Antibodies directed to Bacillus anthracis protective antigen

09732145 · 2017-08-15

Assignee

Inventors

Cpc classification

International classification

Abstract

This disclosure generally relates to therapeutic antibodies for treating Bacillus anthracis (B. anthracis) infection, to specific variants thereof, pharmaceutical composition comprising them and to methods for their use.

Claims

1. An isolated monoclonal antibody or any antigen-binding fragment thereof which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region comprising: a) the complementarity determining region CDRH1 comprising the amino acid sequence of IFTNYNMH denoted by SEQ ID NO. 3; b) the complementarity determining region CDRH2 comprising the amino acid sequence AIYPRTGDTSYNQKFKG denoted by SEQ ID NO. 4; and c) the complementarity determining region CDRH3 comprising the amino acid sequence ARDGFAY denoted by SEQ ID NO. 5; and a light chain variable region comprising: d) the complementarity determining region CDRL1 comprising the amino acid sequence RASQDISNYLN denoted by SEQ ID NO. 8; e) the complementarity determining region CDRL2 comprising the amino acid sequence YTSRLHS denoted by SEQ ID NO. 9; and f) the complementarity determining region CDRL3 comprising the amino acid sequence QQGKTLPWT denoted by SEQ ID NO. 10.

2. The isolated monoclonal antibody according to claim 1, wherein said heavy chain variable region is encoded by a nucleic acid sequence which is at least 70% identical to SEQ ID NO. 1 and wherein said light chain variable region is encoded by a nucleic acid sequence which is at least 70% identical to SEQ ID NO. 6.

3. The isolated monoclonal antibody according to claim 1, wherein said heavy chain variable region is of the amino acid sequence denoted by SEQ ID NO. 2 or a variant thereof in which at least one position selected from the group consisting of position 1 and position 16 of SEQ ID NO. 2 is substituted.

4. The isolated monoclonal antibody according to claim 1, wherein said light chain variable region is of the amino acid sequence denoted by SEQ ID NO. 7 or a variant thereof in which at least one position selected from the group consisting of positions 3, 9, 21, 57 and 87 of SEQ ID NO. 7 is substituted.

5. The isolated monoclonal antibody according to claim 1, wherein said heavy chain variable region is of the amino acid sequence denoted by SEQ ID NO. 2 and wherein said light chain variable region is of the amino acid sequence denoted by SEQ ID NO. 7.

6. The isolated monoclonal antibody according to claim 1, wherein said antibody is a chimeric, a humanized or a human antibody.

7. The isolated monoclonal antibody according to claim 1, wherein said antibody is an antibody fragment selected from the group consisting of Fv, single chain Fv (scFv), heavy chain variable region, light chain variable region, Fab, F(ab).sub.2′ and any combination thereof.

8. A pharmaceutical composition comprising as an active ingredient the isolated monoclonal antibody or any antigen-binding fragment thereof of claim 1 and a pharmaceutically acceptable carrier, excipient or diluent.

9. The pharmaceutical composition according to claim 8, wherein said composition further comprises at least one additional anti-anthrax agent.

10. A kit comprising: (i) an isolated monoclonal antibody or any antigen-binding fragment thereof which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region comprising: a) the complementarity determining region CDRH1 comprising the amino acid sequence of IFTNYNMH denoted by SEQ ID NO. 3; b) the complementarity determining region CDRH2 comprising the amino acid sequence AIYPRTGDTSYNQKFKG denoted by SEQ ID NO. 4; and c) the complementarity determining region CDRH3 comprising the amino acid sequence ARDGFAY denoted by SEQ ID NO. 5; and a light chain variable region comprising: d) the complementarity determining region CDRL1 comprising the amino acid sequence RASQDISNYLN denoted by SEQ ID NO. 8; e) the complementarity determining region CDRL2 comprising the amino acid sequence YTSRLHS denoted by SEQ ID NO. 9; and f) the complementarity determining region CDRL3 comprising the amino acid sequence QQGKTLPWT denoted by SEQ ID NO. 10; and (ii) instructions for use.

11. An isolated chimeric antibody, or any antigen-binding fragment thereof which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region comprising: a) the complementarity determining region CDRH1 comprising the amino acid sequence of IFTNYNMH denoted by SEQ ID NO. 3; b) the complementarity determining region CDRH2 comprising the amino acid sequence AIYPRTGDTSYNQKFKG denoted by SEQ ID NO. 4; and c) the complementarity determining region CDRH3 comprising the amino acid sequence ARDGFAY denoted by SEQ ID NO. 5; and a light chain variable region comprising: d) the complementarity determining region CDRL1 comprising the amino acid sequence RASQDISNYLN denoted by SEQ ID NO. 8; e) the complementarity determining region CDRL2 comprising the amino acid sequence YTSRLHS denoted by SEQ ID NO. 9; and f) the complementarity determining region CDRL3 comprising the amino acid sequence QQGKTLPWT denoted by SEQ ID NO. 10.

12. The isolated chimeric antibody according to claim 11, wherein the antibody comprises a heavy chain variable region of the amino acid sequence denoted by SEQ ID NO. 2, or a variant thereof in which at least one position selected from the group consisting of position 1 and position 16 of SEQ ID NO. 2 is substituted, and a light chain variable region of the amino acid sequence denoted by SEQ ID NO. 7, or a variant thereof in which at least one position selected from the group consisting of positions 3, 9, 21, 57 and 87 of SEQ ID NO. 7 is substituted.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) In order to better understand the subject matter that is disclosed herein and to exemplify how it may be carried out in practice, embodiments will now be described, by way of non-limiting example only, with reference to the accompanying drawings, in which:

(2) FIG. 1: Nucleic acid and amino acid sequences of the heavy and the light chains of the chimeric antibody cAb 29 and the mutated antibody PA29mut29. Nucleic and amino acid sequences of the heavy chains of cAb 29 and PA29mut29 are denoted by PA29VH w.t. and PA29mut29VH, respectively and nucleic and amino acid sequences of the light chains of cAb 29 and PA29mut29 are denoted by PA29VL w.t. and PA29mut29VL, respectively. Mutated nucleotides and amino acid residues are indicated by bold underlined letters.

(3) FIG. 2: Nucleic acid and amino acid sequences of the heavy and the light chains of the mutated antibodies PA29mut33 and PA29mut39. Nucleic and amino acid sequences of the heavy chains of PA29mut33 and PA29mut39 are denoted by PA29mut33VH and PA29mut39VH, respectively and nucleic and amino acid sequences of the light chains of PA29mut33 and PA29mut39 are denoted by PA29mut33VL and PA29mut39VL, respectively. Mutated nucleotides and amino acid residues are indicated by bold underlined letters.

(4) FIG. 3: Nucleic acid and amino acid sequences of the heavy and the light chains of the mutated antibodies PA29mut40 and PA29mut41. Nucleic and amino acid sequences of the heavy chains of PA29mut40 and PA29mut41 are denoted by PA29mut40VH and PA29mut41VH, respectively and nucleic and amino acid sequences of the light chains of PA29mut40 and PA29mut41 are denoted by PA29mut40VL and PA29mut41VL, respectively. Mutated nucleotides and amino acid residues are indicated by bold underlined letters.

(5) FIGS. 4A-4C: Multiple sequence alignment of the heavy chain variable domains of the wild type and mutated antibodies. Sequence alignment of the heavy chain variable domains of the wild type and mutated antibodies are presented for fragments comprising the complementarity determining regions (CDR) CDRH1 (FIG. 4A), CDRH2 (FIG. 4B) and CDRH3 (FIG. 4C). CDRs are shown in grey boxes and the mutated amino acid residues are indicated by bold underlined letters. Abbreviations: w.t., cAb 29; 29, PA29mut29; 33, PA29mut33; 39, PA29mut39; 40, PA29mut40; and 41, PA29mut41.

(6) FIGS. 5A-5C: Multiple sequence alignment of the light chain variable domains of the wild type and mutated antibodies. Sequence alignment of the light chain variable domains of the wild type and mutated antibodies are presented for fragments comprising the complementarity determining regions (CDR) CDRL1 (FIG. 5A), CDRL2 (FIG. 5B) and CDRL3 (FIG. 5C). CDRs are shown in grey boxes and the mutated amino acid residues are indicated by bold underlined letters. Abbreviations: w.t., cAb 29; 29, PA29mut29; 33, PA29mut33; 39, PA29mut39; 40, PA29mut40; and 41, PA29mut41.

DETAILED DESCRIPTION OF EMBODIMENTS

(7) The present invention is based on the sequencing and characterization of specific antibodies directed to Bacillus anthracis protective antigen (PA), in particular a chimeric antibody, and variants thereof harboring specific amino acid substitutions in the sequence of the heavy chain and the light chain of the antibody.

(8) The present invention thus provides an isolated monoclonal antibody or any antigen-binding fragment thereof which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region comprising: a) the complementarity determining region CDRH1 comprising the amino acid sequence of IFTNYNMH denoted by SEQ ID NO. 3 or a variant thereof; b) the complementarity determining region CDRH2 comprising the amino acid sequence AIYPRTGDTSYNQKFKG denoted by SEQ ID NO. 4 or a variant thereof; and c) the complementarity determining region CDRH3 comprising the amino acid sequence ARDGFAY denoted by SEQ ID NO. 5 or a variant thereof; and
a light chain variable region comprising: d) the complementarity determining region CDRL1 comprising the amino acid sequence RASQDISNYLN denoted by SEQ ID NO. 8 or a variant thereof; e) the complementarity determining region CDRL2 comprising the amino acid sequence YTSRLHS denoted by SEQ ID NO. 9 or a variant thereof; and f) the complementarity determining region CDRL3 comprising the amino acid sequence QQGKTLPWT denoted by SEQ ID NO. 10 or a variant thereof.

(9) The term “Bacillus anthracis” (or “B. anthracis”) as herein defined refers to a Gram-positive, endospore-forming rod-shaped bacterium that can be grown in an ordinary nutrient medium under aerobic or anaerobic conditions. The bacterium can form dormant soil-borne endospores (often referred to as “spores”) that are able to survive in harsh conditions for decades. When spores are inhaled, ingested, or come into contact with a skin lesion on a host, they may become reactivated and multiply rapidly.

(10) As known in the art, the disease Anthrax is an acute disease caused by the bacterium Bacillus anthracis. Most forms of the disease are lethal, and it affects both humans and animals.

(11) Anthrax toxin is a three-protein exotoxin secreted by Bacillus anthracis. Anthrax toxin is composed of a cell-binding protein, known as protective antigen (PA), and two enzyme components, edema factor (EF) and lethal factor (LF). PA, EF and LF act together to impart their physiological effects.

(12) Assembled complexes containing the toxin components are endocytosed. In the endosome, the enzymatic components of the toxin translocate into the cytoplasm of a target cell. Once in the cytosol, the enzymatic components of the toxin disrupt various cell functions, namely cellular signaling and cell migration. Anthrax toxin ultimately allows the bacteria to evade the immune system, proliferate, and ultimately kill the host.

(13) “Protective antigen” (PA) as herein defined refers to the central component of the three-part protein toxin secreted by Bacillus anthracis. After proteolytic activation on the host cell surface, PA forms a membrane-inserting heptamer that translocates the toxic enzymes, edema factor (EF) and lethal factor (LF), into the cytosol.

(14) B. anthracis PA may be prepared by any method known in the art. For example, from the B. anthracis strain V770-NPI-R, anaerobically grown as previously described (10). Briefly, bacteria are grown at 37° C. in Luria-Bertani (LB) medium supplemented with 25 μg/ml kanamycin. After 24 hours of growth, bacteria is removed by microfiltration, while the protective antigen (PA) containing supernatant is concentrated by ultrafiltration and dialyzed against 20 mM phosphate buffer (pH=8.0). Purification of PA may be carried out by Q-Sepharose chromatography, essentially as previously described (11).

(15) As indicated above, the present invention provides defined isolated monoclonal antibodies that bind to Bacillus anthracis protective antigen. The term “antibody” refers to a polypeptide that generally contains heavy chain polypeptides and light chain polypeptides and is encoded by an immunoglobulin gene, or functional fragments thereof that specifically bind and recognize an antigen, namely Bacillus anthracis PA.

(16) An antibody as herein defined comprises one of five different types of heavy chains, called alpha, delta, epsilon, gamma, and mu, based on the amino acid sequence of the heavy chain constant region. These different types of heavy chains give rise to five classes of antibodies, IgA (including IgA1 and IgA2), IgD, IgE, IgG (IgG1, IgG2, IgG3, and IgG4) and IgM, respectively. An antibody also comprises one of two types of light chains, called kappa or lambda, based on the amino acid sequence of the light chain constant domains.

(17) The term “monoclonal antibody”, “monoclonal antibodies” or “mAb” as herein defined refers to a population of substantially homogenous antibodies, namely, the individual antibodies comprising the population are identical except for possibly naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are directed against a single antigenic site.

(18) Monoclonal antibodies may be prepared and purified by any method known in the art. For example, monoclonal antibodies may be prepared from B cells taken from the spleen or lymph nodes of immunized animals (e.g. rats or mice), by fusion with immortalized B cells under conditions which favor the growth of hybrid cells.

(19) Immunization of mice for the preparation of monoclonal antibodies may be carried out by primary sub-cutaneous (s.c.) immunization using PA (e.g. 50 μg) emulsified with complete Freund's adjuvant. Two subcutaneous booster injections with PA (e.g. 50 μg) emulsified with incomplete Freund's adjuvant are then administered every 2 weeks. The mice with the highest neutralizing antibody titer receive an additional intravenous (i.v.) boost of PA (e.g. 5 μg) in PBS four days prior to spleen removal.

(20) After the final boost (e.g. four days), the spleen of the mouse with the highest neutralizing antibody titer is removed and splenocytes are fused to mouse myeloma cells (e.g. NS0 cells) using polyethylene glycol, as previously described (12). After fusion, the hybridoma cells are selected by growing the cells in HAT (hypoxantine-aminopterin-thymidine) medium. Cell clones are then screened for neutralizing antibody production, for example using the direct and indirect ELISA assays described below.

(21) Antibodies may also be prepared using phage display. As known in the art, antibody phage display (APD) is based on genetic engineering of bacteriophages and repeated rounds of antigen-guided selection and phage propagation.

(22) The APD process begins with antibody-library preparation, by preparation of quality RNA from the cell source chosen (e.g., peripheral blood mononuclear cells). This RNA is reverse-transcribed into cDNA, which is used for PCR of the VH and VL chains of the encoded antibodies. This step is followed by ligation of the variable heavy (VH) and variable light (VL) PCR products into a phage display vector, culminating in analysis of clones of mAbs.

(23) Purification of monoclonal antibodies may be based for example on affinity chromatography, namely, using an affinity column to which a specific epitope is conjugated.

(24) Binding to Bacillus anthracis protective antigen by the antibodies prepared according to the present disclosure may be examined by any method known to a person skilled in the art, for example using the direct and indirect ELISA assays described below.

(25) An exemplary IgG antibody structural unit comprises a tetramer, as known in the art. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light chain” and one “heavy chain”. The N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen (or epitope) recognition.

(26) Thus, the terms “heavy chain variable region” (V.sub.H) and “light chain variable region” (V.sub.L) refer to these heavy and light chains, respectively. More specifically, the variable region is subdivided into hypervariable and framework (FR) regions. Hypervariable regions have a high ratio of different amino acids in a given position, relative to the most common amino acid in that position. Four FR regions which have more stable amino acids sequences separate the hypervariable regions. The hypervariable regions directly contact a portion of the antigen's surface. For this reason, hypervariable regions are herein referred to as “complementarily determining regions”, or “CDRs”.

(27) From N-terminal to C-terminal, both light and heavy chains comprise the regions (also referred to as domains) FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The CDRs are primarily responsible for binding to an epitope of an antigen. The CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located (namely the heavy or the light chain).

(28) Thus, the complementarity determining regions CDRH1, CDRH2 and CDRH3 refer to the three complementarity determining regions starting from the N-terminus of the antibody's heavy chain and the complementarity determining regions CDRL1, CDRL2 and CDRL3 refer to the three complementarity determining regions starting from the N-terminus of the antibody's light chain.

(29) As detailed above the present invention provides an isolated monoclonal antibody, which comprises a heavy chain variable region comprising the CDRH1 comprising the amino acid sequence of IFTNYNMH denoted by SEQ ID NO. 3 or a variant thereof, the CDRH2 comprising the amino acid sequence AIYPRTGDTSYNQKFKG denoted by SEQ ID NO. 4 or a variant thereof, and the CDRH3 comprising the amino acid sequence ARDGFAY denoted by SEQ ID NO. 5 or a variant thereof; and a light chain variable region comprising: the CDRL1 comprising the amino acid sequence RASQDISNYLN denoted by SEQ ID NO. 8 or a variant thereof; the CDRL2 comprising the amino acid sequence YTSRLHS denoted by SEQ ID NO. 9 or a variant thereof; and the CDRL3 comprising the amino acid sequence QQGKTLPWT denoted by SEQ ID NO. 10 or a variant thereof.

(30) The above CDR sequences CDRH1, CDRH2, CDRH3, CDRL1, CDRL2 and CDRL3 denoted by SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 8, SEQ ID NO. 9 and SEQ ID NO. 10 (Table 1), respectively are also presented in the context of their respective heavy and light chains sequences, e.g. in FIGS. 4A-4C and in FIGS. 5A-5C.

(31) For example, the sequence of CDRH1, denoted herein by SEQ ID NO. 3, is shown in FIG. 4A in a grey box, for each of the antibodies described below.

(32) As shown in the accompanying examples, various mutated antibodies of the antibody cAb29 were prepared and shown to bind Bacillus anthracis protective antigen.

(33) Thus the present invention also encompasses variants (also referred to herein as “mutated antibodies”) of the heavy and light chain variable regions. The variants may include mutations in the complementarity determining regions of the heavy and light chains, or in the framework regions, which do not alter the biological activity of the antibodies herein described (namely binding to Bacillus anthracis PA).

(34) By the term “variant” it is meant sequences of amino acids or nucleotides different from the sequences specifically identified herein, in which one or more amino acid residues or nucleotides are deleted, substituted or added.

(35) It should be appreciated that by the term “added”, as used herein it is meant any addition(s) of amino acid residues to the sequences described herein. For example, the variant antibodies or fragments thereof of the invention may be extended at their N-terminus and/or C-terminus with various identical or different amino acid residues.

(36) Variants encompass various amino acid substitutions. An amino acid “substitution” is the result of replacing one amino acid with another amino acid which has similar or different structural and/or chemical properties Amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.

(37) Surprisingly, as shown in the appended Examples, certain variants according to the invention had similar (or higher) binding affinity to their PA ligand as compared to the original antibody, where an uncharged polar amino acid was replaced by a charged polar amino acid (Glutamine to Glutamic acid and Glutamine to Arginine in the antibody PA29mut33) and where a polar amino acid was replaced by a non-polar amino acid (Serine to Proline in the antibody PA29mut40 and Glutamic acid to Glycine in the antibody PA29mut29). Therefore variants in accordance with the invention encompass inter alia non-polar to polar amino acid substitutions and vice-versa.

(38) Variants also encompass conservative amino acid substitutions. Conservative substitution tables providing functionally similar amino acids are well known in the art. For example, nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine; polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine; positively charged (basic) amino acids include arginine, lysine, and histidine; and negatively charged (acidic) amino acids include aspartic acid and glutamic acid.

(39) Each of the following eight groups contains other exemplary amino acids that are conservative substitutions for one another:

(40) 1) Alanine (A), Glycine (G);

(41) 2) Aspartic acid (D), Glutamic acid (E);

(42) 3) Asparagine (N), Glutamine (Q);

(43) 4) Arginine (R), Lysine (K);

(44) 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V);

(45) 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W);

(46) 7) Serine (S), Threonine (T); and

(47) 8) Cysteine (C), Methionine (M).

(48) Conservative nucleic acid substitutions are nucleic acid substitutions resulting in conservative amino acid substitutions as defined above.

(49) As used herein, the term “amino acid” or “amino acid residue” refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.

(50) Variant sequences refer to amino acid or nucleic acids sequences that may be characterized by the percentage of the identity of their amino acid or nucleotide sequences with the amino acid or nucleotide sequences described herein (namely the amino acid or nucleotide sequences of the heavy and light chains of the antibodies herein described).

(51) In some embodiments, variant sequences as herein defined refer to nucleic acid sequences that encode the heavy and light chain variable regions, each having a sequence of nucleotides with at least 70% or 75% of sequence identity, around 80% or 85% of sequence identity, around 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of sequence identity when compared to the sequences of the heavy and light chain variable regions described herein.

(52) In some embodiments the isolated monoclonal antibody according to the invention is wherein its heavy chain variable region is encoded by a nucleic acid sequence which is at least 70% identical to the nucleic acid sequence of the heavy chain variable region denoted by SEQ ID NO. 1 and wherein its light chain variable region is encoded by a nucleic acid sequence which is at least 70% identical to the nucleic acid sequence of the light chain variable region denoted by SEQ ID NO. 6.

(53) By the term “biological activity” it is meant the ability of the antibody to neutralize the toxicity of Bacillus anthracis.

(54) As reported by Mechaly, A. et al. (8), incorporated herein by reference, numerous PA-neutralizing monoclonal antibodies directed against all the four domains of PA were isolated and described to date Interestingly, the antibodies in accordance with the invention are able to bind to B. anthracis PA at any stage of PA intoxication and specifically, to neutralize B. anthracis PA intoxication by inhibiting the prepore-to-pore conversion step.

(55) Without wishing to be bound by theory, this unique neutralizing activity of the antibody in accordance with the invention provides the antibodies described herein with a broad range of neutralizing activity and in particular with the ability to prevent the translocation of LF (or EF) into the cell. It can therefore be hypothesized that antibodies that bind to the heptamer form of PA, even when it has already bound LF/EF and inhibit the last stage of intoxication, namely, receptor binding, internalization and pore formation, will provide superior protection against anthrax as compared to other antibodies directed to other epitopes in PA.

(56) The ability of the antibody to neutralize the toxicity of B. anthracis may be monitored by any method known in the art, in particular, using the methods described herein below. These methods include but are not limited to in vitro LeTx neutralization assay, namely by assessing the ability of the antibody to protect murine macrophage J774A.1 cells against PA/LF toxin complex (LeTx) intoxication (11). Briefly, tested antibody samples are serially diluted by two-fold dilutions in a buffer containing PA (5 μg/ml) and LF (2 μg/ml), and after one hour of incubation, 10 μl of each of the reaction mixture dilutions is added to J774A.1 cells. Plates are then incubated for 5 hours at 37° C. in 5% CO.sub.2, and cell viability is monitored by the MTT (3-[4,5-Dimethylthiazol-2-yl]-2,5-Diphenyltetrazolium bromide; Thiazolyl blue) assay, reflecting the number of viable cells (13).

(57) The ability of the antibody to neutralize the toxicity of B. anthracis may also be monitored by in vivo neutralization experiments in animals subjected to LeTx challenge, for example as detailed below.

(58) LeTx challenge in rats consists of evaluating the ability of the antibody to protect rats against a LeTx challenge. To this end, rats (e.g. Male Fisher 344) are injected intramuscularly (i.m.) with various doses of antibodies. Seventeen hours later, rats are anesthetized with ketamine:xylazine (50:2 mg/kg) and injected via the tail vein (i.v.) with LeTx, containing 20 μg PA and 10 μg LF in 500 μl saline, and monitored for survival.

(59) The ability of the antibody to protect against anthrax spore challenge may also be performed in guinea pigs, by injecting guinea pigs i.m. with various doses of antibodies, and 14 hrs later challenging by subcutaneous (s.c.) administration of 40 LD.sub.50 anthrax Vollum spores as described previously (10). Animal viability is then monitored for at least 14 days.

(60) Additional in vitro experiments for determining the binding of the antibody prepared according to the invention to its target protein include for example direct and indirect-ELISA assays.

(61) Direct-ELISA assay for anti-PA antibody titration can be performed in 96-well microtiter plates using an RMP200 (TECAN, Switzerland) robotic system. PA is used as the capture antigen and a suitable alkaline phosphatase-conjugated secondary antibody may be used for detection. Indirect-ELISA may be performed using Rabbit anti-PA as the capture antibody for PA.

(62) As indicated above, the present invention is based on the identification of a specific chimeric antibody directed to Bacillus anthracis protective antigen (PA), and variants thereof (referred to below as “mutated antibodies”). As detailed below, the antibody of the invention comprises heavy and light chains having the amino acid sequences denoted by SEQ ID NO. 2 and SEQ ID NO. 7, respectively (the sequences are shown for example in Table 1).

(63) Thus in some embodiments the isolated monoclonal antibody according to the invention is wherein its heavy chain variable region is of the amino acid sequence denoted by SEQ ID NO. 2 or a variant thereof.

(64) In some embodiments, the present invention pertains to an isolated monoclonal antibody or any antigen-binding fragment thereof, wherein the antibody comprises a heavy chain variable region in which at least one amino acid residue is replaced or substituted with respect to the amino acid sequence of the heavy chain variable region denoted by SEQ ID NO. 2.

(65) As demonstrated below, the variant antibodies PA29mut33 and PA29mut41 were shown to bind Bacillus anthracis protective antigen.

(66) Thus in some embodiments the isolated monoclonal antibody according to the invention is wherein its heavy chain variable region comprises a substitution in at least one position selected from the group consisting of position 1 and position 16 of SEQ ID NO. 2.

(67) By the term “position” it is meant the location within the amino acid sequence, where “position 1” indicates the N-terminal amino acid residue, “position 2” indicates the amino acid residue that is adjacent to the N-terminal amino acid residue and so forth in the direction of N-terminal to C-terminal, as known in the art.

(68) For example, in the amino acid sequence of the heavy chain variable region of the antibody of the invention, denoted by SEQ ID NO. 2 (Table 1), “position 1” refers to the N-terminal amino acid residue, namely glutamine (Gln, Q), “position 2” refers to valine (Val, V), and “position 16” refers to alanine (Ala, A), etc.

(69) In some embodiments the isolated monoclonal antibody according to the invention comprised the heavy chain variable region of the variant antibody PA29mut33, namely wherein its heavy chain variable region comprises the amino acid residue glutamic acid (Glu, E) at position 1 of SEQ ID NO. 2 and wherein said heavy chain variable region is of the amino acid sequence denoted by SEQ ID NO. 16.

(70) In other embodiments the isolated monoclonal antibody according to the invention comprised the heavy chain variable region of the variant antibody PA29mut41, namely wherein its heavy chain variable region comprises the amino acid residue valine (Val, V) at position 16 of SEQ ID NO. 2 and wherein said heavy chain variable region is of the amino acid sequence denoted by SEQ ID NO. 28.

(71) As indicated above, the antibody of the invention comprises heavy and light chains having the amino acid sequences denoted by SEQ ID NO. 2 and SEQ ID NO. 7, respectively.

(72) Thus in some embodiments the isolated monoclonal antibody according to the invention is wherein its light chain variable region is of the amino acid sequence denoted by SEQ ID NO. 7 or a variant thereof.

(73) As demonstrated below, the variant antibodies PA29mut29, PA29mut39 and PA29mut40 were also shown to bind Bacillus anthracis protective antigen.

(74) Thus in some embodiments the isolated monoclonal antibody according to the invention is wherein its light chain variable region comprises a substitution in at least one position selected from the group consisting of position 3, 9, 21, 57 and 87 of SEQ ID NO. 7.

(75) In other words, the invention encompasses an isolated monoclonal antibody in which at least one of the amino acid residues glutamine at position 3, serine at position 9, isoleucine at position 21, glutamic acid at position 57 and phenylalanine at position 87 of SEQ ID NO. 7 is substituted by another amino acid.

(76) In some embodiments the isolated monoclonal antibody according to the invention comprises the light chain variable region of the variant antibody PA29mut33, namely wherein its light chain variable region comprises the amino acid residue arginine (Arg, R) at position 3 of SEQ ID NO. 7 and wherein said light chain variable region is of the amino acid sequence denoted by SEQ ID NO. 18.

(77) In other embodiments the isolated monoclonal antibody according to the invention comprises the light chain variable region and the heavy chain variable region of the variant antibody PA29mut33, denoted by SEQ ID NO. 18 and SEQ ID NO. 16, respectively.

(78) In further embodiments the isolated monoclonal antibody according to the invention comprises the light chain variable region of the variant antibody PA29mut40, namely wherein its light chain variable region comprises the amino acid residue proline (Pro, P) at position 9 of SEQ ID NO. 7 and wherein said light chain variable region is of the amino acid sequence denoted by SEQ ID NO. 26.

(79) In still further embodiments the isolated monoclonal antibody according to the invention comprises the light chain variable region of the variant antibody PA29mut39, namely wherein its light chain variable region comprises the amino acid residue valine (Val, V) at position 21 of SEQ ID NO. 7 and wherein said light chain variable region is of the amino acid sequence denoted by SEQ ID NO. 22.

(80) In other embodiments the isolated monoclonal antibody according to the invention comprises the light chain variable region of the variant antibody PA29mut29, namely wherein its light chain variable region comprises the amino acid residue glycine (Gly, G) at position 57 and the amino acid residue tyrosine (Tyr, Y) at position 87 of SEQ ID NO. 7 and wherein said light chain variable region is of the amino acid sequence denoted by SEQ ID NO. 14.

(81) In specific embodiments the isolated monoclonal antibody according to the invention is wherein said heavy chain variable region is of the amino acid sequence denoted by SEQ ID NO. 2 and wherein said light chain variable region is of the amino acid sequence denoted by SEQ ID NO. 7.

(82) In specific embodiments of the present disclosure the isolated monoclonal antibody comprises the light chain variable region and the heavy chain variable region of the variant antibody PA29mut29, denoted by SEQ ID NO. 14 and SEQ ID NO. 12, respectively.

(83) In other specific embodiments of the present disclosure the isolated monoclonal antibody comprises the light chain variable region and the heavy chain variable region of the variant antibody PA29mut39, denoted by SEQ ID NO. 22 and SEQ ID NO. 20, respectively.

(84) In further specific embodiments of the present disclosure the isolated monoclonal antibody comprises the light chain variable region and the heavy chain variable region of the variant antibody PA29mut40, denoted by SEQ ID NO. 26 and SEQ ID NO. 24, respectively.

(85) In still further specific embodiments of the present disclosure the isolated monoclonal antibody comprises the light chain variable region and the heavy chain variable region of the variant antibody PA29mut41, denoted by SEQ ID NO. 30 and SEQ ID NO. 28, respectively.

(86) In some embodiments the isolated monoclonal antibody according to the invention is a chimeric, a humanized or a human antibody.

(87) In one embodiment, the antibody of the invention is a chimeric antibody containing mouse variable region genes (V.sub.H and V.sub.L) fused to human constant region genes (Cγ1 and Cκ, respectively).

(88) The term “chimeric” antibodies as herein defined refers to antibodies in which a portion of the heavy and/or light chain is derived from a particular species, while the remainder of the chain(s) is derived from another species, as well as fragments of such antibodies, which exhibit the same biological activity.

(89) Chimeric antibodies may be prepared by any method known in the art, for example as described below.

(90) A murine-human chimeric antibody may be prepared by the amplification and cloning of murine V.sub.H and V.sub.L genes, encoding the antibody variable regions, followed by murine-human chimeric antibody expression. To this end, total RNA is isolated from the murine anti-PA hybridoma cells that are shown to secrete antibodies with the desired characteristics and cDNA is synthesized using oligo (dT).sub.15 primer, M-MLV and AMV reverse transcriptases Amplification of the heavy and the light variable genes (VH and V.sub.L) may be carried out using a panel of primers directed at the 5′ terminus of framework 1 of each gene, essentially as described in Benhar, I. et al. (14), and to the constant region (C.sub.H1 or C.sub.k, respectively) at the 3′ end.

(91) The variable genes are then re-amplified using non-degenerate primers introducing restriction sites at both ends for cloning into a pCMV-based antibody expression vector as described for example in Rosenfeld et al (7), incorporated herein by reference.

(92) The amplified heavy and light variable genes are separately purified, digested and cloned into appropriate mammalian (human) full-length Ig expression vectors, providing each chain with a corresponding signal-peptide and constant gene, resulting in IgG1/k murine human chimeric antibody expression.

(93) For preparing large quantities of the antibody, a stable cell line expressing the antibody can be prepared, by transfecting cells (e.g. CHO cells) with the Ig expression vector containing both heavy and light chains of the chimeric antibody. Highly anti-PA antibody producing clones may be then selected and expanded based on antibody levels in the supernatant, as tested by any method known in the art, for example, PA-specific ELISA assay, as detailed herein.

(94) By another one of its aspects the present invention provides an isolated chimeric antibody, or any antigen-binding fragment thereof which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region of the amino acid sequence denoted by SEQ ID NO. 2 or a variant thereof and a light chain variable region of the amino acid sequence denoted by SEQ ID NO. 7 or a variant thereof.

(95) In a further specific aspect the present invention provides an isolated chimeric murine-human antibody, or any antigen-binding fragment thereof which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region of the amino acid sequence denoted by SEQ ID NO. 2 and a light chain variable region of the amino acid sequence denoted by SEQ ID NO. 7.

(96) It is appreciated that “humanized” forms of non-human (for example, murine) antibodies are antibodies that contain a human-derived immunoglobulin framework with minimal sequences derived from non-human immunoglobulin at the CDRs and optionally at additional relevant positions. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and activity.

(97) The term “human antibody” as used herein refers to an antibody that possesses an amino acid sequence corresponding to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies disclosed herein. This definition specifically excludes a humanized antibody that comprises non-human antigen-binding residues.

(98) Preparation of humanized and human antibodies is well known in the art.

(99) The present invention further encompasses any antigen-binding fragments of the isolated monoclonal antibody of the invention.

(100) The term “antigen-binding fragments” in the context of the isolated monoclonal antibody of the present disclosure refer to a polypeptide derived from an antibody polypeptide molecule that does not comprise a full-length antibody polypeptide, but that still comprises at least a portion of a full-length antibody polypeptide that is capable of binding to an antigen.

(101) Such antigen-binding fragments may include for example fragment antigen-binding (Fab) and F(ab′).sub.2, which are capable of binding antigen. Such fragments may be produced by any method known in the art, for example by proteolytic cleavage, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab′).sub.2 fragments). Other examples of antigen-binding fragments encompassed herein are variable fragment (Fv), single chain variable fragment Fv (scFv) and linear antibodies. Additional examples of antigen-binding antibody fragments are known in the art.

(102) Thus in some embodiments the isolated monoclonal antibody according to the invention is wherein said antibody is an antibody fragment selected from the group consisting of Fv, single chain Fv (scFv), heavy chain variable region, light chain variable region, Fab, F(ab).sub.2′ and any combination thereof.

(103) Rosenfeld et al. (7), incorporated herein by reference, describe the generation of antibodies directed against the complete PA protein. Of the 600 hybridoma cell lines obtained from a single fusion process, 101 clones displayed PA-neutralizing activities at different levels. The monoclonal antibody termed mAb 29 demonstrated the highest neutralizing activity. A chimeric antibody (cAb 29) based on mAb 29 was produced.

(104) cAb29 was shown to neutralize PA-LF complex (LeTx) activity in vitro in the J774A macrophage cell line, and in vivo in a LeTx challenge performed in rats (7) and was also shown to confer full protection to guinea pigs when given prior to infection with 40 LD.sub.50 B. anthracis spores and to protect all infected rabbits, when treated 12 hours post exposure (200 LD.sub.50) as shown by Rosenfeld R. et al. and Mechaly, A., et al., the content of which is incorporated herein by reference (7, 8).

(105) Briefly, in the LeTx challenge performed in rats, antibodies were administered intramuscularly (i.m.) at different doses, followed by an intravenous (i.v.) challenge with a lethal dose of LeTx.

(106) A dose of 170 μg/kg cAb 29 was needed in order to provide 50% protection (PD.sub.50).

(107) In the guinea pig protection assay, antibody at doses of either 5, 10 or 20 mg/kg were administered intramuscularly (i.m.) to guinea pigs 14 hrs prior to challenge with 40LD.sub.50 of B. anthracis Vollum spores. Under these challenge conditions, control animals (which did not receive treatment) died within 3 days post infection, with Mean Time to Death (MTTD) of 2.5 days.

(108) However, when treated with antibody at a dose of 5 mg/kg, 50% of the guinea pigs survived the challenge with a delayed MTTD of 7 days, significantly longer (P<0.005) than the respective control group value.

(109) The efficacy of cAb29 as post exposure therapy was evaluated in rabbits that were intranasally infected with 5×10.sup.6 cfu of Vollum spores (200 LD.sub.50). In this assay, the antibody was administered to rabbits in two successive treatments, given 12 and 60 hours after infection. All the animals treated twice with 1 mg/kg survived the challenge with no evident disease within 14 days after challenge.

(110) In addition, endogenous immune response against PA was developed in infected guinea pigs treated with cAb 29 and this immune response conferred protection against anthrax re-challenge.

(111) The ability of cAb 29 to confer endogenous protective immunity against B. anthracis re-challenge as described above, along with the protective effect demonstrated for cAb29 pre- and post exposure to B. anthracis, suggest that cAb 29 is a potent antibody for the prophylaxis and treatment of B. anthracis infection.

(112) Thus in some embodiments the isolated monoclonal antibody according to the invention is a neutralizing antibody.

(113) The term “Neutralizing antibody” (or Nab) as herein defined refers to an antibody which defends a cell from an antigen or infectious body by inhibiting or neutralizing the biological effect of the antigen or infectious body. Neutralizing antibodies are mainly defined by their in vitro activity, which in the present case may be assessed by their inhibition of PA-LF toxin complex-mediated cell-death (LeTx assay). It has previously been shown that the results of the LeTx assay can serve as a surrogate marker to predict an antibody's neutralization potential against anthrax challenges in vivo (11). The typical method for elucidating the PA-neutralizing capacity of monoclonal antibodies includes a wide screen and the selection of antibodies that bind to adsorbed PA (using for example a direct ELISA format), and only then the best binders are further screened for their ability to neutralize PA in the LeTx assay.

(114) The present invention further provides a bispecific molecule comprising the antibody according to the invention.

(115) The term “bispecific molecule” as herein defined comprises an antibody or any antigen binding fragment thereof as herein defined and a second entity, preferably a second antibody or antigen binding fragment thereof that specifically binds a different target, such as but not limited to an epitope in Bacillus anthracis that is different from the epitope recognized by the antibodies in accordance with the invention. The second antibody or antigen binding fragment thereof may target toxins of Bacillus anthracis (e.g EF or LF), any other protein of another pathogen, host-related protein, or host cell as non-limiting examples. Bispecific antibodies include cross-linked or “heteroconjugate” antibodies and can be made using any convenient cross-linking or recombinant methods.

(116) In another one of its aspects the present invention provides an isolated nucleic acid molecule comprising a nucleotide sequence encoding an antibody or any antigen-binding fragment thereof according to the invention.

(117) The term “nucleic acid” or “nucleic acid molecule” as herein defined refers to polymer of nucleotides, which may be either single- or double-stranded, which is a polynucleotide such as deoxyribonucleic acid (DNA), and, where appropriate, ribonucleic acid (RNA). The terms should also be understood to include, as equivalents, analogs of either RNA or DNA made from nucleotide analogs, and, as applicable to the embodiment being described, single-stranded (such as sense or antisense) and double-stranded polynucleotides. The term DNA used herein also encompasses cDNA, i.e. complementary or copy DNA produced from an RNA template by the action of reverse transcriptase (RNA-dependent DNA polymerase).

(118) The invention further provides an expression vector comprising the isolated nucleic acid molecule as herein defined.

(119) “Expression vector” sometimes referred to as “expression vehicle” or “expression construct”, as used herein, encompass vectors such as plasmids, viruses, bacteriophage, integratable DNA fragments, and other vehicles, in which another polynucleotide segment is attached, resulting in the replication and/or expression of the attached segment and which in some cases enable the integration of DNA fragments into the genome of the host.

(120) Expression vectors are typically self-replicating DNA or RNA constructs containing the desired gene or its fragments, and operably linked genetic control elements that are recognized in a suitable host cell and effect expression of the desired genes. These control elements are capable of effecting expression within a suitable host. The expression vector in accordance with the invention may be competent with expression in bacterial, yeast, or mammalian host cells, to name but few. For example, the expression vector may be pCMV-based antibody expression vector, as exemplified herein below.

(121) In yet another one of its aspects the present invention provides a host cell transfected with the isolated nucleic acid molecule according to the invention or with the expression vector according to the invention.

(122) The term “host cells” as used herein refers to cells which are susceptible to the introduction of the isolated nucleic acid molecule according to the invention or the expression vector according to the invention. Preferably, said cells are mammalian cells, for example CHO cells, HEK 293. Transfection of the isolated nucleic acid molecule or the expression vector according to the invention to the host cell may be performed by any method known in the art.

(123) In yet another one of its aspects the present invention provides an immunoconjugate comprising the antibody or any antigen-binding fragment thereof according to the invention and an additional anti-anthrax agent.

(124) The term “immunoconjugate” as herein defined refers to an antibody or any antigen-binding fragment thereof according to the invention that is conjugated (linked or joined) to an additional agent Immunoconjugates may be prepared by any method known to a person skilled in the art, for example, by cross-linking the additional agent to the antibody according to the invention or by recombinant DNA methods.

(125) The term “additional anti-anthrax agent” used herein refers to any agent that may be used for the identification or prophylaxis, treatment or amelioration of B. anthracis infection. In some embodiments the additional anti-anthrax agent in accordance with the invention is a cytotoxic agent (e.g. a toxin, an anti-metabolite), an antibiotic agent, a radioactive label (e.g. H.sup.3, I.sup.125, S.sup.35, C.sup.14, P.sup.32) antitoxin therapies or an additional antibody.

(126) The antibiotic agent that may be used in conjunction with the antibody as herein defined is any antibiotic agent that is known in the art to affect infection by Bacillus anthracis (e.g. ciprofloxacin, doxycycline, penicillin G procaine, amoxicillin, ofloxacin and levofloxacin).

(127) The term “additional antibody” as herein defined refers to an antibody, which is not the antibody according to the invention, and which may be used in combination with the antibody according to the invention. Such antibody may be directed against Bacillus anthracis protective antigen, against a different antigen or toxin of Bacillus anthracis (e.g. an antibody that specifically binds B. anthracis edema factor, an antibody that specifically binds B. anthracis lethal factor), against a different pathogen or against a host-related moiety (e.g an anti TNF-α antibody or an anti IL-1β antibody).

(128) The present invention further provides a pharmaceutical composition comprising as an active ingredient the isolated monoclonal antibody or any antigen-binding fragment thereof, the bispecific molecule according to the invention or the immunoconjugate as herein defined and a pharmaceutically acceptable carrier, excipient or diluents.

(129) The “pharmaceutical composition” of the invention generally comprises the antibody or any antigen-binding fragment thereof as herein defined and a buffering agent, an agent which adjusts the osmolarity of the composition and optionally, one or more pharmaceutically acceptable carriers, excipients and/or diluents as known in the art. Supplementary active ingredients (also referred to herein as additional anti-anthrax agents) can also be incorporated into the compositions, e.g. antibiotics.

(130) As used herein the term “pharmaceutically acceptable carrier, excipient or diluent” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents and the like, as known in the art. The carrier can be solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils. Each carrier should be both pharmaceutically and physiologically acceptable in the sense of being compatible with the other ingredients and not injurious to the subject. Except as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic composition is contemplated.

(131) In some embodiments the pharmaceutical composition according to the invention further comprises an adjuvant.

(132) An “adjuvant” as herein defined refers to a pharmacological and/or immunological agent that modifies the effect of other agents. Adjuvants are inorganic or organic chemicals, macromolecules or entire cells of certain killed bacteria, which enhance the immune response to an antigen. Examples of adjuvants include, but are not limited to Freund's adjuvant, aluminium hydroxide etc.

(133) In other embodiments the pharmaceutical composition according to the invention further comprises at least one additional anti-anthrax agent as herein defined.

(134) In specific embodiments the present invention relates to a pharmaceutical composition comprising an isolated chimeric antibody, or any antigen-binding fragment thereof, which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region of the amino acid sequence denoted by SEQ ID NO. 2 or a variant thereof and a light chain variable region of the amino acid sequence denoted by SEQ ID NO. 7 or a variant thereof.

(135) In other specific embodiments the present invention provides a pharmaceutical composition comprising an isolated chimeric antibody, which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region of the amino acid sequence denoted by SEQ ID NO. 2 and a light chain variable region of the amino acid sequence denoted by SEQ ID NO. 7.

(136) Anthrax is an acute disease as indicated above and therefore the isolated monoclonal antibody or any antigen-binding fragment thereof as herein defined is a potential therapeutic agent against Bacillus anthracis infection.

(137) Therefore further provided is a method of prophylaxis, treatment or amelioration of Bacillus anthracis infection comprising administering to a subject in need thereof a therapeutically effective amount of the isolated monoclonal antibody or any antigen-binding fragment thereof, the bispecific molecule, the immunoconjugate or the pharmaceutical composition according to the invention.

(138) In some embodiments the invention provides a method of prophylaxis, treatment or amelioration of Bacillus anthracis infection comprising administering to a subject in need thereof a therapeutically effective amount of an isolated chimeric antibody, or any antigen-binding fragment thereof, which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region of the amino acid sequence denoted by SEQ ID NO. 2 or a variant thereof and a light chain variable region of the amino acid sequence denoted by SEQ ID NO. 7 or a variant thereof.

(139) By the term “prophylaxis” as herein defined it is meant to provide a “preventive treatment” or “prophylactic treatment”, namely acting in a protective manner, to defend against or prevent an infection by Bacillus anthracis. In such case a therapeutically effective amount of the isolated monoclonal antibody or any antigen-binding fragment thereof, the bispecific molecule, the immunoconjugate or the pharmaceutical composition as herein defined is administered prior to a potential Bacillus anthracis infection.

(140) It is to be understood that the terms “treat”, “treating”, “treatment” or forms thereof, as used herein, mean preventing, ameliorating or delaying the onset of one or more clinical indications of disease activity resulting from exposure to Bacillus anthracis in a subject at risk of being infected or in a subject that was infected by Bacillus anthracis.

(141) There are four common routes of anthrax infection, each with different signs and symptoms. Symptoms of cutaneous anthrax include a raised bump that develops into a painless sore with a black center and swelling in the sore and nearby lymph glands; Symptoms of gastrointestinal anthrax include nausea, vomiting, abdominal pain, headache and fever; Symptoms of inhaled anthrax (breathing of anthrax spores) include flu-like symptoms, mild chest discomfort, shortness of breath, nausea, coughing up blood and painful swallowing.

(142) The clinical indications of disease activity resulting from exposure to Bacillus anthracis are known to a person skilled in the art, for example a skilled physician.

(143) Administration according to the present invention may be performed by any route known in the art for example by one of the following routes: oral administration, intravenous, intramuscular, intraperitoneal, intratechal or subcutaneous injection; intrarectal administration; intranasal administration, ocular administration or topical administration.

(144) In specific embodiments administration according to the present invention may be performed intravenously.

(145) The antibodies or antibody fragments as herein defined, any pharmaceutical compositions comprising the same or any conjugates comprising them may be administered to a subject prior to or post exposure to B. anthracis.

(146) Thus in some embodiments the method of prophylaxis, treatment or amelioration of Bacillus anthracis infection according to the invention is where said isolated monoclonal antibody or any antigen-binding fragment thereof, bispecific molecule, immunoconjugate or pharmaceutical composition according to the invention is administered to said subject prior to or after infection with Bacillus anthracis.

(147) In other embodiments the isolated monoclonal antibody or any antigen-binding fragment thereof, bispecific molecule, immunoconjugate or pharmaceutical composition as herein defined for use in prophylaxis, treatment or amelioration of Bacillus anthracis infection is for administration to said subject prior to or after infection with Bacillus anthracis.

(148) In specific embodiments the isolated monoclonal antibody or any antigen-binding fragment thereof, bispecific molecule, immunoconjugate or pharmaceutical composition according to the invention is administered to the subject 1, 2, 3, 4, 5, 6 or 7 days, two, three or four weeks, or more before potential exposure to Bacillus anthracis, e.g. about a month prior to potential exposure to Bacillus anthracis, or immediately after Bacillus anthracis infection, or between about 1 to about 30 days or more after Bacillus anthracis infection, namely 1, 2, 3, 4, 5, 6 or 7 days, two, three or four weeks, or more after Bacillus anthracis infection.

(149) As used herein the term “immediately” encompasses the instant time frame following detection of infection, e.g. minutes or hours after detection.

(150) In some embodiments the method of prophylaxis, treatment or amelioration of Bacillus anthracis infection as herein defined further comprises administering to a subject in need thereof at least one additional anti-anthrax agent as herein defined.

(151) In other words, in some embodiments the isolated monoclonal antibody or any antigen-binding fragment thereof, bispecific molecule, immunoconjugate or pharmaceutical composition as herein defined for use according to the invention is adapted for administration to said subject in combination with at least one additional anti-anthrax agent as herein defined.

(152) Administration of the at least one additional anti-anthrax agent may be performed before, concomitantly with or after the administration of the therapeutically effective amount of the isolated monoclonal antibody or any antigen-binding fragment thereof, the bispecific molecule, the immunoconjugate or the pharmaceutical composition as herein defined.

(153) A “therapeutically effective amount” of the isolated monoclonal antibody or any antigen-binding fragment thereof, the bispecific molecule, the immunoconjugate or the pharmaceutical composition according to the invention for purposes herein defined is determined by such considerations as are known in the art in order to cure, arrest or at least alleviate or ameliorate the medical condition associated with Bacillus anthracis infection. For any preparation used in the methods of the invention, the dosage or the therapeutically effective amount can be estimated initially from in vitro cell culture assays or based on animal models such as the animal models detailed herein.

(154) Without wishing to be bound by theory, the fact that the antibody in accordance with the invention is active at relatively low doses is the result of its broad activity range and the fact that it interferes with a critical step in PA intoxication.

(155) In some embodiments the therapeutically effective amount in accordance with the invention is in the range of 0.01 to 100 mg/kg of the subject.

(156) In other embodiments the therapeutically effective amount in accordance with the invention is in the range of 0.01 to 40 mg/kg, 0.1 to 40 mg/kg or 1 to 10 mg/kg.

(157) In other embodiments the isolated monoclonal antibody or any antigen-binding fragment thereof, bispecific molecule, immunoconjugate or pharmaceutical composition according to the invention is administered to the subject as a single dose or multiple doses.

(158) The term “subject in need thereof” in the context of the present invention means warm-blooded animals, such as for example rats, mice, dogs, cats, guinea pigs, primates and humans at risk of being exposed to Bacillus anthracis (anthrax) or anyone who has come in contact with Bacillus anthracis (anthrax) spores, for example veterinarians, laboratory professionals, livestock producers, people who handle animal products, mail handlers, military personnel, and response workers who may be exposed during a bio-terror event involving anthrax spores. Subject in need thereof are also people that were exposed to Bacillus anthracis.

(159) The present invention further provides the isolated monoclonal antibody or any antigen-binding fragment thereof according to the invention, the bispecific molecule according to the invention, the immunoconjugate as herein defined or the pharmaceutical composition according to the invention for use in prophylaxis, treatment or amelioration of Bacillus anthracis infection.

(160) In specific embodiments the invention provides an isolated chimeric antibody, or any antigen-binding fragment thereof, which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region of the amino acid sequence denoted by SEQ ID NO. 2 or a variant thereof and a light chain variable region of the amino acid sequence denoted by SEQ ID NO. 7 or a variant thereof for use in prophylaxis, treatment or amelioration of Bacillus anthracis infection.

(161) Any one of the specific isolated monoclonal antibodies described herein may be used in prophylaxis, treatment or amelioration of Bacillus anthracis infection.

(162) Still further the present invention provides use of the isolated monoclonal antibody or any antigen-binding fragment thereof, the bispecific molecule, the immunoconjugate or the pharmaceutical composition according to the invention in the preparation of a medicament for the prophylaxis, treatment or amelioration of Bacillus anthracis infection.

(163) In specific embodiments the invention provides use of an isolated chimeric antibody, or any antigen-binding fragment thereof, which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region of the amino acid sequence denoted by SEQ ID NO. 2 or a variant thereof and a light chain variable region of the amino acid sequence denoted by SEQ ID NO. 7 or a variant thereof in the preparation of a medicament for prophylaxis, treatment or amelioration of Bacillus anthracis infection.

(164) As detailed above, the antibodies in accordance with the invention are able to bind to B. anthracis PA at any stage of PA intoxication and neutralize B. anthracis PA intoxication by inhibiting the prepore-to-pore conversion step.

(165) Thus in still a further aspect the present invention further provide a method of neutralizing Bacillus anthracis toxicity comprising administering to a subject in need thereof a therapeutically effective amount of the isolated monoclonal antibody or any antigen-binding fragment thereof according to the invention, the bispecific molecule according to the invention, the immunoconjugate or the pharmaceutical composition according to the invention.

(166) By the term “neutralizing” as herein defined it is meant that by administering to a subject in need thereof a therapeutically effective amount of the isolated monoclonal antibody or any antigen-binding fragment thereof, the bispecific molecule, the immunoconjugate or the pharmaceutical composition according to the invention, the biological effects of Bacillus anthracis will be at least partially counteracted, alleviated or ameliorated, as can be monitored by following the subject's clinical symptoms associated with Bacillus anthracis infection.

(167) Still further the present disclosure provides the isolated monoclonal antibody or any antigen-binding fragment thereof, the bispecific molecule, the immunoconjugate or the pharmaceutical composition according to the invention for use in neutralizing Bacillus anthracis toxicity.

(168) The present disclosure further provides a kit comprising:

(169) (i) an isolated monoclonal antibody or any antigen-binding fragment thereof which binds to Bacillus anthracis protective antigen, wherein the antibody comprises a heavy chain variable region comprising: a) the complementarity determining region CDRH1 comprising the amino acid sequence of IFTNYNMH denoted by SEQ ID NO. 3 or a variant thereof; b) the complementarity determining region CDRH2 comprising the amino acid sequence AIYPRTGDTSYNQKFKG denoted by SEQ ID NO. 4 or a variant thereof; and c) the complementarity determining region CDRH3 comprising the amino acid sequence ARDGFAY denoted by SEQ ID NO. 5 or a variant thereof; and
a light chain variable region comprising: d) the complementarity determining region CDRL1 comprising the amino acid sequence RASQDISNYLN denoted by SEQ ID NO. 8 or a variant thereof; e) the complementarity determining region CDRL2 comprising the amino acid sequence YTSRLHS denoted by SEQ ID NO. 9 or a variant thereof; and f) the complementarity determining region CDRL3 comprising the amino acid sequence QQGKTLPWT denoted by SEQ ID NO. 10 or a variant thereof; and

(170) (ii) instructions for use.

(171) It is appreciated that the term “purified” or “isolated” refers to molecules, such as amino acid or nucleic acid sequences, peptides, polypeptides or antibodies that are removed from their natural environment, isolated or separated. An “isolated antibody” is therefore a purified antibody removed from its natural environment. As used herein, the term “purified” or “to purify” also refers to the removal of contaminants from a sample.

(172) As used herein, the term “about”, when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of ±10%, more preferably ±5%, even more preferably ±1%, and still more preferably ±0.1% from the specified value, as such variations are appropriate to perform the disclosed invention.

(173) The following examples are presented in order to more fully illustrate certain embodiments of the invention. They should in no way, however, be construed as limiting the broad scope of the invention. One skilled in the art can readily devise many variations and modifications of the principles disclosed herein without departing from the scope of the invention.

EXAMPLES

(174) Without further elaboration, it is believed that one skilled in the art can, using the preceding description, utilize the present disclosure to its fullest extent. The following preferred specific embodiments are, therefore, to be construed as merely illustrative, and not limitative of the claimed invention in any way.

(175) Standard molecular biology protocols known in the art not specifically described herein are generally followed essentially as in Sambrook & Russell, 2001.

(176) Standard medicinal chemistry methods known in the art not specifically described herein are generally followed essentially in the series “Comprehensive Medicinal Chemistry” by various authors and editors, published by Pergamon Press.

Example 1

Sequencing and Characterization of a Chimeric Antibody Directed to B. anthracis PA

(177) A chimeric antibody, also termed herein cAb 29, containing murine variable region genes (V.sub.H and V.sub.L) fused to human constant region genes (Cγ1 and Cκ, respectively) was constructed as described in Rosenfeld et al (7). The antibody was introduced into a mammalian expression-system and the recombinant antibody was stably produced by CHO cells.

(178) The chimeric Ab 29 (cAb 29) was sequenced using the ABI 310 Genetic Analyser (Applied Biosystems). The nucleic acid and amino acid sequences of the heavy and the light chains of cAb 29 as well as of the complementarity determining regions (CDRs) of cAb 29 are detailed in Table 1 below.

(179) TABLE-US-00001 TABLE 1 Sequences of heavy and light chains and CDRs of cAb29 SEQ ID NO. Sequence Description 1 CAGGTTCAACTGCAGCAGTCTGGGGCTGAGCTGGTGAAGCCT Nucleic GGGGCCTCAGTGAAGATGTCCTGCAAGGCTTCTGGCTACATA acid TTTACCCATTACAATATGCACTGGGTACAGCAGACACCTGGA sequence of CAGGGCCTGGAATGGATTGGCGCTATTTATCCACGAACTGGT the heavy GATACTTCCTACAATCAGAAGTTCAAAGGCAAGGCCACATTG chain ACTGCAGACAAATCCTCCAGCACAGCCTACATGCAGCTCAGC variable AGCCTGACATCTGAGGATTCTGCGGTCTATTACTGTGCAAGA region (V.sub.H) GACGGGTTTGCTTACTGGGGCCAAGGG 2 QVQLQQSGAELVKPGASVKMSCKASGYIFTNYNMHWVQQTPG Amino acid QGLEWIGAIYPRTGDTSYNQKFKGKATLTADKSSSTAYMQLS sequence of SLTSEDSAVYYCARDGFAYWGQG the heavy chain variable region (V.sub.H) 3 IFTNYNMH Amino acid sequence of the heavy chain CDRH 1 4 AIYPRTGDTSYNQKFKG Amino acid sequence of the heavy chain CDRH2 5 ARDGFAY Amino acid sequence of the heavy chain CDRH3 6 GATATCCAGATGACACAGACTACATCCTCCCTGTCTGCCTCT Nucleic CTGGGAGACAGAGTCACCATCAGTTGCAGGGCAAGTCAGGAC acid ATTAGCAATTATTTAAACTGGTATCAGCAGAAACCAGATGGA sequence of ACTGTTAAACTCCTGATCTACTACACATCAAGATTACACTCA the light GAAGTCCCATCAAGGTTCAGTGGCAGTGGGTCTGGAACAGAT chain TATTCTCTCACCATTAGCAACCTGGAGGAAGAAGATATTGCC variable ACTTACTTTTGCCAACAGGGTAAAACGCTTCCGTGGACGTTC region (V.sub.L) GGTGGAGGC 7 DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDG Amino acid TVKLLIYYTSRLHSEVPSRFSGSGSGTDYSLTISNLEEEDIA sequence of TYFCQQGKTLPWTFGGG the light chain variable region (V.sub.L) 8 RASQDISNYLN Amino acid sequence of the light chain CDRL 1 9 YTSRLHS Amino acid sequence of the light chain CDRL2 10 QQGKTLPWT Amino acid sequence of the light chain CDRL3

Example 2

Preparation of Mutated Antibodies Derived from cAb29

(180) In order to map the residues in the cAb29 antibody that interact with B. anthracis protective antigen (PA) and are functionally required for binding of the antibody to PA, the antibody cAb29 was mutated as described below.

(181) The wild type antibody PA29 as a single chain variable fragment (scFv) was randomly mutated using error-prone PCR under standard conditions. Mutated PCR-products were re-amplified, gel-purified, digested and ligated into a phage-display plasmid for the expression of a scFv-library displayed by m13 phage particles. Standard bio-panning technology was applied for the enrichment and screening of various mutated antibodies, resulting among other in the antibodies termed herein as PA29mut29, PA29mut33, PA29mut39, PA29mut40, and PA29mut41.

(182) In order to examine the PA binding ability of the mutated antibodies, the mutated antibodies in the form of scFvs were screened using a direct ELISA assay. Briefly, phages were added to PA-coated plates and incubated for 2 hours. Plates were then washed, incubated with anti-M13-HRP detection antibody (GE healthcare) and developed using TMB (Pierce) as a substrate.

(183) About 25% of the various mutated antibodies that were screened demonstrated improved binding as compared to the wild type scFv. The five mutated antibodies that demonstrated the highest binding signal (PA29mut29, PA29mut33, PA29mut39, PA29mut40, PA29mut41) were therefore sequenced.

(184) The nucleic acid and amino acid sequences of the heavy and the light chains of the mutated antibodies PA29mut29, PA29mut33, PA29mut39, PA29mut40 and PA29mut41 are detailed in Table 2 below. The mutated amino acid residues are indicated by underlined bold letters.

(185) In addition, the nucleic acid and amino acid sequences of the heavy and the light chains of the mutated antibody PA29mut29 and of the wild type chimeric antibody (termed PA29 w.t.) are shown in FIG. 1, and the nucleic acid and amino acid sequences of the heavy and the light chains of the mutated antibodies PA29mut33 and PA29mut39 and of the mutated antibodies PA29mut40 and PA29mut41 are shown in FIG. 2 and FIG. 3, respectively. The mutated nucleotides and amino acid residues are indicated by underlined bold letters.

(186) TABLE-US-00002 TABLE 2 Sequences of mutated antibodies SEQ ID NO. Sequence Description 11 CAGGTTCAACTGCAGCAGTCTGGGGCTGAGCTGGTGA Nucleic AGCCTGGGGCCTCAGTGAAGATGTCCTGCAAGGCTTC acid TGGCTACATATTTACCAATTACAATATGCACTGGGTAC sequence of AGCAGACACCTGGACAGGGCCTGGAATGGATTGGCGC the heavy CATTTATCCACGAACTGGTGATACTTCCTACAATCAGA chain AGTTCAAAGGCAAGGCCACATTGACCGCAGACAAATC variable CTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACA region of TCTGAGGATTCTGCGGTCTATTACTGTGCAAGAGACG PA29mut29 GGTTTGCTTACTGGGGCCAAGGGACCACTCTCACAGT C 12 QVQLQQSGAELVKPGASVKMSCKASGYIFTNYNMHWV Amino acid QQTPGQGLEWIGAIYPRTGDTSYNQKFKGKATLTADKSS sequence of STAYMQLSSLTSEDSAVYYCARDGFAYWGQGTTLTV the heavy chain variable region of PA29mut29 13 GATATCCAGATGACACAGACTACATCCTCCCTGTCTG Nucleic CCTCTCTGGGAGACAGAGTCACCATCAGTTGCAGGGC acid AAGTCAGGACATTAGCAATTATTTAAACTGGTATCAG sequence of CAGAAACCAGATGGAACTGTTAAACTCCTGATCTACT the light ACACATCAAGATTACACTCAGGAGTCCCATCAAGGTT chain CAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACC variable ATTAGCAACCTGGAGGAAGAAGATATTGCCACTTACT region of ATTGCCAACAGGGTAAAACGCTTCCGTGGACGTTCGG PA29mut29 TGGAGGCACCAAGCTGGAAATCAAA 14 DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQK Amino acid PDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNL sequence of EEEDIATYYCQQGKTLPWTFGGGTKLEIK the light chain variable region of PA29mut29 15 GAGGTTCAACTGCAGCAGTCTGGGGCTGAGCTGGTGA Nucleic AGCCTGGGGCCTCAGTGAAGATGTCCTGCAAGGCTTC acid TGGCTACATATTTACCAATTACAATATGCACTGGGTAC sequence of AGCAGACACCTGGACAGGGCCTGGAATGGATTGGCGC the heavy TATTTATCCACGAACTGGTGATACTTCCTACAATCAGA chain AGTTCAAAGGCAAGGCCACATTGACTGCAGACAAATC variable CTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACA region of TCTGAGGATTCTGCGGTCTATTACTGTGCAAGAGACG PA29mut33 GGTTTGCTTACTGGGGCCAAGGGACCACTCTCACAGT C 16 EVQLQQSGAELVKPGASVKMSCKASGYIFTNYNMHWV Amino acid QQTPGQGLEWIGAIYPRTGDTSYNQKFKGKATLTADKSS sequence of STAYMQLSSLTSEDSAVYYCARDGFAYWGQGTTLTV the heavy chain variable region of PA29mut33 17 GATATCCGGATGACACAGACTACATCCTCCCTGTCTG Nucleic CCTCTCTGGGAGACAGAGTCACCATCAGTTGCAGGGC acid AAGTCAGGACATTAGCAATTATTTAAACTGGTATCAG sequence of CAGAAGCCAGATGGAACTGTTAAACTCCTGATCTACT the light ACACATCAAGATTACACTCAGAAGTCCCATCAAGGTT chain CAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACC variable ATTAGCAACCTGGAGGAAGAAGATATTGCCACTTACT region of TTTGCCAACAGGGTAAAACGCTTCCGTGGACGTTCGG PA29mut33 TGGAGGCACCAAGCtGgAAATCAAA 18 DIRMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQK Amino acid PDGTVKLLIYYTSRLHSEVPSRFSGSGSGTDYSLTISNL sequence of EEEDIATYFCQQGKTLPWTFGGGTKLEIK the light chain variable region of PA29mut33 19 CAGGTTCAACTGCAGCAGTCTGGGGCTGAGCTAGTGA Nucleic AGCCTGGGGCCTCAGTGAAGATGTCCTGCAAGGCTTC acid TGGCTACATATTTACCAATTACAATATGCACTGGGTAC sequence of AGCAGACACCTGGACAGGGCCTGGAATGGATTGGCGC the heavy TATTTATCCACGAACTGGTGATACTTCCTACAATCAGA chain AGTTCAAAGGCAAGGCCACATTGACTGCAGACAAATC variable CTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACA region of TCTGAGGATTCTGCGGTCTATTACTGTGCAAGAGACG PA29mut39 GGTTTGCTTACTGGGGCCAAGGGACCACTCTCACAGT C 20 QVQLQQSGAELVKPGASVKMSCKASGYIFTNYNMHWV Amino acid QQTPGQGLEWIGAIYPRTGDTSYNQKFKGKATLTADKSS sequence of STAYMQLSSLTSEDSAVYYCARDGFAYWGQGTTLTV the heavy chain variable region of PA29mut39 21 GATATCCAGATGACACAGACTACATCCTCCCTGTCTG Nucleic CCTCTCTGGGAGACAGAGTCACCGTCAGTTGCAGGGC acid AAGTCAGGACATTAGCAATTATTTAAACTGGTATCAG sequence of CAGAAACCAGATGGAACTGTTAAACTCCTGATCTACT the light ACACATCAAGATTACACTCAGAAGTCCCATCAAGGTT chain CAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACC variable ATTAGCAACCTGGAGGAAGAAGATATTGCCACTTACT region of TTTGCCAACAGGGTAAAACGCTTCCGTGGACGTTCGG PA29mut39 TGGAGGCACCAAGCTGGAAATCAAA 22 DIQMTQTTSSLSASLGDRVTVSCRASQDISNYLNWYQQK Amino acid PDGTVKLLIYYTSRLHSEVPSRFSGSGSGTDYSLTISNL sequence of EEEDIATYFCQQGKTLPWTFGGGTKLEIK the light chain variable region of PA29mut39 23 CAGGTTCAACTGCAGCAGTCTGGGGCTGAGCTGGTGA Nucleic AGCCTGGGGCCTCAGTGAAGATGTCCTGCAAGGCTTC acid TGGCTACATATTTACCAATTACAATATGCACTGGGTAC sequence of AGCAGACACCTGGACAGGGCCTGGAATGGATTGGCGC the heavy TATTTATCCACGAACTGGTGATACTTCCTACAATCAGA chain AGTTCAAAGGCAAGGCCACATTGACTGCAGACAAATC variable CTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACA region of TCTGAGGATTCTGCGGTCTATTACTGTGCAAGAGACG PA29mut40 GGTTTGCTTACTGGGGCCAAGGGACCACTCTCACAGT C 24 QVQLQQSGAELVKPGASVKMSCKASGYIFTNYNMHWV Amino acid QQTPGQGLEWIGAIYPRTGDTSYNQKFKGKATLTADKSS sequence of STAYMQLSSLTSEDSAVYYCARDGFAYWGQGTTLTV the heavy chain variable region of PA29mut40 25 GATATCCAGATGACACAGACTACACCCTCCCTGTCTG Nucleic CCTCTCTGGGGGACAGAGTCACCATCAGTTGCAGGGC acid AAGTCAGGACATTAGCAATTATTTAAACTGGTATCAG sequence of CAGAAACCAGATGGAACTGTTAAACTCCTGATCTACT the light ACACATCGAGATTACACTCAGAAGTCCCATCGAGGTT chain CAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACC variable ATTAGCAACCTGGAGGAAGAAGATATTGCCACTTACT region of TTTGCCAACAGGGTAAAACGCTTCCGTGGACGTTCGG PA29mut40 TGGAGGCACCAAGCTGGAAATCAAA 26 DIQMTQTTPSLSASLGDRVTISCRASQDISNYLNWYQQK Amino acid PDGTVKLLIYYTSRLHSEVPSRFSGSGSGTDYSLTISNL sequence of EEEDIATYFCQQGKTLPWTFGGGTKLEIK the light chain variable region of PA29mut40 27 CAGGTTCAACTGCAGCAGTCTGGGGCTGAGCTGGTGA Nucleic AGCCTGGGGTCTCAGTGAAGATGTCCTGCAAGGCTTC acid TGGCTACATATTTACCAATTACAATATGCACTGGGTAC sequence of AGCAGACACCTGGACAGGGCCTGGAATGGATTGGCGC the heavy TATTTATCCACGAACTGGTGATACTTCCTACAATCAGA chain AGTTCAAAGGCAAGGCCACATTGACTGCAGACAAATC variable CTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACA region of TCTGAGGATTCTGCGGTCTATTACTGTGCAAGAGACG PA29mut41 GGTTTGCTTACTGGGGCCAAGGGACCACTCTCACAGT C 28 QVQLQQSGAELVKPGVSVKMSCKASGYIFTNYNMHWV Amino acid QQTPGQGLEWIGAIYPRTGDTSYNQKFKGKATLTADKSS sequence of STAYMQLSSLTSEDSAVYYCARDGFAYWGQGTTLTV the heavy chain variable region (V.sub.H) of PA29mut41 29 GATATCCAGATGACACAGACTACATCCTCCCTGTCTG Nucleic CCTCTCTGGGAGACAGAGTCACCATCAGTTGCAGGGC acid AAGTCAGGACATTAGCAATTATTTAAACTGGTATCAG sequence of CAGAAACCAGATGGAACTGTTAAACTCCTGATCTACT the light ACACATCAAGATTACACTCAGAAGTCCCATCAAGGTT chain CAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACC variable ATTAGCAACCTGGAGGAAGAAGATATTGCCACTTACT region of TTTGCCAACAGGGTAAAACGCTTCCGTGGACGTTCGG PA29mut41 TGGAGGCACCAAGCTGGAAATCAAA 30 DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQK Amino acid PDGTVKLLIYYTSRLHSEVPSRFSGSGSGTDYSLTISNL sequence of EEEDIATYFCQQGKTLPWTFGGGTKLEIK the light chain variable region (V.sub.L) of PA29mut41

(187) Alignments of the heavy chain variable domains of the wild type and mutated antibodies are shown in FIG. 4A, FIG. 4B and FIG. 4C for the heavy chain variable domain CDRH1, CDRH2 and CDRH3, respectively. The CDRs are shown in grey boxes and the mutated amino acid residues are indicated by bold underlined letters.

(188) Alignments of the light chain variable domains of the wild type and mutated antibodies are shown in FIG. 5A, FIG. 5B and FIG. 5C for the light chain variable domain CDRL1, CDRL2 and CDRL3, respectively. The CDRs are shown in grey boxes and the mutated amino acid residues are indicated by bold underlined letters.