for oral administration may be in tablet, capsule, powder or liquid form. A tablet may comprise a solid carrier or an adjuvant. Liquid pharmaceutical compositions generally comprise a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included. A capsule may comprise a solid carrier such a gelatin.
[0250] For intravenous, cutaneous or subcutaneous injection, or injection at the site of affliction, the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringers Injection, Lactated Ringers Injection. Preservatives, stabilisers, buffers, antioxidants and/or other additives may be included, as required.
[0251] The term “treatment,” as used herein in the context of treating a condition, pertains generally to treatment and therapy, whether of a human or an animal (e.g., in veterinary applications), in which some desired therapeutic effect is achieved, for example, the inhibition of the progress of the condition, and includes a reduction in the rate of progress, a halt in the rate of progress, regression of the condition, amelioration of the condition, and cure of the condition. Treatment as a prophylactic measure (i.e., prophylaxis, prevention) is also included.
[0252] The term “therapeutically-effective amount,” as used herein, pertains to that amount of an active compound, or a material, composition or dosage from comprising an active compound, which is effective for producing some desired therapeutic effect, commensurate with a reasonable benefit/risk ratio, when administered in accordance with a desired treatment regimen.
[0253] Similarly, the term “prophylactically-effective amount,” as used herein, pertains to that amount of an active compound, or a material, composition or dosage from comprising an active compound, which is effective for producing some desired prophylactic effect, commensurate with a reasonable benefit/risk ratio, when administered in accordance with a desired treatment regimen.
[0254] Use
[0255] The antibodies of the disclosure may be used to target a target location. The target location may preferably be a proliferative cell population.
[0256] The antibodies of the disclosure are antibodies for an antigen present on a proliferative cell population. In some embodiments the antigen is absent or present at a reduced level in a non proliferative cell population compared to the amount of antigen present in the proliferative cell population, for example a tumour cell population.
[0257] The target location may be in vitro, in vivo or ex vivo.
[0258] The antibodies of the disclosure include those with utility for anticancer activity. Thus, the present disclosure provides a humanised antibody as described herein for use in therapy. The present disclosure also provides a humanised antibody as described herein for use in the treatment of a proliferative disease. Similarly, the present disclosure provides the use of a humanised antibody as described herein in the manufacture of a medicament for treating a proliferative disease.
[0259] Also provided by the disclosure are antibody drug conjugates comprising a humanised antibody as described herein conjugated to a drug moiety. Such conjugates include those with utility for anticancer activity. In particular, the conjugates of the disclosure include an antibody conjugated, i.e. covalently attached by a linker, to a drug moiety, which may be a toxin. When the drug is not conjugated to an antibody, the drug has a cytotoxic effect. The biological activity of the drug moiety is thus modulated by conjugation to an antibody. The antibody-drug conjugates (ADC) of the disclosure may selectively deliver an effective dose of a cytotoxic agent to tumor tissue whereby greater selectivity, i.e. a lower efficacious dose, may be achieved.
[0260] Thus, the present disclosure provides a conjugate compound as described herein for use in therapy. The present disclosure also provides provides a conjugate compound as described herein for use in the treatment of a proliferative disease, and the use of a conjugate compound as described herein in the manufacture of a medicament for treating a proliferative disease.
[0261] One of ordinary skill in the art is readily able to determine whether or not a candidate conjugate treats a proliferative condition for any particular cell type.
[0262] The term “proliferative disease” pertains to an unwanted or uncontrolled cellular proliferation of excessive or abnormal cells which is undesired, such as, neoplastic or hyperplastic growth, whether in vitro or in vivo. Examples of proliferative conditions include, but are not limited to, benign, pre malignant, and malignant cellular proliferation, including but not limited to, neoplasms and tumours (e.g. histocytoma, glioma, astrocyoma, osteoma), cancers (e.g. lung cancer, small cell lung cancer, gastrointestinal cancer, bowel cancer, colon cancer, breast carinoma, ovarian carcinoma, prostate cancer, testicular cancer, liver cancer, kidney cancer, bladder cancer, pancreas cancer, brain cancer, sarcoma, osteosarcoma, Kaposi's sarcoma, melanoma), lymphomas, leukemias, psoriasis, bone diseases, fibroproliferative disorders (e.g. of connective tissues), and atherosclerosis.
[0263] Any type of cell may be treated, including but not limited to, lung, gastrointestinal (including, e.g. bowel, colon), breast (mammary), ovarian, prostate, liver (hepatic), kidney (renal), bladder, pancreas, brain, and skin.
[0264] Disorders of particular interest include, but are not limited to cancers, including metastatic cancers and metastatic cancer cells, such as circulating tumour cells, which may be found circulating in body fluids such as blood or lymph. Cancers of particular interest include lung cancer, breast cancer, pancreatic cancer, ovarian cancer, renal cancer, head and neck cancer, mesothelioma, glioblastoma, melanomas, and brain tumors such as but not limited to gliomas, medulloblastoma, astrocytoma and ependymoma.
[0265] Other disorders of interest include any condition in which IL13Rα2 is overexpressed, or wherein IL-13Rα2 antagonism will provide a clinical benefit—for example in inflammatory conditions such as but not limited to inflammatory bowel disease and fibrosis.
[0266] It is contemplated that the antibodies and antibody-drug conjugates (ADC) of the present invention may be used to treat various diseases or disorders, e.g. characterized by the overexpression of a tumor antigen. Exemplary conditions or hyperproliferative disorders include benign or malignant tumors; leukemia, haematological, and lymphoid malignancies. Others include neuronal, glial, astrocytal, hypothalamic, glandular, macrophagal, epithelial, stromal, blastocoelic, inflammatory, angiogenic and immunologic, including autoimmune, disorders.
[0267] Generally, the disease or disorder to be treated is a hyperproliferative disease such as cancer. Examples of cancer to be treated herein include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g. epithelial squamous cell cancer), lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
[0268] Autoimmune diseases for which the ADC compounds may be used in treatment include rheumatologic disorders (such as, for example, rheumatoid arthritis, Sjögren's syndrome, scleroderma, lupus such as SLE and lupus nephritis, polymyositis/dermatomyositis, cryoglobulinemia, anti-phospholipid antibody syndrome, and psoriatic arthritis), osteoarthritis, autoimmune gastrointestinal and liver disorders (such as, for example, inflammatory bowel diseases (e.g. ulcerative colitis and Crohn's disease), autoimmune gastritis and pernicious anemia, autoimmune hepatitis, primary biliary cirrhosis, primary sclerosing cholangitis, and celiac disease), vasculitis (such as, for example, ANCA-associated vasculitis, including Churg-Strauss vasculitis, Wegener's granulomatosis, and polyarteriitis), autoimmune neurological disorders (such as, for example, multiple sclerosis, opsoclonus myoclonus syndrome, myasthenia gravis, neuromyelitis optica, Parkinson's disease, Alzheimer's disease, and autoimmune polyneuropathies), renal disorders (such as, for example, glomerulonephritis, Goodpasture's syndrome, and Berger's disease), autoimmune dermatologic disorders (such as, for example, psoriasis, urticaria, hives, pemphigus vulgaris, bullous pemphigoid, and cutaneous lupus erythematosus), hematologic disorders (such as, for example, thrombocytopenic purpura, thrombotic thrombocytopenic purpura, post-transfusion purpura, and autoimmune hemolytic anemia), atherosclerosis, uveitis, autoimmune hearing diseases (such as, for example, inner ear disease and hearing loss), Behcet's disease, Raynaud's syndrome, organ transplant, and autoimmune endocrine disorders (such as, for example, diabetic-related autoimmune diseases such as insulin-dependent diabetes mellitus (IDDM), Addison's disease, and autoimmune thyroid disease (e.g. Graves' disease and thyroiditis)). More preferred such diseases include, for example, rheumatoid arthritis, ulcerative colitis, ANCA-associated vasculitis, lupus, multiple sclerosis, Sjögren's syndrome, Graves' disease, IDDM, pernicious anemia, thyroiditis, and glomerulonephritis.
[0269] Formulations
[0270] While it is possible for the antibodies and conjugate compounds of the disclosure to be used (e.g., administered) alone, it is often preferable to present it as a composition or formulation.
[0271] In some embodiments, the composition is a pharmaceutical composition (e.g., formulation, preparation, medicament) comprising an antibody or conjugate compound as described herein, and a pharmaceutically acceptable carrier, diluent, or excipient.
[0272] In some embodiments the composition is a pharmaceutical composition comprising at least one antibody or conjugate compound as described herein, together with one or more other pharmaceutically acceptable ingredients well known to those skilled in the art, including, but not limited to, pharmaceutically acceptable carriers, diluents, excipients, adjuvants, fillers, buffers, preservatives, anti-oxidants, lubricants, stabilisers, solubilisers, surfactants (e.g., wetting agents), masking agents, colouring agents, flavouring agents, and sweetening agents.
[0273] In some embodiments, the composition may further comprise other active agents, for example, other therapeutic or prophylactic agents. Suitable carriers, diluents, excipients, etc. can be found in standard pharmaceutical texts. See, for example, Handbook of Pharmaceutical Additives, 2nd Edition (eds. M. Ash and I. Ash), 2001 (Synapse Information Resources, Inc., Endicott, N.Y., USA), Remington's Pharmaceutical Sciences, 20th edition, pub. Lippincott, Williams & Wilkins, 2000; and Handbook of Pharmaceutical Excipients, 2nd edition, 1994.
[0274] Also disclosed are methods of making a pharmaceutical composition comprising admixing at least one [11C]-radiolabelled conjugate or conjugate-like compound, as defined herein, together with one or more other pharmaceutically acceptable ingredients well known to those skilled in the art, e.g., carriers, diluents, excipients, etc. If formulated as discrete units (e.g., tablets, etc.), each unit contains a predetermined amount (dosage) of the active compound.
[0275] The term “pharmaceutically acceptable,” as used herein, pertains to compounds, ingredients, materials, compositions, dosage forms, etc., which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of the subject in question (e.g., human) without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio. Each carrier, diluent, excipient, etc. must also be “acceptable” in the sense of being compatible with the other ingredients of the formulation.
[0276] The formulations of the disclosure may be prepared by any methods well known in the art of pharmacy. Such methods include the step of bringing into association the active compound with a carrier which constitutes one or more accessory ingredients. In general, the formulations are prepared by uniformly and intimately bringing into association the active compound with carriers (e.g., liquid carriers, finely divided solid carrier, etc.), and then shaping the product, if necessary.
[0277] The formulation may be prepared to provide for rapid or slow release; immediate, delayed, timed, or sustained release; or a combination thereof.
[0278] Formulations suitable for parenteral administration (e.g., by injection), include aqueous or non-aqueous, isotonic, pyrogen-free, sterile liquids (e.g., solutions, suspensions), in which the active ingredient is dissolved, suspended, or otherwise provided (e.g., in a liposome or other microparticulate). Such liquids may additional contain other pharmaceutically acceptable ingredients, such as anti-oxidants, buffers, preservatives, stabilisers, bacteriostats, suspending agents, thickening agents, and solutes which render the formulation isotonic with the blood (or other relevant bodily fluid) of the intended recipient. Examples of excipients include, for example, water, alcohols, polyols, glycerol, vegetable oils, and the like. Examples of suitable isotonic carriers for use in such formulations include Sodium Chloride Injection, Ringers Solution, or Lactated Ringers Injection. Typically, the concentration of the active ingredient in the liquid is from about 1 ng/ml to about 10 μg/ml, for example from about 10 ng/ml to about 1 μg/ml. The formulations may be presented in unit-dose or multi-dose sealed containers, for example, ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules, and tablets.
[0279] Dosage
[0280] It will be appreciated by one of skill in the art that appropriate dosages of the cantibodies, conjugate compounds, and compositions of the disclosure can vary from patient to patient. Determining the optimal dosage will generally involve the balancing of the level of therapeutic benefit against any risk or deleterious side effects. The selected dosage level will depend on a variety of factors including, but not limited to, the activity of the particular compound, the route of administration, the time of administration, the rate of excretion of the compound, the duration of the treatment, other drugs, compounds, and/or materials used in combination, the severity of the condition, and the species, sex, age, weight, condition, general health, and prior medical history of the patient. The amount of compound and route of administration will ultimately be at the discretion of the physician, veterinarian, or clinician, although generally the dosage will be selected to achieve local concentrations at the site of action which achieve the desired effect without causing substantial harmful or deleterious side-effects.
[0281] Administration can be effected in one dose, continuously or intermittently (e.g., in divided doses at appropriate intervals) throughout the course of treatment. Methods of determining the most effective means and dosage of administration are well known to those of skill in the art and will vary with the formulation used for therapy, the purpose of the therapy, the target cell(s) being treated, and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician, veterinarian, or clinician.
[0282] In general, a suitable dose of the active compound is in the range of about 100 ng to about 25 mg (more typically about 1 μg to about 10 mg) per kilogram body weight of the subject per day. Where the active compound is a salt, an ester, an amide, a prodrug, or the like, the amount administered is calculated on the basis of the parent compound and so the actual weight to be used is increased proportionately.
[0283] In one embodiment, the active compound is administered to a human patient according to the following dosage regime: about 100 mg, 3 times daily.
[0284] In one embodiment, the active compound is administered to a human patient according to the following dosage regime: about 150 mg, 2 times daily.
[0285] In one embodiment, the active compound is administered to a human patient according to the following dosage regime: about 200 mg, 2 times daily.
[0286] However in one embodiment, the conjugate compound is administered to a human patient according to the following dosage regime: about 50 or about 75 mg, 3 or 4 times daily.
[0287] In one embodiment, the conjugate compound is administered to a human patient according to the following dosage regime: about 100 or about 125 mg, 2 times daily.
[0288] The dosage amounts described above may apply to the antibody, conjugate (including the drug moiety and the linker to the antibody) or to the effective amount of drug compound provided, for example the amount of compound that is releasable after cleavage of the linker.
[0289] For the prevention or treatment of disease, the appropriate dosage will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the molecule is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The molecule is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, about 1 μg/kg to 15 mg/kg (e.g. 0.1-20 mg/kg) of molecule is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. A typical daily dosage might range from about 1 μg/kg to 100 mg/kg or more, depending on the factors mentioned above. An exemplary dosage of ADC to be administered to a patient is in the range of about 0.1 to about 10 mg/kg of patient weight. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of disease symptoms occurs. An exemplary dosing regimen comprises a course of administering an initial loading dose of about 4 mg/kg, followed by additional doses every week, two weeks, or three weeks of an ADC. Other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
[0290] Subject/Patient
[0291] The subject/patient may be an animal, mammal, a placental mammal, a marsupial (e.g., kangaroo, wombat), a monotreme (e.g., duckbilled platypus), a rodent (e.g., a guinea pig, a hamster, a rat, a mouse), murine (e.g., a mouse), a lagomorph (e.g., a rabbit), avian (e.g., a bird), canine (e.g., a dog), feline (e.g., a cat), equine (e.g., a horse), porcine (e.g., a pig), ovine (e.g., a sheep), bovine (e.g., a cow), a primate, simian (e.g., a monkey or ape), a monkey (e.g., marmoset, baboon), an ape (e.g., gorilla, chimpanzee, orangutang, gibbon), or a human.
[0292] Furthermore, the subject/patient may be any of its forms of development, for example, a foetus. In one preferred embodiment, the subject/patient is a human.
Embodiments
[0293] The present disclosure provides anti-IL13Rα2 antibodies. Specifically contemplated embodiments of the antibodies of the disclosure include:
[0294] An antibody that binds to Interleukin-13 receptor subunit alpha-2 (IL13Rα2), comprising a heavy chain comprising the complementarity determining regions (CDRs) shown in SEQ ID NO:13, SEQ ID NO: 14 and SEQ ID: NO 15; and/or a light chain comprising (i) the CDRs shown in SEQ ID NO:16, SEQ ID NO: 17 and SEQ ID: NO 18; and (ii) a serine residue at position 30 (numbering with reference to SEQ ID NO: 3), wherein the variable regions are fully human. In one embodiment the antibody is fully human, including the constant regions. In a related embodiment the present invention provides an antibody conjugate comprising said antibody and pyrollobenzodiazepine dimer. In one embodiment the light chain is a human kappa light chain.
[0295] An antibody that binds to Interleukin-13 receptor subunit alpha-2 (IL13Rα2), wherein the antibody comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 3; SEQ ID NO: 5; SEQ ID NO: 6; SEQ ID NO: 7; and SEQ ID NO: 8. In some such embodiments, the antibody further comprises a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and/or a VL CDR3 with the amino acid sequence of SEQ ID NO. 18. In some embodiments, the antibody further comprises a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18. In some embodiments the variable regions are fully human. In some embodiments the antibody is fully human. For example, any constant regions comprised in the antibody may also be fully human antibody.
[0296] Thus, in some embodiments, the antibody comprises: [0297] (i) a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 3, and a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18, optionally wherein the variable domains and/or the antibody is fully human; [0298] (ii) a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 5, and a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18, optionally wherein the variable domains and/or the antibody is fully human; [0299] (iii) a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 6, and a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18, optionally wherein the variable domains and/or the antibody is fully human; [0300] (iv) a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 7, and a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18, optionally wherein the variable domains and/or the antibody is fully human; or [0301] (v) a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 8, and a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18, optionally wherein the variable domains and/or the antibody is fully human.
[0302] In some embodiments, the antibody further comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 4; SEQ ID NO: 9; SEQ ID NO: 10; SEQ ID NO: 11.
[0303] An antibody that binds to Interleukin-13 receptor subunit alpha-2 (IL13Rα2), wherein the antibody comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 4; SEQ ID NO: 9; SEQ ID NO: 10; SEQ ID NO: 11. In some such embodiments, the antibody further comprises a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and/or a VH CDR3 with the amino acid sequence of SEQ ID NO. 15. In some embodiments, the antibody further comprises a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 with the amino acid sequence of SEQ ID NO. 15. In some embodiments the variable regions are fully human. In some embodiments the antibody is fully human. For example, any constant regions comprised in the antibody may also be fully human antibody.
[0304] Thus, in some embodiments, the antibody comprises: [0305] (i) a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 with the amino acid sequence of SEQ ID NO. 15, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 4, optionally wherein the variable domains and/or the antibody is fully human; [0306] (ii) a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 with the amino acid sequence of SEQ ID NO. 15, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 9, optionally wherein the variable domains and/or the antibody is fully human; [0307] (iii) a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 with the amino acid sequence of SEQ ID NO. 15, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 10, optionally wherein the variable domains and/or the antibody is fully human; [0308] (iv) a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 with the amino acid sequence of SEQ ID NO. 15, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 11, optionally wherein the variable domains and/or the antibody is fully human.
[0309] In some embodiments, the antibody further comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 3; SEQ ID NO: 5; SEQ ID NO: 6; SEQ ID NO: 7; and SEQ ID NO: 8.
[0310] Thus, specifically contemplated antibodies of the disclosure include those which comprise: [0311] i) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0312] ii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0313] iii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0314] iv) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0315] v) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0316] vi) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0317] vii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0318] viii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0319] ix) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0320] x) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0321] xi) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0322] xii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0323] xiii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0324] xiv) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0325] xv) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0326] xvi) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0327] xvii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0328] xviii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0329] xix) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; and [0330] xx) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11.
[0331] Preferred antibodies of the disclosure include those which comprise: [0332] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3 (VHA; HuCL47 VH), and a light chain variable region having the amino acid sequence of SEQ ID NO: 4 (VKA; HuCL47 VL); [0333] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5 (VHAback), and a light chain variable region having the amino acid sequence of SEQ ID NO: 4 (VKA; HuCL47 VL); and [0334] a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 (VHA3), and a light chain variable region having the amino acid sequence of SEQ ID NO: 11 (VKA2).
[0335] Particularly preferred antibodies of the disclosure include those which comprise a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4.
[0336] The features disclosed in the foregoing description, or in the following claims, or in the accompanying drawings, expressed in their specific forms or in terms of a means for performing the disclosed function, or a method or process for obtaining the disclosed results, as appropriate, may, separately, or in any combination of such features, be utilised for realising the invention in diverse forms thereof.
[0337] While the invention has been described in conjunction with the exemplary embodiments described above, many equivalent modifications and variations will be apparent to those skilled in the art when given this disclosure. Accordingly, the exemplary embodiments of the invention set forth above are considered to be illustrative and not limiting. Various changes to the described embodiments may be made without departing from the spirit and scope of the invention.
[0338] For the avoidance of any doubt, any theoretical explanations provided herein are provided for the purposes of improving the understanding of a reader. The inventors do not wish to be bound by any of these theoretical explanations.
[0339] Any section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.
[0340] Throughout this specification, including the claims which follow, unless the context requires otherwise, the word “comprise” and “include”, and variations such as “comprises”, “comprising”, and “including” will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integers or steps.
[0341] It must be noted that, as used in the specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. Ranges may be expressed herein as from “about” one particular value, and/or to “about” another particular value. When such a range is expressed, another embodiment includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by the use of the antecedent “about,” it will be understood that the particular value forms another embodiment. The term “about” in relation to a numerical value is optional and means for example +/−10%.
TABLE-US-00001 SEQUENCES SEQ ID NO: 1 [murine CL47 VH, CDR underline] QVQLQQPGAELVRPGASVKLSCKASGYTFSNYLMNWVKQRPEQDLDWIGRI DPYDGDIDYNQNFKDKAILTVDKSSSTAYMQLSSLTSEDSAVYYCARGYGT AYGVDYWGQGTSVTVSS SEQ ID NO: 2 [murine CL47 VL, CDR underline] DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQKPGQPPKLL IYAASRQGSGVPARFSGSGSGTDFSLNIHPMEEDDTAMYFCQQSKEVPWTF GGGTKLEIK SEQ ID NO: 3 [HuCL47 VH (Clone 47 VHA), CDR underline] QVQLVQSGAEVKKPGASVKVSCKASGYTFSNYLMNWVRQAPGQGLEWMGRI DPYDGDIDYNQNFKDRVTITRDTSASTAYMELSSLRSEDTAVYYCARGYGT AYGVDYWGQGTSVTVSS SEQ ID NO: 4 [HuCL47 VL (Clone 47 VKA), CDR underline] EIVLIQSPATLSLSPGERATLSCRASESVDNYGISFMNWYQQKPGQAPRLL IYAASRQGSGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQSKEVPWTF GGGTKLEIK SEQ ID NO: 5 [Clone 47 VHAback, CDR underline] QVQLVQSGAEVKKPGASVKVSCKASGYTFSNYLMNWVRQAPGQGLEWIGRI DPYDGDIDYNQNFKDRATLTVDKSASTAYMELSSLRSEDTAVYYCARGYGT AYGVDYWGQGTSVTVSS SEQ ID NO: 6 [Clone 47 VHA1, CDR underline] QVQLVQSGAEVKKPGASVKVSCKASGYTFSNYLMNWVRQAPGQGLEWIGRI DPYDGDIDYNQNFKDRVTITRDTSASTAYMELSSLRSEDTAVYYCARGYGT AYGVDYWGQGTSVTVSS SEQ ID NO: 7 [Clone 47 VHA2, CDR underline] QVQLVQSGAEVKKPGASVKVSCKASGYTFSNYLMNWVRQAPGQGLEWMGRI DPYDGDIDYNQNFKDRVTITVDTSASTAYMELSSLRSEDTAVYYCARGYGT AYGVDYWGQGTSVTVSS SEQ ID NO: 8 [Clone 47 VHA3, CDR underline] QVQLVQSGAEVKKPGASVKVSCKASGYTFSNYLMNWVRQAPGQGLEWMGRI DPYDGDIDYNQNFKDRVTITRDKSASTAYMELSSLRSEDTAVYYCARGYGT AYGVDYWGQGTSVTVSS SEQ ID NO: 9 [Clone 47 VKAback, CDR underline] EIVLTQSPATLSLSPGERATLSCRASESVDNYGISFMNWFQQKPGQAPRLL IYAASRQGSGIPDRFSGSGSGTDFTLTISRLEPEDFAVYFCQQSKEVPWTF GGGTKLEIK SEQ ID NO: 10 [Clone 47 VKA1, CDR underline] EIVLTQSPATLSLSPGERATLSCRASESVDNYGISFMNWFQQKPGQAPRLL IYAASRQGSGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQSKEVPWTF GGGTKLEIK SEQ ID NO: 11 [Clone 47 VKA2, CDR underline] EIVLTQSPATLSLSPGERATLSCRASESVDNYGISFMNWYQQKPGQAPRLL IYAASRQGSGIPDRFSGSGSGTDFTLTISRLEPEDFAVYFCQQSKEVPWTF GGGTKLEIK SEQ ID NO: 12 [Extracellular domain (27-343) of Human IL13RA2 (Uniprot Q14627)] DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNIG SETWKTIITKNLHYKDGFDLNKGIEAKIHILLPWQCTNGSEVQSSWAETTY WISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLD HALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTF QLQNIVKPLPPVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDT TLVTATVENETYTLKTTNETRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWE GEDLSKKILLRhhhhhh Hhhhhh = C-terminal His Tag SEQ ID NO: 13 CDRH1 NYLMN SEQ ID NO: 14 CDRH2 RIDPYDGDIDYNQNFKD SEQ ID NO: 15 CDRH3 GYGTAYGVDY SEQ ID NO: 16 CDRL1 RASESVDNYGISFMN SEQ ID NO: 17 CDRL2 AASRQGS SEQ ID NO: 18 CDRL3 QQSKEVPWT
STATEMENTS OF DISCLOSURE
[0342] The following numbered statements, outlining aspects of the present disclosure, are part of the description.
[0343] 101. An antibody that binds to Interleukin-13 receptor subunit alpha-2 (IL13Rα2), wherein the antibody comprises: [0344] a heavy chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 3; SEQ ID NO: 5; SEQ ID NO: 6; SEQ ID NO: 7; and SEQ ID NO: 8; and [0345] a light chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 4; SEQ ID NO: 9; SEQ ID NO: 10; SEQ ID NO: 11.
[0346] 102. The antibody according to statement 101, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 3, and: [0347] (i) a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0348] (ii) a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0349] (iii) a light chain variable region having the amino acid sequence of SEQ ID NO: 10; or [0350] (iv) a light chain variable region having the amino acid sequence SEQ ID NO: 11.
[0351] 103. The antibody according to statement 101, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 5, and: [0352] (i) a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0353] (ii) a light chain variable region having the amino acid sequence of SEQ ID NO: 9; (iii) a light chain variable region having the amino acid sequence of SEQ ID NO: 10; or [0354] (iv) a light chain variable region having the amino acid sequence SEQ ID NO: 11.
[0355] 104. The antibody according to statement 101, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 6, and: [0356] (i) a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0357] (ii) a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0358] (iii) a light chain variable region having the amino acid sequence of SEQ ID NO: 10; or [0359] (iv) a light chain variable region having the amino acid sequence SEQ ID NO: 11.
[0360] 105. The antibody according to statement 101, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 7, and: [0361] (i) a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0362] (ii) a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0363] (iii) a light chain variable region having the amino acid sequence of SEQ ID NO: 10; or [0364] (iv) a light chain variable region having the amino acid sequence SEQ ID NO: 11.
[0365] 106. The antibody according to statement 101, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 8, and: [0366] (i) a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0367] (ii) a light chain variable region having the amino acid sequence of SEQ ID NO: 9; (iii) a light chain variable region having the amino acid sequence of SEQ ID NO: 10; or [0368] (iv) a light chain variable region having the amino acid sequence SEQ ID NO: 11.
[0369] 107. The antibody according to statement 101 or 102, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4.
[0370] 108. The antibody according to any preceding statement, wherein the antibody is an antibody fragment selected from the group consisting of: a Fab, a Fab′, a F(ab′)2, and an scFv.
[0371] 109. The antibody according to any preceding statement, wherein the antibody further comprises an antibody constant region derived from one or more human antibodies.
[0372] 110. The antibody according to any preceding statement, wherein the antibody binds IL13Rα2 with an affinity (K.sub.D) no greater than 5×10.sup.−10 M, such as no greater than 2.5×10.sup.−10 M.
[0373] 111. The antibody according to any preceding statement, wherein the antibody binds IL13Rα2 with an affinity (K.sub.D) no greater than 1.5×10.sup.−10 M.
[0374] 112. The antibody according to any preceding statement, wherein the antibody competitively inhibits the binding to IL13Rα2 of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2, and optionally, an antibody constant region.
[0375] 113. The antibody according to any preceding statement, wherein the antibody binds IL13Rα2 with higher affinity (K.sub.D) than an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2, and optionally, an antibody constant region.
[0376] 114. The antibody according to any preceding statement, wherein the antibody has immunogenicity in a human subject that is lower than that of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2, and optionally, an antibody constant region.
[0377] 115. The antibody according to any preceding statement, wherein the antibody has improved stability properties as compared to an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2, and optionally, an antibody constant region.
[0378] 116. An antibody drug conjugate comprising the antibody according to any preceding statement conjugated to a drug moiety.
[0379] 117. The antibody drug conjugate according to statement 116, wherein the drug moiety is a cytotoxic drug moiety.
[0380] 118. A pharmaceutical composition comprising the antibody or antibody drug conjugate according to any one of any one of statements 101 to 117 and a pharmaceutically acceptable diluent, carrier or excipient.
[0381] 119. An antibody that binds to Interleukin-13 receptor subunit alpha-2 (IL13Rα2), wherein the antibody comprises: [0382] a heavy chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 3; SEQ ID NO: 5; SEQ ID NO: 6; SEQ ID NO: 7; and SEQ ID NO: 8; and [0383] a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and/or a VL CDR3 with the amino acid sequence of SEQ ID NO. 18.
[0384] 120. The antibody according to statement 119, wherein the antibody comprises a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18.
[0385] 121. The antibody according to statement 119 or 120, wherein the antibody comprises: [0386] (i) a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 3, and a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18; [0387] (ii) a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 5, and a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18; [0388] (iii) a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 6, and a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18; [0389] (iv) a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 7, and a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18; or [0390] (v) a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 8, and a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and a VL CDR3 with the amino acid sequence of SEQ ID NO. 18.
[0391] 122. The antibody according to any one of statements 119-121, wherein the antibody comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 4; SEQ ID NO: 9; SEQ ID NO: 10; SEQ ID NO: 11.
[0392] 123. An antibody that binds to Interleukin-13 receptor subunit alpha-2 (IL13Rα2), wherein the antibody comprises: [0393] a light chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 4; SEQ ID NO: 9; SEQ ID NO: 10; SEQ ID NO: 11; and [0394] a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and/or a VH CDR3 with the amino acid sequence of SEQ ID NO. 15.
[0395] 124. The antibody according to statement 123, wherein the antibody comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 with the amino acid sequence of SEQ ID NO. 15
[0396] 125. The antibody according to statement 123 or 124, wherein the antibody comprises: [0397] (i) a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 with the amino acid sequence of SEQ ID NO. 15, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 4; [0398] (ii) a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 with the amino acid sequence of SEQ ID NO. 15, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 9; [0399] (iii) a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 with the amino acid sequence of SEQ ID NO. 15, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 10; [0400] (iv) a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 with the amino acid sequence of SEQ ID NO. 15, and a light chain variable region having the amino acid sequence of: SEQ ID NO: 11.
[0401] 126. The antibody according to any one of statements 123-125, wherein the antibody comprises a a heavy chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 3; SEQ ID NO: 5; SEQ ID NO: 6; SEQ ID NO: 7; and SEQ ID NO: 8.
[0402] 127. The antibody according to any one of statements 119-126, wherein the antibody comprises: [0403] i) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0404] ii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0405] iii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0406] iv) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0407] v) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0408] vi) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0409] vii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0410] viii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 5, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0411] ix) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0412] x) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0413] xi) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0414] xii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0415] xiii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0416] xiv) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0417] xv) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; [0418] xvi) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 7, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11; [0419] xvii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4; [0420] xviii) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; [0421] xix) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 10; or [0422] xx) a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8, and a light chain variable region having the amino acid sequence of SEQ ID NO: 11.
[0423] 128. The antibody according to any one of statements 119-127, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of: SEQ ID NO: 3, and a light chain variable region having the amino acid sequence of SEQ ID NO: 4.
[0424] 129. An antibody comprising: [0425] a heavy chain variable region which comprises a VH CDR1 with the amino acid sequence of SEQ ID NO: 13, a VH CDR2 with the amino acid sequence of SEQ ID NO: 14, and/or a VH CDR3 with the amino acid sequence of SEQ ID NO. 15; and/or [0426] a light chain variable region which comprises a VL CDR1 with the amino acid sequence of SEQ ID NO: 16, a VL CDR2 with the amino acid sequence of SEQ ID NO: 17, and/or a VL CDR3 with the amino acid sequence of SEQ ID NO. 18.
[0427] 130. The antibody according to statement 129, wherein the antibody binds to Interleukin-13 receptor subunit alpha-2 (IL13Rα2).
[0428] 131. The antibody according to either one of statements 129 or 130, wherein the antibody comprises a serine residue at position 30 (numbering with reference to SEQ ID NO: 3).
[0429] 132. The antibody according to any one of statements any one of statements 129 to 131, wherein the variable regions are fully human.
[0430] 133. The antibody according to any one of statements any one of statements 129 to 132, wherein the antibody is a fully human antibody.
[0431] 134. The antibody according to any one of statements any one of statements 129 to 133, wherein the light chain is a human kappa light chain.
[0432] 135. The antibody according to any one of statements 119-134, wherein the antibody is an antibody fragment selected from the group consisting of: a Fab, a Fab′, a F(ab′)2, and an scFv.
[0433] 136. The antibody according to any one of statements 119-134, wherein the antibody further comprises an antibody constant region derived from one or more human antibodies.
[0434] 137. The antibody according to any one of statements 119-136, wherein the antibody binds IL13Rα2 with an affinity (K.sub.D) no greater than 5×10.sup.−10 M, such as no greater than 2.5×10.sup.−10 M.
[0435] 138. The antibody according to any one of statements 119-137, wherein the antibody binds IL13Rα2 with an affinity (K.sub.D) no greater than 1.5×10.sup.−10 M.
[0436] 139. The antibody according to any one of statements 119-138, wherein the antibody competitively inhibits the binding to IL13Rα2 of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2, and optionally, an antibody constant region.
[0437] 140. The antibody according to any one of statements 119-139, wherein the antibody binds IL13Rα2 with higher affinity (K.sub.D) than an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2, and optionally, an antibody constant region.
[0438] 141. The antibody according to any one of statements 119-140, wherein the antibody has immunogenicity in a human subject that is lower than that of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2, and optionally, an antibody constant region.
[0439] 142. The antibody according to any any one of statements 119-141, wherein the antibody has improved stability properties as compared to an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 1 and a light chain variable region having the amino acid sequence of SEQ ID NO: 2, and optionally, an antibody constant region.
[0440] 143. An antibody drug conjugate comprising the antibody according to any one of statements 119-142 conjugated to a drug moiety.
[0441] 144. The antibody drug conjugate according to statement 143, wherein the drug moiety is a cytotoxic drug moiety.
[0442] 145. The antibody drug conjugate according to statement 144, wherein the cytotoxic drug moiety is a pyrollobenzodiazepine dimer.
[0443] 146. A pharmaceutical composition comprising the antibody or antibody drug conjugate according to any one of any one of statements 119 to 145 and a pharmaceutically acceptable diluent, carrier or excipient.
[0444] 201. The antibody, antibody drug conjugate, or pharmaceutical composition according to any one of statements 101 to 146, for use in a method of treatment.
[0445] 202. The antibody, antibody drug conjugate, or pharmaceutical composition according to any one of statements 101 to 146, for use in a method of treatment of a proliferative disease in a subject.
[0446] 203. The antibody, antibody drug conjugate, or pharmaceutical composition according to statement 202, wherein the proliferative disease is cancer.
[0447] 204. The antibody, antibody drug conjugate, or pharmaceutical composition according to statement 203, wherein the cancer is a cancer selected from the group consisting of: lung cancer, breast cancer, pancreatic cancer, ovarian cancer, renal cancer, head and neck cancer, mesothelioma, glioblastoma, melanomas, and brain tumors such as but not limited to gliomas, medulloblastoma, astrocytoma and ependymoma.
[0448] 205. Use of an antibody, antibody drug conjugate, or pharmaceutical composition according to any one of statements 101 to 146, in the manufacture of a medicament for use in a method of treatment.
[0449] 206. Use of an antibody, antibody drug conjugate, or pharmaceutical composition according to any one of statements 101 to 146, in the manufacture of a medicament for use in a method of treatment of a proliferative disease in a subject.
[0450] 207. The use according to statement 206, wherein the proliferative disease is cancer.
[0451] 208. The use according to statement 207, wherein the cancer is a cancer selected from the group consisting of: lung cancer, breast cancer, pancreatic cancer, ovarian cancer, renal cancer, head and neck cancer, mesothelioma, glioblastoma, melanomas, and brain tumors such as but not limited to gliomas, medulloblastoma, astrocytoma and ependymoma.
[0452] 209. A method of treating a proliferative disease comprising administering to a subject in need thereof an antibody, antibody drug conjugate, or pharmaceutical composition according to any one of statements 101 to 146.
[0453] 210. The method according to statement 209 wherein the subject is administered a chemotherapeutic agent in combination with the antibody, antibody drug conjugate, or pharmaceutical composition.
[0454] 211. The method according to any one of statements 208 to 210, wherein the cancer is a cancer selected from the group consisting of: lung cancer, breast cancer, pancreatic cancer, ovarian cancer, renal cancer, head and neck cancer, mesothelioma, glioblastoma, melanomas, and brain tumors such as but not limited to gliomas, medulloblastoma, astrocytoma and ependymoma.
[0455] 301. A polynucleotide encoding an antibody according to any one of statements 101 to 115 or 119 to 142.
[0456] 302. A vector comprising the polynucleotide of statement 301.
[0457] 303. The vector of statement 302 wherein the vector is an expression vector.
[0458] 304. A host cell comprising a vector according to any one of statements 302 to 303.
[0459] 305. The host cell according to statement 304, wherein the host cell is prokaryotic, eukaryotic, or mammalian.
EXAMPLES
[0460] Materials and Methods
[0461] Expression and Purification of Antibodies
[0462] Cell lines were cultured and expanded according to the manufacturer's instructions; Expi293F™ cells were grown in Expi293™ Expression Medium (ThermoFisher A1435102). Briefly, the cells were cultured in 125 mL shaker culture flasks (Corning™ 431143) in a 37° C. orbital incubator, at 125 rpm and 8% CO2 atmosphere, and maintained at 3-5×10.sup.6 cells/ml throughout the method. Cell density was determined in duplicate by Trypan blue exclusion assay using a LUNA-II™ automated cell counter (Logo Biosystems Ltd). DNA transfection procedures in volumes of 30 mL were followed for both cell lines as described in Thermo Fisher protocols. On the day of transfection, cells with 95% viability (examined via a microscope/cell counter) were selected and diluted to 2.5×10.sup.6/ml for Expi293F™ in 25.5 mL of cell specific expression medium. For Expi293F™ 30 μg of plasmid DNA (15 μg heavy chain+15 μg light chain) was diluted in Opti-MEM® I Reduced-Serum Medium (ThermoFisher 31985070) to a total of 1.5 mL, simultaneously in a separate vial 81 μL of ExpiFectamine™ 293 Reagent was diluted in Opti-MEM® I Reduced Serum Medium to a total of 1.5 mL. Each was gently mixed and incubated at room temperature for 5 minutes, then combined carefully to obtain a total volume of 3 mL. This was incubated for a further 20 minutes at room temperature to allow the DNA-lipid complexes to form, following this the mixture was carefully added to the cell flask. Cultures were harvested on Day 5, cell viability and density were measured using a using a LUNA-II™ automated cell counter, as described earlier. To harvest cells were centrifuged (2000 G, 15 min, 4° C.) and the supernatant was removed and then sterile filtered through 0.22 μm filters prior to purification. Purification was by standard Protein A chromatography.
[0463] ELISA
[0464] Recombinant human extracellular domain of IL13RA2-6His (27-343) was obtained from Sino biological (Ref 10350-H08H). 50 μl of 1 μg/ml of human IL13RA2 in PBS was coated overnight at 4° C. on MaxiSorp ELISA plates. The following morning, the plate is washed with PBS/Tween20 0.02%. Each well has 200 μl of Superblock blocking buffer added and incubated at room temperature for 1 hour in an orbital shaker at 120 rpm. A dilution series of each antibody was prepared, with dilutions of each antibody variant in PBS/Tween20 0.02%. The antibodies are added to blocked antigen coated plates and incubated for 1 hour at room temperature with 120 rpm shaking on an orbital shaker. Plates are then washed 3-times with 200 μl of PBS/Tween20 0.02% and 75 μl of secondary antibody (Mouse anti-human-HRP diluted 1 in 4000 in PBS/Tween20 0.02%) is added to the wells and incubated for 1 hour at room temperature with 120 rpm shaking on an orbital shaker. Plates are then washed 3-times with 200 μl of PBS/Tween20 0.02%. To develop the ELISA, 75 μl of TMB-Turbo substrate is added to the wells and incubated at room temperature with 120 rpm shaking on an orbital shaker till a blue colour develops, the reaction is then stopped with the addition of 75 μl of 0.6 N HCl. Plates are read on the Envision at 450 nM and curves are analysed using GraphPad prism software
[0465] Thermal Shift Analysis
[0466] Protein thermal shift dye, 2.5 μL 1:1000 dilution ((Life Technologies cat. 446148) was added to sample proteins (17.5 μL of 0.5 mg/mL in PBS) in a 96 well optical plate and mixed thoroughly. Every sample was done in quadruplicate. The plate was sealed with an optical adhesive film and bubbles in the wells were removed by centrifugation 1 min at 500 g, then placed on ice. The sealed plate was introduced in the 7500 Real-Time PCR System and subsequently the experiment was set up as follows:
TABLE-US-00002 Reaction vol 20 μl Ramp mode continuous Step Ramp rate Temp ° C. Time (mm:ss) 1 100% 25.0 02:00 2 1% 99.0 02:00
[0467] The data was analysed using the Protein thermal shift v1.2 software (Life Technologies).
[0468] Accelerated Stability Analysis
[0469] Antibodies were incubated at 45° C. in sterile PBS for 7-8 days before being analysed by ELISA, SEC, HIC and RP Chromatography.
[0470] Biacore Analysis
[0471] Biacore analysis using Human IL13RA2-6His coated sensor was used to calculate apparent affinity constants of the Clone 47 variants. A dilution series of the antibody variants were applied to the IL13RA2 sensor surface for 600 seconds minutes to calculate the association constant Ka and buffer (HBS-EP+) was then applied for 1800 seconds to calculate the dissociation constant Kd. The ratio of the two constants will provide an apparent K.sub.D as the bivalency of the antibody will affect the binding kinetics.
[0472] HPLC Size Exclusion Chromatography (SEC)
[0473] SEC analysis was carried out using a Shimadzu HPLC system (or equivalent system), using TSKgel Super SW mAb HTP 4 um 4.6 mm×15 cm column. The mobile phase was 200 mM Potassium Phosphate, 250 mM Potassium Chloride, 10% v/v i-Propanol, pH 6.95, with a flowrate of 0.5m1/minute and detcteion at 280 nm.
[0474] HPLC Hydrophobic Interaction Chromatography (HIC)
[0475] HIC analysis SEC analysis was carried out using a Shimadzu HPLC system (or equivalent system), using a Proteomix HIC Butyl-NPS, 5 um, non-porous, 4.6×35 mm (Sepax) column. Mobile Phase A was 1.25 M (NH4)2SO4, 25 mM NaOAc (pH 5.50) and Mobile Phase B was 75% 25 mM NaOAc (pH 5.50), 25% i-Propanol, with a flowrate of 0.8m1/minute and detection at 214 nm.
[0476] HPLC Reverse Phase Chromatography
[0477] Reverse Phase chromatography was carried out using Shimadzu HPLC system (or equivalent system), using a Aeris Widepore XB-C18, 200 Å, 3.6 μm, 2.1×150 mm (Phenomenex, 00F-4482-AN) column. Mobile Phase A was water+0.1% v/v TFA and Mobile Phase B was Acetonitrile+0.1% v/v TFA. The sample was prepared prior to loading by addition to 40 μL of sample (5 mg/ml) to which was added 30 μl of water, 20 μl NaBorate and 10 μL of DTT. This was then incubated at 37° C., 30 min, 100 μl of 49:49:2 Acetonitrile/Water/Formic acid was added. The column was run at 1 mL/minute, at a temperature of 80° C., with detection at 214 nm.
[0478] In Vitro Cytotoxicity
[0479] A375/NCI-H1299 cells were diluted to 5×10.sup.4 cells/mL in complete growth with 100 μL of cells added to wells in an EDGE plate. The cells were incubated at 37° C./5% CO2 for 2-6 hours to allow time for the cells to adhere. The ADC's were diluted in an 11 point, 1 in 4 serial dilutions, from 50 μg/mL to 47.7 μg/mL, leaving a final negative control sample i.e. no ADC, each concentration was run in duplicate. The diluted ADC's were added to the EDGE plate containing the target cells, and the plate was incubated in a humidified incubator for 5 days (˜120 hours). To determine the cytotoxic effect of the ADC's, Cell Titre Glow (Promega) was used, 40 μL of the read solution was added to each well on the plate and incubated at 37° C./5% CO2 for 1-5 hours. After the incubation, the plate was read on an optical reader (Molecular Devices Spectramax i3X) and the data analysed by the software inherent to the machine (Softmax Pro). Overall the data is a result of running each cell line in triplicate.
[0480] FACS Analysis
[0481] NCI-H1299 cells were diluted to 2×10.sup.6 cells/mL in assay buffer (0.1% BSA/0.1% Sodium Azide in PBS) and 50 μL added per well to a 96-well-plate. The HuCL47 and Clone 47 antibodies were diluted to a top concentration of 40 μg/ml (266 nM) of and diluted 1:4 for 7 dilutions as well as buffer only. 50 μL of the antibody were added to 50 μL of cells to give a concentration of 20 μg/ml. The plate was incubated for 1 hour at room temperature, after which the plate was centrifuged and washed three times. A Goat F(ab′)2 Anti-Human IgG Alexa Fluor 488-conjugated antibody was used (Life Technologies Cat. No. H10120) at a 1 in 250 dilution for detection in assay buffer, 50 μL added to cells and after one hour of incubation at room temperature the cells centrifuged and washed as before, fixed with 7.5% formaldehyde and analysed on the Flow cytometer, with data analysis carried out using FlowJo.
Example 1—Design and Production of Humanised Antibodies
[0482] A number of humanised anti-Interleukin-13 receptor subunit alpha-2 (IL13Rα2) antibody variants were generated beginning from the murine anti-IL13Rα2 antibody “Clone 47”. The heavy and light chain variable region sequences of murine “Clone 47” are SEQ ID NO: 1 and SEQ ID NO: 2 respectively. These were compared with the human variable fragment database, and human framework regions with highest homology to Clone 47 at Vernier and canonical residues were selected for CDR grafting.
[0483] For VH humanisation, IGHV1-3 and IGHJ1-01 frameworks were selected for CDR grafting. The threonine T30 in the original IGHV1-3 human framework was replaced by a serine S30, which is also very common at this position in human germlines, and which matches the serine found in this position in the murine VH sequence. The resulting humanised VH domain (SEQ ID NO: 3) was designated “Clone 47 VHA”.
[0484] Further humanised versions of the Clone 47 VH were generated by introducing back mutations into the “Clone 47 VHA” (SEQ ID NO: 3) sequence. These humanised VH domains were designated “Clone 47 VHAback” (SEQ ID NO: 5), “Clone 47 VHA1” (SEQ ID NO: 6), “Clone 47 VHA2” (SEQ ID NO: 7), and “Clone 47 VHA3” (SEQ ID NO: 8). The variants “Clone 47 VHA1”, “Clone 47 VHA2”, and “Clone 47 VHA3” were generated to assess the impact of murine VCI residues M48, V71, and K73 respectively (numbering according to Kabat).
[0485] For VL humanisation, IGKV3-NL5 and IGHJ2-01 frameworks were selected for CDR grafting. The resulting humanised VL domain (SEQ ID NO: 4) was designated “Clone 47 VKA”.
[0486] Further humanised versions of the Clone 47 VL were generated by introducing back mutations into the “Clone 47 VKA” (SEQ ID NO: 4) sequence. These humanised VL domains were designated “Clone 47 VKAback” (SEQ ID NO: 9), “Clone 47 VKA1” (SEQ ID NO: 10), and “Clone 47 VKA2” (SEQ ID NO: 11). The variants “Clone 47 VKA1” and “Clone 47 VKA2” were generated to assess the impact of two murine VCI phenylalanine residues F36 and F87, which are both tyrosine residues in the human germline.
[0487] Each of the generated light and heavy chain variants were cloned and paired up, transfected into Expi293 cells, expressed and purified. Table 1 shows expression levels and antibody yields of transient co-transfection of the heavy and light chain constructs in Expi293 cells. 3 m1 of purified antibodies was obtained. Clones marked with (*) had expression levels over 200 μg/ml and were selected for further analysis.
TABLE-US-00003 TABLE 1 Expression of humanised variants VH construct VK construct IgG μg/ml Yield (mg) Clone 47 VHA* Clone 47 VKA 281 0.843 Clone 47 VHA Clone 47 VKAback 175 0.525 Clone 47 VHA* Clone 47 VKA1 231 0.693 Clone 47 VHA* Clone 47 VKA2 300 0.900 Clone 47 VHAback* Clone 47 VKA 312 0.936 Clone 47 VHAback Clone 47 VKAback 100 0.300 Clone 47 VHAback* Clone 47 VKA1 243 0.729 Clone 47 VHAback* Clone 47 VKA2 212 0.636 Clone 47 VHA1 Clone 47 VKA 175 0.525 Clone 47 VHA1 Clone 47 VKAback 112 0.336 Clone 47 VHA1 Clone 47 VKA1 175 0.525 Clone 47 VHA1 Clone 47 VKA2 143 0.429 Clone 47 VHA2 Clone 47 VKA 187 0.561 Clone 47 VHA2 Clone 47 VKAback 131 0.393 Clone 47 VHA2 Clone 47 VKA1 187 0.561 Clone 47 VHA2 Clone 47 VKA2 168 0.504 Clone 47 VHA3 Clone 47 VKA 156 0.468 Clone 47 VHA3 Clone 47 VKAback 137 0.411 Clone 47 VHA3 Clone 47 VKA1 81 0.243 Clone 47 VHA3* Clone 47 VKA2 200 0.600
[0488] Binding of each humanised clone to IL13Rα2 was assessed by ELISA. All tested clones appear similar in their binding to IL13Rα2.
Example 2—Characterisation of the Humanised Antibodies
[0489] Binding affinity of a chimeric (Ch) Clone 47 and select humanised variants to human IL13Rα2 was measured on Biacore. Results are shown in Table 2 below. The apparent affinities show that the humanised variants show improved binding to human IL13Rα2 as compared to the chimeric (Ch) Clone 47.
TABLE-US-00004 TABLE 2 Variants K.sub.ass (1/MS) K.sub.diss (1/s) K.sub.D App (nM) Ch Clone 47 1.25 × 10.sup.5 6.58 × 10.sup.−5 0.53 VHA/VKA 1.12 × 10.sup.5 1.12 × 10.sup.−5 0.10 VHA/VKA1 1.24 × 10.sup.5 2.65 × 10.sup.−5 0.21 VHA/VKA2 1.31 × 10.sup.5 8.20 × 10.sup.−6 0.06 VHAback/VKA 1.15 × 10.sup.5 5.30 × 10.sup.−6 0.05
[0490] Stability of a chimeric Clone 47 and select humanised variants was assessed by protein thermal shift and temperature stability assays at 37° C. versus 4° C. for 8 days. Results are shown in Table 3 below. The selected humanised variants subjected to stress conditions show comparable stability to the chimeric Clone 47.
TABLE-US-00005 TABLE 3 8 Days stability (PBS) 4° C. 37° C. Clones PTS T.sub.m SEC RP HIC SEC RP HIC Ch Clone 47 71.4 4.86/97.0 3.80/3.48 2.19 4.88/84.9 3.80/3.47 2.19 VHA/VKA 73.1 4.84/96.8 3.79/3.42 2.18 4.85/89.6 3.79/3.41 2.18 VHA/VKA1 70.3 4.84/96.6 3.79/3.45 2.19 4.84/89.2 3.79/3.55 2.18 VHA/VKA2 72.0 4.87/93.0 3.78/3.52 2.19 4.85/92.6 3.78/3.53 2.18 VHAback/VKA 74.1 4.82/97.3 3.78/3.40 2.19 4.83/93.1 3.78/3.39 2.18 VHAback/VKA1 72.3 4.82/97.8 3.79/3.43 2.19 4.83/91.2 3.80/3.54 2.19 VHA3/VKA2 71.9 4.83/97.5 3.76/3.42 2.19 4.84/92.1 3.75/3.52 2.19 Protein thermal shift (PTS): Mean Tm in ° C. (quadruplicates) SEC: Elution time (min)/% Monomer RP: HC/LC retention time (min) HIC: Retention time (min)
[0491] Binding of the variants listed in Table 3 to IL13Rα2 was also assessed by ELISA following incubation at 4° C. or 45° C. for 8 days. As shown in Table 4, among the tested variants only the VHA/VKA variant showed no reduction in binding due to the stress conditions (incubation at 45° C. for 8 days), indicating it is the most stable. These binding data also indicate that the humanised variants VHAback/VKA and VHA3/VKA2 have improved stability properties as compared to the chimeric Clone 47.
TABLE-US-00006 TABLE 4 Clone 47 EC.sub.50 45° C. EC.sub.50 4° C. variants (ng/ml) (ng/ml) Ch Clone 47 16.8 77.7 VHA/VKA 18.4 17.8 VHA/VKA1 12.3 58.1 VHA/VKA2 20.4 147.9 VHAback/VKA 16.4 45.6 VHAback/VKA1 12.8 1012.0 VHA3/VKA2 12.3 25.8
[0492] Based on this data, the VHANKA variant (which is fully human with no mouse back mutations introduced) comprising the VH of SEQ ID NO: 3 and VL of SEQ ID NO: 4 is the best performing. This humanised anti-IL13Rα2 antibody was designated “HuCL47”.
[0493] A sequence comparison of murine “Clone 47” and “HuCL47” is shown in
Example 3—Theoretical pI of Anti-IL13Rα2 Antibodies
[0494] The theoretical pIs of certain of the anti-IL13Rα2 antibodies described above were calculated based on their heavy and light chain sequences using the “Protparam” tool available at https://web.expasy.org/protparam/. Results are shown in Table 5.
TABLE-US-00007 TABLE 5 Antibody VH/VL Seguences pI Ch Clone 47 SEQ ID NO: 1/SEQ ID NO: 2 6.95 VHA/VKA (HuCL47) SEQ ID NO: 3/SEQ ID NO: 4 7.63 VHAback/VKAback SEQ ID NO: 5/SEQ ID NO: 9 7.64 VHA1/VKA1 SEQ ID NO: 6/SEQ ID NO: 10 7.64 VHA2/VKA2 SEQ ID NO: 7/SEQ ID NO: 11 7.28
Example 4—Comparison of Clone 47 and HuCL47
[0495] Chimeric clone 47 and HuCL47 were compared in terms of their: binding to NCI-H1299 Cells by standard FACS analysis using NCI-H1299 cells and unmodified purified antibodies. In vitro cytotoxicity analysis was performed on both A375 and NCI-1299 cells, using a pyrollobenzodiazepine dimer (PBD) warhead conjugated to chimeric clone 47 and HuCL47.
[0496] Results are shown in:
TABLE-US-00008 TABLE 6 ADC EC.sub.50 (pM) Ch Clone 47-PBD 135.3 VHA/VKA (HuCL47)-PBD 113.7 B12-PBD 12400
TABLE-US-00009 TABLE 7 ADC EC.sub.50 (pM) Ch Clone 47-PBD 7.6 VHA/VKA (HuCL47)-PBD 7.8 B12-PBD 6864
REFERENCES
[0497] A number of publications are cited above in order to more fully describe and disclose the invention and the state of the art to which the invention pertains The entirety of each of these references is incorporated herein. [0498] For standard molecular biology techniques, see Sambrook, J., Russel, D. W. Molecular Cloning, A Laboratory Manual. 3 ed. 2001, Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press