COMPOUNDS AND METHODS FOR TREATING CANCER
20170226073 · 2017-08-10
Assignee
Inventors
- John A. Copland, III (Ponte Vedra Beach, FL)
- Han W. Tun (Jacksonville, FL)
- Thomas R. Caulfield (Jacksonville, FL)
- Christina Von Roemeling (Jacksonville, FL)
- Laura Ann Marlow (Jacksonville, FL)
Cpc classification
A61K45/06
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
C07D211/64
CHEMISTRY; METALLURGY
A61K31/496
HUMAN NECESSITIES
A61K31/44
HUMAN NECESSITIES
C07D213/75
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
C07D211/66
CHEMISTRY; METALLURGY
A61K31/496
HUMAN NECESSITIES
A61K31/495
HUMAN NECESSITIES
International classification
A61K31/44
HUMAN NECESSITIES
A61K31/495
HUMAN NECESSITIES
A61K31/496
HUMAN NECESSITIES
C07D213/75
CHEMISTRY; METALLURGY
C07D211/66
CHEMISTRY; METALLURGY
Abstract
This document provides compounds, compositions, and methods for treating cancers including renal cancer (e.g., renal cell carcinoma) as well as ovarian, breast, prostate, colon, pancreatic, bladder, liver, lung, and thyroid cancers and melanoma. For example, compounds, compositions, and methods for using one or more inhibitors of SCD1 to treat renal cell carcinoma (e.g., clear cell renal cell carcinoma (ccRCC)), thyroid cancer, or liver cancer; or to increase the efficacy of treatment for the same.
Claims
1. A compound according to Formula (I): ##STR00033## or a pharmaceutically acceptable salt thereof, wherein: R.sup.1 is an unsubstituted C.sub.1-6alkyl or C.sub.1-6haloalkyl; X is ##STR00034## Y is selected from the group consisting of: ##STR00035## m is 0 or 1; n is 0, 1, or 2; V is NR.sup.4 or O; R.sup.2, R.sup.3, and R.sup.4 are each independently H or an unsubstituted C.sub.1-6alkyl; and Z is an unsubstituted aryl.
2. The compound of claim 1, wherein the compound according to Formula (I) has the structure of Formula (Ia): ##STR00036## or a pharmaceutically acceptable salt thereof.
3. The compound of claim 1 or 2, wherein R.sup.1 is CF.sub.3.
4. The compound of any one of claims 1-3, wherein m is 0.
5. The compound of any one of claims 1-4, wherein V is NH.
6. The compound of any one of claims 1-5, wherein Y is ##STR00037##
7. The compound of any one of claims 1-5, wherein Y is N ##STR00038##
8. The compound of any one of claims 1-3, wherein m is 1.
9. The compound of any one of claims 1-3 and 8, wherein V is O.
10. The compound of claim 9, wherein Y is ##STR00039##
11. The compound of any one of claims 1-4, 9, and 10, wherein R.sup.2 is H; and R.sup.3 is CH.sub.3.
12. The compound of claim 11, wherein Y is ##STR00040##
13. The compound of any one of claims 1-12, wherein n is 1.
14. The compound of any one of claims 1-13, wherein Z is phenyl.
15. The compound of claim 1, wherein the compound according to Formula (I) is selected from the group consisting of: ##STR00041## or a pharmaceutically acceptable salt thereof.
16. A compound according to Formula (II): ##STR00042## or a pharmaceutically acceptable salt thereof, wherein R.sup.1 is halo; X is —(C═O)NR.sup.4—; Y is ##STR00043## and R.sup.2, R.sup.3, and R.sup.4 are each independently H or an unsubstituted C.sub.1-6alkyl.
17. The compound of claim 16, wherein the compound according to Formula (II) has the structure of Formula (IIa): ##STR00044## or a pharmaceutically acceptable salt thereof.
18. The compound of claim 16 or 17, wherein R.sup.1 is Cl.
19. The compound of any one of claims 16-18, wherein R.sup.4 is H.
20. The compound of any one of claims 16-19, wherein R.sup.2 is H; and R.sup.3 is CH.sub.3.
21. The compound of claim 16, wherein the compound according to Formula (II) is ##STR00045## or a pharmaceutically acceptable salt thereof.
22. A pharmaceutical composition comprising a compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1-21, and a pharmaceutically acceptable carrier.
23. A method for inhibiting SCD1 in a cell, the method comprising contacting the cell with an effective amount of a compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1-21, or a pharmaceutical composition of claim 22.
24. The method of claim 23, wherein the cell is a cancer cell.
25. The method of claim 24, wherein the cancer cell is selected from the group consisting of a kidney cancer cell, a liver cancer cell, a breast cancer cell, a lung cancer cell, a pancreatic cancer cell, a bladder cancer cell, a colon cancer cell, a melanoma cell, a thyroid cancer cell, an ovarian cancer cell, and a prostate cancer cell.
26. The method of claim 24 or 25, wherein the cancer cell is a kidney cancer cell.
27. The method of any one of claims 23-26, wherein the contacting is in vitro.
28. The method of any one of claims 23-26, wherein the contacting is in vivo.
29. A method for treating a cancer in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a compound of any one of claims 1-21, or a pharmaceutical composition of claim 22.
30. The method of claim 29, wherein the subject is a mammal.
31. The method of claim 29 or 30, wherein the subject is human.
32. The method of any one of claims 29-31, wherein the cancer comprises a solid tumor.
33. The method of any one of claims 29-32, wherein the cancer is selected from the group consisting of: a kidney cancer, a liver cancer, a breast cancer, a lung cancer, a pancreatic cancer, a bladder cancer, a colon cancer, a melanoma, a thyroid cancer, an ovarian cancer, and a prostate cancer.
34. The method of any one of claims 29-33, wherein the cancer is a kidney cancer or a bladder cancer.
35. The method of any one of claims 29-34, wherein the cancer is a kidney cancer.
36. The method of any one of claims 29-35, wherein the kidney cancer is clear cell renal cell carcinoma.
37. The method of any one of claims 29-34, wherein the cancer is a bladder cancer.
38. The method of claim 37, wherein the bladder cancer is selected from the group consisting of: transitional cell carcinoma, urothelial carcinoma, papillary carcinoma, flat carcinoma, squamous cell carcinoma, adenocarcinoma, small-cell carcinoma, and sarcoma.
39. The method of claim 37 or 38, wherein the bladder cancer is transitional cell carcinoma.
40. A method of treating a cancer in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an SCD1 inhibitor and a proteasome inhibitor, or pharmaceutically acceptable salts thereof, or a composition comprising the SCD1 inhibitor and the proteasome inhibitor.
41. The method of claim 40, wherein the SCD1 inhibitor and the proteasome inhibitor are admixed prior to administration.
42. The method of claim 41 or 42, wherein the SCD1 inhibitor and the proteasome inhibitor are administered concurrently.
43. The method of claim 40, wherein the SCD1 inhibitor and the proteasome inhibitor are administered sequentially.
44. The method of claim 40 or 43, wherein the SCD1 inhibitor is administered prior to the administration of the proteasome inhibitor.
45. The method of claim 40 or 43, wherein the proteasome inhibitor is administered prior to the administration of the SCD1 inhibitor.
46. The method of any one of claims 40-45, wherein the cancer is selected from the group consisting of: a kidney cancer, a liver cancer, a breast cancer, a lung cancer, a pancreatic cancer, a bladder cancer, a colon cancer, a melanoma, a thyroid cancer, an ovarian cancer, and a prostate cancer.
47. The method of any one of claims 40-46, wherein the cancer is a thyroid cancer.
48. A method of treating a cancer in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a compound of any one of claims 1-21 and an mTor inhibitor, or pharmaceutically acceptable salts thereof, or a composition of claim 22 and the mTor inhibitor.
49. The method of claim 48, wherein the compound and the mTor inhibitor are admixed prior to administration.
50. The method of claim 48 or 49, wherein the compound and the mTor inhibitor are administered concurrently.
51. The method of claim 48, wherein the compound and the mTor inhibitor are administered sequentially.
52. The method of claim 48 or 51, wherein the compound is administered prior to the administration of the mTor inhibitor.
53. The method of claim 48 or 51, wherein the mTor inhibitor is administered prior to the administration of the compound.
54. The method of any one of claims 48-53, wherein the cancer is selected from the group consisting of: a kidney cancer, a liver cancer, a breast cancer, a lung cancer, a pancreatic cancer, a bladder cancer, a colon cancer, a melanoma, a thyroid cancer, an ovarian cancer, and a prostate cancer.
55. The method of any one of claims 48-54, wherein the cancer is a kidney cancer.
56. A method of treating a cancer in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an SCD1 inhibitor and sorafenib, or pharmaceutically acceptable salts thereof, or a composition comprising the SCD1 inhibitor and the proteasome inhibitor.
57. The method of claim 40, wherein the SCD1 inhibitor and sorafenib are admixed prior to administration.
58. The method of claim 41 or 42, wherein the SCD1 inhibitor and sorafenib are administered concurrently.
59. The method of claim 40, wherein the SCD1 inhibitor and sorafenib are administered sequentially.
60. The method of claim 40 or 43, wherein the SCD1 inhibitor is administered prior to the administration of sorafenib.
61. The method of claim 40 or 43, wherein sorafenib is administered prior to the administration of the SCD1 inhibitor.
62. The method of any one of claims 56-61, wherein the cancer is a liver cancer.
63. The method of claim 62, wherein the cancer is hepatobiliary carcinoma (HCC).
Description
DESCRIPTION OF DRAWINGS
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
DETAILED DESCRIPTION
[0074] SCD1 is an enzyme that catalyzes the de novo lipogenesis of Δ-9 monounsaturated fatty acids (MUFA) oleic acid (OA) and palmitoleic acid (PA). These MUFAs are essential for the synthesis of triglycerides, sphingolipids, ceramides, glycolipids, phospholipids, and other lipoproteins which influence membrane fluidity, membrane raft formation and receptor clustering, second messenger signaling, fatty acid oxidation, energy storage, cell division, inflammation, and a number of other biological functions (Guillou H, Zadravec D, Martin P G, Jacobsson A. The key roles of elongases and desaturases in mammalian fatty acid metabolism: Insights from transgenic mice. Prog Lipid Res. April 2010; 49(2):186-199).
[0075] Aberrant upregulation of SCD1 has been implicated in the development of certain types of cancer, for example, renal cancer. Inhibitors of SCD1, compositions, and methods of use are provided in this disclosure.
Definitions
[0076] For the terms “for example” and “such as” and grammatical equivalences thereof, the phrase “and without limitation” is understood to follow unless explicitly stated otherwise. As used herein, the term “about” is meant to account for variations due to experimental error. All measurements reported herein are understood to be modified by the term “about”, whether or not the term is explicitly used, unless explicitly stated otherwise. As used herein, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise.
[0077] Compounds provided herein can also include all isotopes of atoms occurring in the intermediates or final compounds. Isotopes include those atoms having the same atomic number but different mass numbers. For example, isotopes of hydrogen include hydrogen, tritium, and deuterium.
[0078] The term, “compound”, as used herein is meant to include all stereoisomers, geometric isomers, tautomers, and isotopes of the structures depicted. Compounds herein identified by name or structure as one particular tautomeric form are intended to include other tautomeric forms unless otherwise specified.
[0079] All compounds, and pharmaceutically acceptable salts thereof, can be found together with other substances such as water and solvents (e.g., hydrates and solvates).
[0080] The term “halo” refers to fluoro, chloro, bromo or iodo.
[0081] The term “alkyl” refers to a straight or branched chain alkyl group, having from 1-20 carbon atoms. The alkyl is unsubstituted unless otherwise indicated. Illustrative of the alkyl group include the methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, t-butyl, pentyl, 3-methylbutyl, 2,2-dimethylpropyl, 1,1-dimethylpropyl, hexyl, 1-methylpentyl, 4-methylpentyl, heptyl, 1-methylhexyl, 2-methylhexyl, 5-methylhexyl, 3-ethylpentyl, octyl, 2-methylheptyl, 6-methylheptyl, 2-ethylhexyl, 2-ethyl-3-methylpentyl, 3-ethyl-2-methylpentyl, nonyl, 2-methyloctyl, 7-methyloctyl, 4-ethylheptyl, 3-ethyl-2-methylhexyl, 2-ethyl-1-methylhexyl, decyl, 2-methylnonyl, 8-methylnonyl, 5-ethyloctyl, 3-ethyl-2-methylheptyl, 3,3-diethylhexyl, undecyl, 2-methyldecyl, 9-methyldecyl, 4-ethylnonyl, 3,5-dimethylnonyl, 3-propyloctyl, 5-ethyl-4-methyloctyl, 1-pentylhexyl, dodecyl, 1-methylundecyl, 10-methylundecyl, 3-ethyldecyl, 5-propylnonyl, 3,5-diethyloctyl, tridecyl, 11-methyldodecyl, 7-ethylundecyl, 4-propyldecyl, 5-ethyl-3-methyldecyl, 3-pentyloctyl, tetradecyl, 12-methyltridecyl, 8-ethyldodecyl, 6-propylundecyl, 4-butyldecyl, 2-pentylnonyl, pentadecyl, 13-methyltetradecyl, 10-ethyltridecyl, 7-propyldodecyl, 5-ethyl-3-methyldodecyl, 4-pentyldecyl, 1-hexylnonyl, hexadecyl, 14-methylpentadecyl, 6-ethyltetradecyl, 4-propyltridecyl, 2-butyldodecyl, heptadecyl, 15-methylhexadecyl, 7-ethylpentadecyl, 3-propyltetradecyl, 5-pentyldodecyl, octadecyl, 16-methylheptadecyl, 5-propylpentadecyl, nonadecyl, 17-methyloctadecyl, 4-ethylheptadecyl, icosyl, 18-methylnonadecyl, 3-ethyloctadecyl, henicosyl, docosinyl, tricosinyl, tetracosinyl and pentacosinyl groups.
[0082] The term “C.sub.x-y alkyl” refers to an alkyl group between x and y carbon atoms in size. For example, C.sub.1-8 alkyl refers to an alkyl of 1 to 8 carbon atoms.
[0083] The term “aryl” as used herein includes 5-, 6-, and 7-membered unsubstituted single-ring aromatic groups in which each atom of the ring is carbon. The term “aryl” also includes polycyclic ring systems having two cyclic rings in which two or more carbons are common to two adjoining rings wherein at least one of the rings is aromatic, e.g., the other cyclic rings can be cycloalkyls, cycloalkenyls, cycloalkynyls, aryls, heteroaryls, and/or heterocyclyls. The aryl group may be optionally substituted where indicated. Aryl groups include benzene, naphthalene, tetralin, and the like.
[0084] The term “haloalkyl” refers to an alkyl group that is substituted with one or more (e.g., 1, 2, 3, 4, or 5) halo substituents. The group is otherwise unsubstituted unless as indicated. Examples include chloroethyl, chloromethyl, difluoromethyl, trifluoromethyl, and the like.
[0085] A “pharmaceutically acceptable carrier” refers to any pharmaceutically acceptable solvent, suspending agent, or other pharmacologically inert vehicle. Pharmaceutically acceptable carriers can be liquid or solid, and can be selected with the planned manner of administration in mind so as to provide for the desired bulk, consistency, and other pertinent transport and chemical properties. Typical pharmaceutically acceptable carriers include, without limitation, water, saline solutions, dimethyl sulfoxide, binding agents (e.g., polyvinylpyrrolidone or hydroxypropyl methylcellulose), fillers (e.g., lactose and other sugars, gelatin, or calcium sulfate), lubricants (e.g., starch, polyethylene glycol, or sodium acetate), disintegrates (e.g., starch or sodium starch glycolate), and wetting agents (e.g., sodium lauryl sulfate).
[0086] The term “pharmaceutically acceptable salt” refers to the relatively non-toxic, inorganic and organic acid addition salts of a compound provided herein. These salts can be prepared in situ during the final isolation and purification of a compound provided herein, or by separately reacting the compound in its free base form with a suitable organic or inorganic acid, and isolating the salt thus formed. Representative salts include the hydrobromide, hydrochloride, sulfate, bisulfate, phosphate, nitrate, acetate, valerate, oleate, palmitate, stearate, laurate, benzoate, lactate, phosphate, tosylate, citrate, maleate, fumarate, succinate, tartrate, naphthylate, mesylate, glucoheptonate, lactobionate, laurylsulphonate salts, and amino acid salts, and the like. (See, for example, Berge et al. (1977) “Pharmaceutical Salts”, J. Pharm. Sci. 66: 1-19.)
[0087] In some embodiments, a compound provided herein may contain one or more acidic functional groups and, thus, is capable of forming pharmaceutically acceptable salts with pharmaceutically acceptable bases.
Compounds
[0088] Provided herein are compounds according to Formula (I):
##STR00013## [0089] or a pharmaceutically acceptable salt thereof, [0090] wherein: [0091] R.sup.1 is an unsubstituted C.sub.1-6alkyl or C.sub.1-6haloalkyl; [0092] X is
##STR00014##
[0093] Y is selected from:
##STR00015## [0094] m is 0 or 1; [0095] n is 0, 1, or 2; [0096] V is NR.sup.4 or O; [0097] R.sup.2, R.sup.3, and R.sup.4 are each independently H or an unsubstituted C.sub.1-6alkyl; and [0098] Z is an unsubstituted aryl.
[0099] In some embodiments, the compound according to Formula (I) has the structure of Formula (Ia):
##STR00016##
or a pharmaceutically acceptable salt thereof.
[0100] In some embodiments, V is NR.sup.4. In some embodiments, V is NH. In some embodiments, V is O.
[0101] In some embodiments, X is
##STR00017##
[0102] In some embodiments, Y is
##STR00018##
In some embodiments, Y is
##STR00019##
In some embodiments, Y is
##STR00020##
[0103] In some embodiments, Z is selected from the group consisting of: phenyl and naphthyl. For example, Z can be phenyl.
[0104] In some embodiments, m is 0. In some embodiments, m is 1.
[0105] In some embodiments, n is 0. In some embodiments, n is 1. In some embodiments, n is 2.
[0106] In some embodiments, R.sup.1 is an unsubstituted C.sub.1-6alkyl. In some embodiments, R.sup.1 is an unsubstituted C.sub.1-3alkyl. For example, R.sup.1 can be CH.sub.3. In some embodiments, R.sup.1 is a C.sub.1-6haloalkyl. In some embodiments, R.sup.1 is a C.sub.1-3haloalkyl. For example, R.sup.1 can be CF.sub.3.
[0107] In some embodiments, R.sup.2 is an unsubstituted C.sub.1-6alkyl. For example R.sup.2 can be CH.sub.3. In some embodiments, R.sup.2 is H.
[0108] In some embodiments, R.sup.3 is an unsubstituted C.sub.1-6alkyl. For example R.sup.3 can be CH.sub.3. In some embodiments, R.sup.3 is H.
[0109] In some embodiments, R.sup.4 is an unsubstituted C.sub.1-6alkyl. For example R.sup.4 can be CH.sub.3. In some embodiments, R.sup.4 is H.
[0110] In some embodiments, R.sup.2 is H; and R.sup.3 is CH.sub.3.
[0111] Non-limiting examples of a compound according to Formula (I) and/or Formula (Ia) include:
##STR00021## [0112] N-Methyl-2-(2-oxo-2-{4-[2-(trifluoromethyl)benzoyl]piperazin-1-yl}ethoxy)benzamide;
##STR00022## [0113] 2-(benzyloxy)-5-{[hydroxy({4-[2-(trifluoromethyl)benzoyl]piperazin-1-yl})methyl]amino}-1,2-dihydropyridin-2-ylium-1-ide; and
##STR00023## [0114] 2-(benzyloxy)-4-({[hydroxy({4-[2-(trifluoromethyl)benzoyl]piperazin-1-yl})methyl]azanidyl}methyl)-1,2-dihydropyridin-2-ylium-1-ide, or a pharmaceutically acceptable salt thereof.
[0115] Also provided herein is a compound according to Formula (II):
##STR00024## [0116] or pharmaceutically acceptable salt thereof, [0117] wherein [0118] R.sup.1 is halo; [0119] X is —(C═O)NR.sup.4—; [0120] Y is
##STR00025## [0121] R.sup.2, R.sup.3, and R.sup.4 are each independently H or an unsubstituted C.sub.1-6alkyl.
[0122] In some embodiments, a compound according to Formula (II) has the structure of Formula (IIa):
##STR00026## [0123] or pharmaceutically acceptable salt thereof.
[0124] In some embodiments, X is —(C═O)NR.sup.4—.
[0125] In some embodiments, Y is
##STR00027##
[0126] In some embodiments, R.sup.1 is Cl. In some embodiments, R.sup.1 is F.
[0127] In some embodiments, R.sup.2 is an unsubstituted C.sub.1-6alkyl. For example R.sup.2 can be CH.sub.3. In some embodiments, R.sup.2 is H.
[0128] In some embodiments, R.sup.3 is an unsubstituted C.sub.1-6alkyl. For example R.sup.3 can be CH.sub.3. In some embodiments, R.sup.3 is H.
[0129] In some embodiments, R.sup.4 is an unsubstituted C.sub.1-6alkyl. For example R.sup.4 can be CH.sub.3. In some embodiments, R.sup.4 is H.
[0130] In some embodiments, R.sup.2 is H; and R.sup.3 is CH.sub.3.
[0131] Non-limiting examples of a compound according to Formula (II) and/or Formula (IIa) include:
##STR00028## [0132] 2-{[4-(2-Chlorophenoxy)piperidine-1-carbonyl]amino}-N-methylpyridine-4-carboxamide,
[0133] or pharmaceutically acceptable salt thereof.
Administration
[0134] Compounds as described herein can be administered in various forms, depending on the disorder to be treated and the age, condition, and body weight of the subject, as is well known in the art. For example, where the compounds are to be administered orally, they may be formulated as tablets, capsules, granules, powders, or syrups; or for parenteral administration, they may be formulated as injections (intravenous, intramuscular, or subcutaneous), drop infusion preparations, or suppositories. For application by the ophthalmic mucous membrane route, they may be formulated as eye drops or eye ointments. These formulations can be prepared by conventional means, and if desired, the active ingredient may be mixed with any conventional additive or excipient, such as a binder, a disintegrating agent, a lubricant, a corrigent, a solubilizing agent, a suspension aid, an emulsifying agent, a coating agent, a cyclodextrin, and/or a buffer. Although the dosage will vary depending on the symptoms, age and body weight of the subject, the nature and severity of the disorder to be treated or prevented, the route of administration and the form of the drug, in general, a daily dosage of from 0.01 to 2000 mg of the compound is recommended for an adult human subject, and this may be administered in a single dose or in divided doses. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the compound which produces a therapeutic effect.
[0135] The precise time of administration and/or amount of the composition that will yield the most effective results in terms of efficacy of treatment in a given patient will depend upon the activity, pharmacokinetics, and bioavailability of a particular compound, physiological condition of the subject (including age, sex, disease type and stage, general physical condition, responsiveness to a given dosage, and type of medication), route of administration, etc. However, the above guidelines can be used as the basis for fine-tuning the treatment, e.g., determining the optimum time and/or amount of administration, which will require no more than routine experimentation consisting of monitoring the subject and adjusting the dosage and/or timing.
[0136] In solid dosage forms for oral administration (capsules, tablets, pills, dragees, powders, granules, and the like), the active ingredient is mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, cyclodextrins, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as, for example, acetyl alcohol and glycerol monostearate; (8) absorbents, such as kaolin and bentonite clay; (9) lubricants, such a talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof; and (10) coloring agents. In the case of capsules, tablets, and pills, the pharmaceutical compositions may also comprise buffering agents. Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols, and the like.
[0137] A tablet may be made by compression or molding, optionally with one or more accessory ingredients. Compressed tablets may be prepared using binder (for example, gelatin or hydroxypropylmethyl cellulose), lubricant, inert diluent, preservative, disintegrant (for example, sodium starch glycolate or cross-linked sodium carboxymethyl cellulose), surface-active or dispersing agent. Molded tablets may be made by molding in a suitable machine a mixture of the powdered inhibitor(s) moistened with an inert liquid diluent.
[0138] Tablets, and other solid dosage forms, such as dragees, capsules, pills, and granules, may optionally be scored or prepared with coatings and shells, such as enteric coatings and other coatings well known in the pharmaceutical-formulating art. They may also be formulated so as to provide slow or controlled release of the active ingredient therein using, for example, hydroxypropylmethyl cellulose in varying proportions to provide the desired release profile, other polymer matrices, liposomes, and/or microspheres. They may be sterilized by, for example, filtration through a bacteria-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved in sterile water, or some other sterile injectable medium immediately before use. These compositions may also optionally contain opacifying agents and may be of a composition that they release the active ingredient(s) only, or preferentially, in a certain portion of the gastrointestinal tract, optionally, in a delayed manner. Examples of embedding compositions which can be used include polymeric substances and waxes. The active ingredient can also be in micro-encapsulated form, if appropriate, with one or more of the above-described excipients.
[0139] Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs. In addition to the active ingredient, the liquid dosage forms may contain inert diluents commonly used in the art, such as, for example, water or other solvents, solubilizing agents, and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols, and fatty acid esters of sorbitan, and mixtures thereof.
[0140] Besides inert diluents, the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming, and preservative agents.
[0141] Suspensions, in addition to the active inhibitor(s) may contain suspending agents as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
[0142] Formulations for rectal or vaginal administration may be presented as a suppository, which may be prepared by mixing one or more inhibitor(s) with one or more suitable nonirritating excipients or carriers comprising, for example, cocoa butter, polyethylene glycol, a suppository wax or a salicylate, which is solid at room temperature, but liquid at body temperature and, therefore, will melt in the rectum or vaginal cavity and release the active agent.
[0143] Formulations which are suitable for vaginal administration also include pessaries, tampons, creams, gels, pastes, foams, or spray formulations containing such carriers as are known in the art to be appropriate.
[0144] Dosage forms for the topical or transdermal administration of an inhibitor(s) include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches, and inhalants. The active component may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants which may be required.
[0145] The ointments, pastes, creams, and gels may contain, in addition to inhibitor(s), excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc, and zinc oxide, or mixtures thereof.
[0146] Powders and sprays can contain, in addition to an inhibitor(s), excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates, and polyamide powder, or mixtures of these substances. Sprays can additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.
[0147] The inhibitor(s) can be alternatively administered by aerosol. This is accomplished by preparing an aqueous aerosol, liposomal preparation, or solid particles containing the composition. A nonaqueous (e.g., fluorocarbon propellant) suspension could be used. Sonic nebulizers are preferred because they minimize exposing the agent to shear, which can result in degradation of the compound.
[0148] Ordinarily, an aqueous aerosol is made by formulating an aqueous solution or suspension of the agent together with conventional pharmaceutically acceptable carriers and stabilizers. The carriers and stabilizers vary with the requirements of the particular composition, but typically include nonionic surfactants (Tweens, Pluronics, sorbitan esters, lecithin, Cremophors), pharmaceutically acceptable co-solvents such as polyethylene glycol, innocuous proteins like serum albumin, oleic acid, amino acids such as glycine, buffers, salts, sugars, or sugar alcohols. Aerosols generally are prepared from isotonic solutions.
[0149] Transdermal patches have the added advantage of providing controlled delivery of an inhibitor(s) to the body. Such dosage forms can be made by dissolving or dispersing the agent in the proper medium. Absorption enhancers can also be used to increase the flux of the inhibitor(s) across the skin. The rate of such flux can be controlled by either providing a rate controlling membrane or dispersing the inhibitor(s) in a polymer matrix or gel.
Methods of Use
[0150] This disclosure provides methods for treating cancer, for example, renal cell carcinoma, ovarian, breast, prostate, colon, pancreatic, bladder, liver, lung, thyroid cancers, and melanoma. In some embodiments, this document provides methods and material for using a compound of the disclosure to treat cancer (e.g., clear cell renal cell carcinoma (ccRCC), hepatobiliary carcinoma (HCC), and anaplastic thyroid cancer) or to increase the efficacy of a cancer treatment. In some embodiments, the cancer is associated with overexpression of an SCD1 protein, an SCD1 enzyme (e.g., “a SCD1-associated cancer”) (see, e.g., von Roemeling, C. A. et al. J. Clin. Endocrinol. Metab. (May 2015) 100(5): E697-E709). The term “SCD1-associated cancer” as used herein refers to cancers associated with or having a dysregulation of a SCD1 protein (SCD1 enzyme), or expression or activity or level of the same. Non-limiting examples of a SCD1-associated cancer are described herein.
[0151] Accordingly, provided herein are methods for treating a patient diagnosed with (or identified as having) a cancer (e.g., a SCD1-associated cancer) that include administering to the patient a therapeutically effective amount of a compound provided herein or a pharmaceutically acceptable salt thereof. Also provided herein are methods for treating a patient identified or diagnosed as having a SCD1-associated cancer (e.g., a patient that has been identified or diagnosed as having a SCD1-associated cancer through the use of a regulatory agency-approved, e.g., FDA-approved test or assay for identifying dysregulation of a SCD1 protein, or expression or activity or level of the same, in a patient or a biopsy sample from the patient) (e.g., any of the SCD1-associated cancer described herein or known in the art) that include administering to the patient a therapeutically effective amount of a compound provided herein or a pharmaceutically acceptable salt thereof. In some embodiments, the test or assay is provided as a kit.
[0152] Also provided are methods for treating cancer in a patient in need thereof, the method comprising: (a) determining if the cancer in the patient is a SCD1-associated cancer (e.g., using a regulatory-agency approved, e.g., FDA-approved, kit for identifying dysregulation of a SCD1 protein or expression or activity or level of the same, in a patient or a biopsy sample from the patient); and (b) if the cancer is determined to be a SCD1-associated cancer, administering to the patient a therapeutically effective amount of a compound provided herein or a pharmaceutically acceptable salt thereof.
[0153] Also provided are methods of treating a patient (e.g., a patient suspected of having a SCD1-associated cancer, a patient presenting with one or more symptoms of a SCD1-associated cancer, or a patient having an elevated risk of developing a SCD1-associated cancer) that include performing an assay (e.g., an assay that utilizes next generation sequencing, pyrosequencing, immunohistochemistry, or break apart FISH analysis) (e.g., using a regulatory agency-approved, e.g., FDA-approved kit) on a sample obtained from the patient to determine whether the patient has dysregulation of a SCD1 protein or expression or activity or level of the same, and administering (e.g., specifically or selectively administering) a therapeutically effective amount of a compound provided herein or a pharmaceutically acceptable salt thereof to a patient determined to have dysregulation of a SCD1 protein or expression or activity or level of the same. Additional assays, non-limiting assays that may be used in these methods are described herein. Additional assays are also known in the art.
[0154] In some embodiments of any of the methods or uses described herein, an assay used to determine whether the patient has dysregulation of a SCD1 protein or expression or activity or level of any of the same, using a sample (e.g., a biological sample or a biopsy sample (e.g., a paraffin-embedded biopsy sample) from a patient (e.g., a patient suspected of having a SCD1-associated cancer, a patient having one or more symptoms of a SCD1-associated cancer, and/or a patient that has an increased risk of developing a SCD1-associated cancer) can include, for example, next generation sequencing, immunohistochemistry, fluorescence microscopy, break apart FISH analysis, Southern blotting, Western blotting, FACS analysis, Northern blotting, and PCR-based amplification (e.g., RT-PCR and quantitative real-time RT-PCR). As is well-known in the art, the assays are typically performed, e.g., with at least one labelled nucleic acid probe or at least one labelled antibody or antigen-binding fragment thereof. Assays can utilize other detection methods known in the art for detecting dysregulation of a SCD1 protein or expression or activity or levels of any of the same.
[0155] In some embodiments, the subject is a mammal. In some embodiments, the mammal can be a mouse, a rat, a guinea pig, a dog, a cow, a goat, a monkey, or a human. For example, the mammal can be a cynomolgus monkey. In some embodiments, the mammal can be a human.
[0156] As described herein, one or more (e.g., one, two, three, four, or more) compounds of the disclosure can be administered to a mammal (e.g., a human) having cancer (e.g., a SCD1-associated cancer, renal cancer, liver cancer, thyroid cancer) under conditions wherein the number of cancer cells within the mammal is reduced. In some embodiments, one or more (e.g., one, two, three, four, or more) compounds of the disclosure can be administered to a mammal (e.g., a human) having renal cancer (e.g., ccRCC) under conditions wherein the number of renal cancer cells within the mammal is reduced.
[0157] An SCD1 enzyme can be a humSCD1 having the amino acid sequence set forth in GenBank® Accession No. 000767 (GI No. 21431730) or a humSCD1 encoded by nucleic acid having the nucleic acid sequence set forth in GenBank® Accession No. AF097514.1 (GI No. 4808600). Examples of inhibitors of an SCD1 include, without limitation, inhibitory anti-SCD1 antibodies, siRNA molecules, shRNA molecules, nucleic acid vectors designed to express siRNA or shRNA molecules, anti-sense molecules, and small molecule antagonists such as A939572 (Biofine International Inc., Urvashi et al., Mol. Cancer Res., 9:1551 (2011); Bristol-Myers Squibb R&D, Roongta et al., Mol. Cancer Res., 9(11):1551-61 (2011)), MK-8245 (Merck Research Laboratories, Oballa et al., J. Med. Chem., 54(14):5082-96 (2011)), CVT-11127, MF-152 (Merck, Li et al., Bioorganic & Medicinal Chemistry Letters, 19:5214 (2009)), LCF369, CVT-11,563, CVT-12,012, DSR-4029, and GSK993 (Uto et al., Eur. J. Med. Chem., 45:4788-4796 (2010)), MF-438 (Leger, S. et al., Bioorg Med Chem Lett. 20(2):499-502 (2010)), and HYR-061 (Medchem Express, Koltun et al., Bioorganic & Medicinal Chemistry Letters, 19(7):2048-2052 (2009), and Xin et al., Bioorganic & Medicinal Chemistry Letters, 18(15):4298-4302 (2008)). In some cases, an inhibitor of an SCD1 polypeptide can be an inhibitor described elsewhere (Igal, Carcinogenesis, 31(9):1509-1515 (2010); Oballa, J. Med. Chem., 54:5082-5096 (2011); Li et al., Bioorganic & Medicinal Chemistry Letters, 19:5214-5217 (2009); Uto et al., Eur. J. Med. Chem., 46:1892-1896 (2011); Uto et al., Eur. J. Med. Chem., 45:4788-4796 (2010); Liu, G. Expert Opin Ter Pat, 19(9):1169-91 (2009); Powell, D. A., Bioorg Med Chem Lett. 20(22):6366-9 (2010), Mason P, et al., PLoS ONE 7(3): 33823 (2012), and Roongta et al., Mol. Cancer Res., 9:1551-1561 (2011)).
[0158] In some embodiments, the methods for inhibiting an SCD1 enzyme can be performed in a cell. In some embodiments, the method comprises inhibiting an SCD1 enzyme in a cell with an effective amount of a compound, pharmaceutically acceptable salt, or a pharmaceutical composition thereof, as described herein. The cell can be a cancer cell, for example, a kidney cancer cell, a liver cancer cell, a breast cancer cell, a lung cancer cell, a pancreatic cancer cell, a bladder cancer cell, a colon cancer cell, a melanoma cell, a thyroid cancer cell, an ovarian cancer cell, or a prostate cancer cell. For example, the cancer cell can be a kidney cancer cell. In some embodiments, the contacting is in vitro. For example, the method for inhibiting the SCD1 enzyme can be used in an in vitro ELISA assay. In some embodiments, the contacting is in vivo. For example, the method for inhibiting the SCD1 enzyme can be used in an in vivo rat model or in treating a cancer in a subject as described herein.
[0159] Cancers that may be treated by an inhibitor of SCD1, compositions and methods described herein include, but are not limited to, the following: [0160] Breast cancers, including, for example ER.sup.+ breast cancer, ER.sup.− breast cancer, her2.sup.− breast cancer, her2.sup.+ breast cancer, stromal tumors such as fibroadenomas, phyllodes tumors, and sarcomas, and epithelial tumors such as large duct papillomas; carcinomas of the breast including in situ (noninvasive) carcinoma that includes ductal carcinoma in situ (including Paget's disease) and lobular carcinoma in situ, and invasive (infiltrating) carcinoma including, but not limited to, invasive ductal carcinoma, invasive lobular carcinoma, medullary carcinoma, colloid (mucinous) carcinoma, tubular carcinoma, and invasive papillary carcinoma; and miscellaneous malignant neoplasms. Further examples of breast cancers can include luminal A, luminal B, basal A, basal B, and triple negative breast cancer, which is estrogen receptor negative (ER.sup.−), progesterone receptor negative, and her2 negative (her2.sup.−). In some embodiments, the breast cancer may have a high risk Oncotype score; Hematopoietic cancers, including, for example, leukemia (acute lymphocytic leukemia (ALL), acute lyelogenous leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), hairy cell leukemia), mature B cell neoplasms (small lymphocytic lymphoma, B cell prolymphocytic leukemia, lymphoplasmacytic lymphoma (such as Waldenstrom's macroglobulinemia), splenic marginal zone lymphoma, plasma cell myeloma, plasmacytoma, monoclonal immunoglobulin deposition diseases, heavy chain diseases, extranodal marginal zone B cell lymphoma (MALT lymphoma), nodal marginal zone B cell lymphoma (NMZL), follicular lymphoma, mantle cell lymphoma, diffuse B cell lymphoma, diffuse large B cell lymphoma (DLBCL), mediastinal (thymic) large B cell lymphoma, intravascular large B cell lymphoma, primary effusion lymphoma and Burkitt lymphoma/leukemia), mature T cell and natural killer (NK) cell neoplasms (T cell prolymphocytic leukemia, T cell large granular lymphocytic leukemia, aggressive NK cell leukemia, adult T cell leukemia/lymphoma, extranodal NK/T cell lymphoma, enteropathy-type T cell lymphoma, hepatosplenic T cell lymphoma, blastic NK cell lymphoma, mycosis fungoides (Sézary syndrome), primary cutaneous anaplastic large cell lymphoma, lymphomatoid papulosis, angioimmunoblastic T cell lymphoma, unspecified peripheral T cell lymphoma and anaplastic large cell lymphoma), Hodgkin lymphoma (nodular sclerosis, mixed celluarity, lymphocyte-rich, lymphocyte depleted or not depleted, nodular lymphocyte-predominant), myeloma (multiple myeloma, indolent myeloma, smoldering myeloma), chronic myeloproliferative disease, myelodysplastic/myeloproliferative disease, myelodysplastic syndromes, immunodeficiency-associated lymphoproliferative disorders, histiocytic and dendritic cell neoplasms, mastocytosis, chondrosarcoma, Ewing sarcoma, fibrosarcoma, malignant giant cell tumor, and myeloma bone disease; [0161] lung cancers, including, for example, bronchogenic carcinoma, e.g., squamous cell, undifferentiated small cell, undifferentiated large cell, and adenocarcinoma; alveolar and bronchiolar carcinoma; bronchial adenoma; sarcoma; lymphoma; chondromatous hamartoma; and mesothelioma; [0162] genitourinary tract cancers, including, for example, cancers of the kidney, e.g., adenocarcinoma, Wilm's tumor (nephroblastoma), lymphoma, and leukemia; cancers of the bladder and urethra, e.g., squamous cell carcinoma, transitional cell carcinoma, and adenocarcinoma; cancers of the prostate, e.g., adenocarcinoma, and sarcoma; cancer of the testis, e.g., seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, interstitial cell carcinoma, fibroma, fibroadenoma, adenomatoid tumors, and lipoma; [0163] liver cancers, including, for example, hepatoma, e.g., hepatocellular carcinoma; cholangiocarcinoma; hepatoblastoma; angiosarcoma; hepatocellular adenoma; and hemangioma; [0164] kidney (renal) cancers, including, for example, clear cell renal cell carcinoma, papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct renal cell carcinoma, unclassified renal cell carcinoma, transitional cell carcinoma, and renal sarcoma; [0165] bladder cancers, including, for example, transitional cell carcinoma, urothelial carcinoma, papillary carcinoma, flat carcinoma, squamous cell carcinoma, adenocarcinoma, small-cell carcinoma, and sarcoma; [0166] gynecological cancers, including, for example, cancers of the uterus, e.g., endometrial carcinoma; cancers of the cervix, e.g., cervical carcinoma, and pre tumor cervical dysplasia; cancers of the ovaries, e.g., ovarian carcinoma, including serous cystadenocarcinoma, epithelial cancer, mucinous cystadenocarcinoma, unclassified carcinoma, granulosa thecal cell tumors, Sertoli Leydig cell tumors, dysgerminoma, and malignant teratoma; cancers of the vulva, e.g., squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, fibrosarcoma, and melanoma; cancers of the vagina, e.g., clear cell carcinoma, squamous cell carcinoma, botryoid sarcoma, and embryonal rhabdomyosarcoma; and cancers of the fallopian tubes, e.g., carcinoma; [0167] skin cancers, including, for example, malignant melanoma, basal cell carcinoma, squamous cell carcinoma, Kaposi's sarcoma, moles dysplastic nevi, lipoma, angioma, dermatofibroma, keloids, psoriasis; [0168] thyroid cancers, including, for example, papillary thyroid cancer, follicular thyroid cancer, anaplastic thyroid carcinoma, and medullary thyroid cancer; and [0169] adrenal gland cancers, including, for example, neuroblastoma.
[0170] In some cases, one or more (e.g., one, two, three, four, or more) compounds of the disclosure can be used as described herein to treat cancer, including renal cancer, ovarian, breast, prostate, colon, pancreatic, bladder, liver, lung, and thyroid cancer as well as melanoma. In some embodiments, the cancer is a kidney cancer or a bladder cancer. For example, the cancer can be a kidney cancer. In some embodiments, the cancer is a bladder cancer. In some embodiments, the cancer is a liver cancer such as hepatocellular carcinoma. In some embodiments, the cancer is a thyroid cancer such as anaplastic thyroid carcinoma.
[0171] For example, a subject having cancer can be administered one or compounds of the disclosure under conditions that result in reduced tumor size or stable disease. In some cases, one or more (e.g., one, two, three, four, or more) compounds of the disclosure can be used as described herein to increase the efficacy of a cancer treatment. In some embodiments (e.g., when compositions comprising one or more (e.g., one, two, three, four, or more) compounds of the disclosure are administered in conjunction with another anticancer agent), one can create a synergistic effect among the agents administered and thereby improve the outcome for a subject. In some embodiments, one or more (e.g., one, two, three, four, or more) compounds of the disclosure (or a pharmaceutically acceptable salt form thereof) can be administered in combination with (i.e., before, during, or after) administration of a pain relief agent (e.g., a nonsteroidal anti-inflammatory drug such as celecoxib or rofecoxib), an antinausea agent, or an additional anticancer agent (e.g., paclitaxel, docetaxel, doxorubicin, daunorubicin, epirubicin, fluorouracil, melphalan, cis-platin, carboplatin, cyclophosphamide, mitomycin, methotrexate, mitoxantrone, vinblastine, vincristine, ifosfamide, teniposide, etoposide, bleomycin, leucovorin, taxol, herceptin, avastin, cytarabine, dactinomycin, interferon alpha, streptozocin, prednisolone, irinotecan, sulindac, 5-fluorouracil, capecitabine, oxaliplatin/5 FU, abiraterone, letrozole, 5-aza/romidepsin, or procarbazine). In certain embodiments, the anticancer agent is paclitaxel or docetaxel. In other embodiments, the anticancer agent is cisplatin or irinotecan.
[0172] For example, a subject having ccRCC can be administered one or more compounds of the disclosure under conditions that result in reduced tumor size or stable disease. In some cases, one or more (e.g., one, two, three, four, or more) compounds of the disclosure can be used as described herein to increase the efficacy of a renal cell carcinoma treatment (i.e. administered in combination with one or more renal cell carcinoma treatments). Examples of such renal cell carcinoma treatments include, without limitation, treatment with Nexavar®, Sutent®, Torisel®, Afinitor® (everolimus), axitinib, pazopanib, levatinib, interleukin-2, and combinations thereof.
[0173] In some embodiments, one or more compounds provided herein can be administered to a subject having a thyroid cancer (e.g. anaplastic thyroid carcinoma, or a SCD1-associated thyroid cancer). In some cases, the one or more compounds provided herein can be administered in combination with one or more proteasome inhibitors. Exemplary proteasome inhibitors include lactacystin, bortezomib, dislfiram, salinosporamide A, carfilzomib, ONX0912, CEP-18770, MLN9708, epoxomicin, and MG132). In some embodiments, the combination of a compound provided herein (e.g., SSI-4) and a proteasome inhibitor have a synergistic effect on the treatment of the cancer.
[0174] In some embodiments, one or more compounds provided herein can be administered to a subject having a liver cancer (e.g. hepatobiliary carcinoma (HCC), or a SCD1-associated liver cancer). In some cases, the one or more compounds provided herein can be administered in combination with one or more multikinase inhibitors (e.g., tyrosine kinase inhibitors, RAF kinase inhibitors, serine/threonine kinase inhibitors). In some embodiments, the multikinase inhibitor is sorafenib. In some embodiments, the combination of a compound provided herein (e.g., SSI-4) and sorafenib have a synergistic effect on the treatment of the cancer.
[0175] In some cases, one or more (e.g., one, two, three, four, or more) compounds of the disclosure as described herein can be used in combination with one or more (e.g., one, two, three, four, or more) inhibitors of mammalian target of rapamycin (mTor). Non-limiting examples of mTor inhibitors include: sirolimus (RAPAMUNE®), temsirolimus (CCI-779), everolimus (RAD001), ridaforolimus (AP-23573).
[0176] Accordingly, provided herein is a method for reducing the number of cancer cells within a subject, wherein the method comprises administering, to the subject, a compound of the disclosure and an inhibitor of an mTor polypeptide under conditions wherein the number of viable cancer cells present within said subject is reduced. In some embodiments, the one or more mTor inhibitor can include a standard of care drug for a particular cancer cell type. For example, a compound of the disclosure can be administered with pacliltaxel and/or platin (cisplatin, carboplatin, or oxaliplatin) for the treatment of ovarian cancer. In some embodiments, the following standard of care drugs can be combined with an SCD1 inhibitor for the following cancers: [0177] Lung—paclitaxel, nivolumab, ceritinib, afatinib [0178] Colon—capecitabine [0179] Breast [0180] Metastatic breast—capecitabine, paclitaxel, and/or gemcitabine [0181] Hormonally responsive breast—aromatase inhibitors such as letrazole and/or antiestrogens such as tamoxifen [0182] HER2 positive—Her2 inhibitors such as trastuzumab; palbociclib, ado-trastuzumab emtansine [0183] Melanoma—temozolomide, and/or BRAF inhibitors, pembrolizumab, nivolumab, pomalidomide, dabrafenib [0184] Prostate—androgen receptor inhibitors such as abiraterone [0185] Bladder—gemcitabine and/or paclitaxel [0186] Thyroid—paclitaxel, cisplatin, a proteasome inhibitor, sorafenib, lenvatinib [0187] Pancreatic—gemcitabine [0188] Liver—sorafenib [0189] Mantle cell lymphoma—bortezomib [0190] Multiple myeloma—panobinostat [0191] Relapsed and/or refractory—carfilzomib, bortezomib and/or an immunomodulatory agent such as dexamethasone
[0192] In some embodiments, the combination of one or more compounds of the disclosure and one or more inhibitors of mTor exhibit a synergistic response. In some embodiments, the one or more inhibitors of an SCD1 (i.e. one or more compounds of the disclosure) can be administered before, during, or after administration of the one or more inhibitors of mTor.
[0193] In some cases, one or more (e.g., one, two, three, four, or more) inhibitors of an SCD1 enzyme as described herein can be used in combination with one or more (e.g., one, two, three, four, or more) proteasome inhibitors. Non-limiting examples of proteasome inhibitors include marizomib (NPI-0052), bortezomib (Velcade®), and carfilzomib (Kyprolis®). Other suitable proteasome inhibitors can be found in U.S. Pat. Nos. 8,431,571; 8,357,683; 8,088,741; 8,080,576; 8,080,545; 7,691,852; 7,687,456; 7,531,526; 7,109,323; 6,699,835; 6,548,668; 6,297,217; 6,066,730, and published PCT applications WO 2011/123502; WO 2010/036357; WO 2009/154737; WO 2009/051581; WO 2009/020448, each of which is incorporated by reference in its entirety.
[0194] Accordingly, provided herein is a method for reducing the number of cancer cells within a mammal, wherein the method comprises administering, to the mammal, inhibitors of an SCD1 enzyme and a proteasome inhibitor under conditions wherein the number of viable cancer cells present within said mammal is reduced. In some embodiments, the one or more proteasome inhibitors can include a standard of care drug for a particular cancer cell type. For example, an SCD1 inhibitor can be administered with carfilzomib for the treatment of refractory multiple myeloma.
[0195] In some embodiments, the combination of one or more inhibitors of an SCD1 enzyme and one or more proteasome inhibitors exhibit a synergistic response. In some embodiments, the one or more inhibitors of SCD1 (i.e. one or more compounds of the disclosure) can be administered before, during, or after administration of the one or more proteasome inhibitors. The administration can be an intratumoral, oral, intraperitoneal, intramuscular, or intravenous administration. In some embodiments, the SCD1 inhibitor and the proteasome inhibitor are admixed prior to administration.
[0196] A compound of the disclosure can also be administered to a subject in combination with surgical methods to treat cancers, e.g., resection of tumors. The compound can be administered to the individual prior to, during, or after the surgery. The compound can be administered parenterally, intravenous or injected into the tumor or surrounding area after tumor removal.
[0197] Typically, one or more of the compounds provided herein can be formulated into a pharmaceutical composition that can be administered to a mammal (e.g., rat, dog, horse, cat, mouse, rabbit, pig, cow, monkey, or human). For example, SSI-1 or a pharmaceutically acceptable salt thereof can be in a pharmaceutically acceptable carrier or diluent. The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.
EXAMPLES
Computational Methods
Example 1—De Novo Ligand Generation
[0198] Using methodology of combining multiple data sources for an accelerated drug discovery process, multiple new compounds using core generation were generated. First, all the cores were separated (“core separation”) from each known scaffold, leaving the binding features from the edges of each compound. Then, potential core fragments were combined from varied sources (core libraries, in-house fragment libraries, and de novo scaffold manipulations), which are then inserted back into the core slots (Core.sub.1, Core.sub.2, or Core.sub.3). Each new core is fused with the existing chemistry on the edges and placed into the appropriate pool (pool.sub.1, pool.sub.2, or pool.sub.3). Each pool is filtered using energy minimization, correct bond orders, and ligand preparation with LigPrep. These three pools are then combined into a common de novo ligand pool. The entire pool of ligands is expanded to allow for generation of tautomers where appropriate, ionization states over a valid range of pH values, and isomerizations. Reactive functional groups are screened and removed from the dataset. At this point, Z-scoring filtering is applied as a reductive filter for SCD1 specificity.
Shape Fitting Algorithms
[0199] Shape similarity models were generated for each compound versus the known inhibitor, SAR707 or A939572, such that upon superposition of the known compound (A) and the de novo compound (B), the following measurement for jointly occupied volume V.sub.A∩B is obtained, which is normalized by the total volume V.sup.A∪B, thus giving the normalized shape similarity Sim.sub.AB ranging from 0 to 1. Thus, Sim.sub.AB=V.sub.A∩B/V.sub.A∪B, where A is the known inhibitor SAR707 or A939572 and B is the unknown, de novo compound, were computed for 1000s of generated compounds. Finally, a pairwise method was employed for faster calculations (600 conformers per second) (Sastry, G. M. et al. J. Chem. Inf. Model. 2013; 53:1531-1542; Pala, D. et al. J. Chem. Inf. Model. 2013; 53(4):821-835; Kalid, O. et al. J. Comput. AidedMol. Des. 2012; 26:1217-1228; Fu, J. et al. Bioorg. Med. Chem. Lett. 2012; 22(2):6848-6853; Sastry, G. M. et al. J. Chem. Inf. Model. 2011; 51:2455-2466). Each compound is allowed to generate 500 conformers, retaining 20 conformers per rotatable bond, allowing the amide bonds to vary conformation, to maximize shape matching likelihood. Volume was also computed for both Pharmacophore types and Atom types using the Macromodel definition for atom typing. Four alignments per ligand were used, filtering out conformers with similarity below 0.7 and then compiled all the shape data together selecting the top shape matching compounds for retention and excluding all lower scoring hits. Various models for chemical shape can also be employed to screen both shape and chemical information simultaneously.
Computational Docking
[0200] Initial docking was performed using Glide (v. 5.6) within the Schrödinger software suite (Schrödinger, LLC) (Mohamadi, F. et al. J Comput Chem. 1990; 11(4):440-467). The origin of the compounds is described in De Novo Library Design. The starting conformation of ligands was obtained by the method of Polak-Ribiere conjugate gradient (PRCG) energy minimization with the Optimized Potentials for Liquid Simulations (OPLS) 2005 force field (Jorgensen, W L et al. J Am Chem Soc. Mar. 16 1988; 110(6):1657-1666) for 5000 steps, or until the energy difference between subsequent structures was less than 0.001 kJ/mol-Å units. The docking methodology has been described previously (Caulfield, T. et al. Proteins. November 2012; 80(11):2489-2500; Loving, K. et al. Journal of computer-aided molecular design. August 2009; 23(8):541-554; Vivoli, M. et al. Mol Pharmacol. March 2012; 81(3):440-454), and the scoring function utilized is described elsewhere (Friesner, R A et al. Journal of medicinal chemistry. Oct. 19 2006; 49(21):6177-6196).
Molecular modeling of SCD1
[0201] Molecular models were generated for the human protein stearoyl-CoA desaturase 1, or acyl-CoA desaturase (SCD1) (NP_005054.3), which has the following 359 amino acid protein sequence:
TABLE-US-00001 (SEQ ID NO: 1) MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDI KDDIYDPTYKDKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYT WLWGVFYYFVSALGITAGAHRLWSHRSYKARLPLRLFLIIANTMAFQNDV YEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGSTL DLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGETFQNSVFVAT FLRYAVVLNATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNY HHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKR TGDGNYKSG.
The modeling for this protein was completed using three combined methods, Schrodinger Prime modeling, TASSER, and Yasara structural and homology modeling program (Krieger E, Dunbrack R L, Jr., Hooft R W, Krieger B. Assignment of protonation states in proteins and ligands: combining pKa prediction with hydrogen bonding network optimization. Methods Mol Biol. 2012; 819:405-421; Krieger E, Joo K, Lee J, et al. Improving physical realism, stereochemistry, and side-chain accuracy in homology modeling: Four approaches that performed well in CASP8. Proteins. 2009; 77 Suppl 9:114-122; Prime, version 2.1 [computer program]. Schrodinger, LLC, New York, N.Y. 20092014; Zhou H, Skolnick J. Protein structure prediction by pro-Sp3-TASSER. Biophys J. Mar. 18 2009; 96(6):2119-2127; Zhou H, Skolnick J. Improving threading algorithms for remote homology modeling by combining fragment and template comparisons. Proteins. July 2010; 78(9):2041-2048; Zhou H, Skolnick J. Template-based protein structure modeling using TASSER(VMT). Proteins. Sep. 14 2011).
[0202] Several models were generated and compared for hybrid modeling, which resulted in best scoring portions from each program and validated for dihedrals, packing, and other metrics like Phi-Psi space.
[0203] From these final models for SCD1 were mapped using the SiteMap module to score highest confidence binding sites on SCD1, which resulted in a deep internal pocket that would correspond with lipophilic substrate binding, required for stearoyl-coA binding (Schrödinger Suite 2014 [computer program]. BioLuminate, version 1.0. New York, N.Y.: Schrödinger, LLC; 2014; Halgren T. New method for fast and accurate binding-site identification and analysis. Chem. Biol. Drug Des. 2007; 69(146-148); Halgren T. Identifying and characterizing binding sites and assessing druggability. J. Chem. Inf. Model. 2009; 49:377-389).
[0204] Prior to mapping out potential grid surfaces for an active site region surrounding residues, the ProteinPreparationWizard contained in Schrödinger (Protein Preparation Wizard; Epik version 2.8; Impact version 6.3; Prime version 3.5 [computer program]: Schrödinger, LLC, New York, N.Y., USA; 2014) was used. The top regions identified using SiteMap region were then mapped for grid generation and decomposition of the protein's three-dimensional space for docking experiments. Using this grid, initial placement for A939572, SAR707, and other known inhibitors were docked using the Glide algorithm within the Schrodinger suite as a virtual screening workflow (VSW). The docking was accomplished using a scheme that proceeds from single-precision (SP) through extra-precision (XP) with the Glide algorithm (Glide, v. 5.6, Schrödinger, LLC). The top seeded poses were ranked for best scoring pose and unfavorable scoring poses were discarded. Each conformer was allowed multiple orientations in the site. Site hydroxyls, such as in serines and threonines, were allowed to move with rotational freedom. Docking scores were not retained as useful, since covalent bonding is the outcome. Hydrophobic patches were utilized within the virtual screening workflow (VSW) as an enhancement. Top favorable scores from initial dockings of yielded thousands of poses with the top five poses retained. XP descriptors were used to obtain atomic energy terms like hydrogen bond interaction, electrostatic interaction, hydrophobic enclosure and pi-pi stacking interaction that result during the docking run. VSW docking was completed for all novel generated compounds from the de novo design process described in the QSAR section and the docking utilized both hydrophobic constraints and the seeding generated from known inhibitor docking poses. Molecular modeling for importing and refining the known inhibitor compounds and generation of the small molecule compounds were prepared with LigPrep module (LigPrep 2.2 [computer program]. Schrodinger, LLC, New York, N.Y., 2008: Schrödinger; 2010). All image rendering used for figures was completed with Maestro (Maestro 9.4 [computer program]. New York, N.Y.: Schrödinger, LLC; 2014).
Example 2—QSAR Methods
Active, Inactive, Unknown Ligand Preparation
[0205] Twenty active compounds that ranged from 3 nM to 400 nM and eight inactives ranging from 2.68 micromolar to >10 micromolar were built into our pharmacophore modeling system. Conformers were generated for all actives, inactives, and test set compounds using ConfGen and Mixed MCMM/LCMOD within Schrodinger (Watts K S, Dalal P, Murphy R B, Sherman W, Friesner R A, Shelley J C. ConfGen: A Conformational Search Method for Efficient Generation of Bioactive Conformers. J. Chem. Inf. Model. 2010; 50:534-546). For ConfGen the number of conformers per rotatable bond was set at 100, maximum number of conformers per structure was set at 1000, sampling was set on “Thorough” mode and included preprocess minimization of 100 steps and postprocess minimization of 50 steps and eliminate high-energy/redundant conformers. The MacroModel options for conformer generation used the OPLS2005 force field, GB/SA water solvation treatment and default setting for the maximum relative energy difference and maximum allowed atom deviation.
Pharmacophore Hypothesis Generation
[0206] A common pharmacophore was determined over a variant list that ranged from 5-6 sites and required a match from at least 6 of the 17 actives built into the model. The variant list included 187 selections based on sites created for all the actives chosen. The following letter code was used for the pharmacophore sites/features: hydrogen bond acceptor (A), hydrogen bond donor (D), hydrophobic group (H), negatively charged group (N), positively charged group [P], aromatic ring [R], and no custom features for X, Y, or Z designation were assigned. For images with pharmacophore models, the following appearance is given: (A) is light red sphere located at atom with lone pair and arrow point toward the lone pair, (D) is light blue sphere centered on hydrogen atom with arrow in direction of the potential H-bond, (H) is green sphere, (N) is red sphere, [P] is blue sphere, and [R] is orange torus in plane of aromatic ring. Our search method employed for finding common pharmacophores is identified using a tree-based partitioning technique that groups according to inter-site distances (k-points). Using a binary decision tree, a tree depth of five was allowed and partition into bins based on a 2.0 Å width, while partition continues to either eliminate or survive the procedure.
[0207] Variant motifs that were included were AAAAAA, AAAAAD, AAAAAH, AAAAAR, AAAADD, AAAADH, AAAADR, AAAAHH, . . . , HNPRRR, which resulted in the following top variant hypotheses AAAHHR, AAAHRR, AAHHRR with 45, 1, and 57 maximum hypotheses, respectively. The initial pharmacophore modeling considered >20,000 hypotheses. Actives were scored using vector and site filtering to keep RMSD below 1.200 Å, keep vectors with scores above 0.500, keep the top 30%, keep at least 10 and at most 50 using feature matching tolerances of A 1.00, D 1.00, H1.50, N 0.75, P 0.75, R 1.50, X 1.0, Y 1.0, and Z 1.0. The unweighted survival score formula is 1.0*(vector score)+1.0*(site score)+1.0*(volume score)+1.0̂(number of matches−1), however to take advantage of existing active compounds, the adjusted scoring function is 1.0*(vector score)+1.0*(site score)+1.0*(volume score)−0.001*(reference ligand(s) relative conformational energy)+1.0̂(number of matches−1)−0.001*(reference ligand activity).
[0208] This scoring metric resulted in eight qualified hypotheses for further examination, including: AAHHRR.2632, AAHHRR.2667, AAHHRR.2641, AAHHRR.2669, AAAHHR.5952, AAHHRR.2361, and AAAHHR.5952. All hypotheses had actives scored, inactives scored, then rescored for post-hoc analysis, which has the following formula: 1.0*(vector score)+1.0*(site score)+1.0*(volume score)+1.0̂(number of matches−1)−0.001*(reference ligand relative conformational energy)+0.001*(reference ligand activity). Then the “adjusted survival score” becomes the survival score−1.0*(inactive match score).
[0209] The scoring hypotheses were bases on the identified pharmacophores from each surviving n-dimensional box for the chosen actives and additional information from partial matching of ligand alignments. The quality alignments were determined using three metrics, namely, the alignment score (via root-mean-squared-deviation (RMSD)), vector score (average cosine of the angles formed by corresponding pairs of vector features (A, D, R), and volume score (overlap of van der Waals models of non-hydrogen atoms in each pair of structures). As well, site scores for each alignment were computed to augment the alignment score with a cutoff Calign, which combined the site score, vector score, and volume score with separate weights to yield a combined alignment score for each non-reference pharmacophore that was aligned with reference. All pharmacophores within a box were treated as a reference and the highest one selected as a hypothesis during multi-ligand alignment optimization. The final scoring function (survival score) was:
S=W.sub.siteS.sub.site+W.sub.vecS.sub.vec+W.sub.volS.sub.vol+W.sub.selS.sub.sel+W.sub.rew.sup.mW.sub.EΔE+W.sub.actA, where W's represented the weights and S's represented the scores. Inactives were penalized by adjusting their alignment score, such that, when an inactive matches only k out of n sites, an effective n-point alignment score was computed as follows:
S.sub.align,n=√{square root over (W.sub.kS.sub.align,k.sup.2(1−W.sub.k)C.sub.align.sup.2)}, where W.sub.k=k/n. The final adjusted score mentioned above became S.sub.adjusted=S.sub.actives−W.sub.inactivesS.sub.inactives. Default weights were used with all equations, as shown above. Hypotheses were clustered for to tease out pharmacophore model variants with similar scores.
Generation of 3D QSAR Models
[0210] The 3D QSAR models were built by mapping the chemical features of ligand structures onto a cubic three-dimensional grid space with the smallest grid spacing of 1 Å per side. As above, the ligands are first aligned to the set of pharmacophore features for the selected hypothesis using a standard least-squares approach, which utilizes regression of the independent variables with binary-valued bits in the cubes by structural components and the dependent variables are the activities. The regression was performed via a partial least squares (PLS) method, where a series of models generated with increasing number of PLS factors. T-value filter (t-value<2.0) was used to eliminate independent variables overly sensitive to incremental changes from the training set. For structural components, both atom-based and pharmacophore features based were examined. The regression with m PLS factors, fitted to activities is given as:
where m=number of PLS factors, b is regression coefficient, vector y represents activity values in the training set. For the prediction of activities for the new ligands, the following was used:
where k=1, . . . n.sub.T. Models with high stability were preferred.
Z-Score Matrix
[0211] A final Z-filtering mechanism was applied to reduce the dataset to a few select compounds for synthesis and experimental screening by using combined normalized scoring. The final Z-score for each compound was determined as:
which averages average of the sums the normalization of each individual Shape, the Dock, and 3D-QSAR score
De Novo Compounds Shape Scoring with SAR707
[0212] SAR707 resulted in the best yield in shape matching with our generated de novo ligands (
De Novo Compounds Docked with SCD1
[0213] Over 500 top generated compounds using scaffold/core hopping technologies were docked with SCD1 protein (Sun H, Tawa G, Wallqvist A. Classification of scaffold-hopping approaches. Drug discovery today. April 2012; 17(7-8):310-324; Ruddigkeit L, Blum L C, Reymond J L. Visualization and virtual screening of the chemical universe database GDB-17. J Chem Inf Model. Dec. 23 2012; Sperandio O, Andrieu O, Miteva M A, et al. MED-SuMoLig: A New Ligand-Based Screening Tool for Efficient Scaffold Hopping. Journal of Chemical Information and Modeling. 2007; 47(3):1097-1110; Bohm H J, Flohr A, Stahl M. Scaffold Hopping. Drug Discov Today: Technologies. 2004; 1(3):217-224; Herr A J, Wills N M, Nelson C C, Gesteland R F, Atkins J F. Drop-off during ribosome hopping. J Mol Biol. 2001; 311(3):445-452; Core Hopping [computer program]: Schrodinger, LLC, New York, N.Y.; 2014). Using the VSW docking process the highest level of Glide precision, XP level docking was used (Sandor M, Kiss R, Keseru G M. Virtual Fragment Docking by Glide: a Validation Study on 190 Protein-Fragment Complexes. Journal of Chemical Information and Modeling. June 2010; 50(6):1165-1172; Docking: HTVS, SP, XP [computer program]. Glide5.5, Schrödinger, LLC, New York, N.Y. 2009: Schrödinger; 2010).
[0214] The complete results from this demonstrated a set of high affinity compounds based upon docking scores. Top binding inhibitors included high scoring SSI-3 (−10.38 kcal/mol), Compound A5 (−9.34 kcal/mol), SSI-2 (−9.0 kcal/mol), SSI-1 (−7.49 kcal/mol), and SSI-4 (−7.32 kcal/mol). Previous docking-only based compound screening fell short of our desired screening and design expectations, which encouraged the use of a Z-scoring method for combining Shape and QSAR with Docking into a rubric for synthesis selection.
Multiple SCD1 Novel Inhibitors Screened Via in Silico Docking
[0215] With SCD1, the binding poses for known inhibitors (>20) were determined using the Glide method outlined. The binding pocket for SCD1 is a long funnel-shaped deep pocket (
[0216] As shown in
[0217] For better clarity, the top 260 compounds are removed from
Top Performing Experimental Inhibitors with in Silico Docking
[0218] All SCD1 inhibitors fit deep into a tunnel-like crevice inside SCD1 that includes the following residues within 4.5 Å of small molecules SSI-3, SSI-2, SSI-1, and SSI-4: Met79, Va1339, Ile115, Thr231, Leu232, Tyr334, Ala343, Arg347, and Ile348.
De Novo Compounds 3D-QSAR Scoring
[0219] Greater than 20,000 pharmacophore models were tested and filtered, yielding the following statistics for the top three performing hypothesis models AAHHRR.1870, AAAHHR.4252, and AAAHHR.5952, which resulted in the following hypotheses values: survival of 2.885, 2.736, 2.478; survival-inactives of 1.262, 1.141, 1.190; Post-hoc of 3.259, 3.036, 2.493; Site of 0.43, 0.46, 0.25; Vector of 0.897, 0.755, 0.723; Volume of 0.552, 0.517, 0.517; Selectivity of 2.624, 2.442, 2.498; number of matches of 6, 10, 7; energy of 0.511, 1.208, 5.247; activity of 8.155, 7.292, 8.155; inactive of 1.623, 1.595, 1.288, respectively. With a PLS set at three, the QSAR results for the two top-performing models (AAAHHR.5952 and AAAHHR.4252) are Std Dev of 0.148, 0.1167; R.sup.2 of 0.9886, 0.9952; F of 896.3, 1172.6; P of 3.438e-30, 6.798e-20; Stability of 0.4859, −0.1098; and RMSE of 5.5806, 1.077.
De Novo Compounds Combined Z-Score Ranking
[0220] The de novo compounds were inputted into the Z-scoring matrix outlined (Methods). The ranked pool of top compounds was sorted and all scored compounds that survived through QSAR were taken to the next step. Compounds were synthesized from this list and tested experimentally.
Compounds
Literature Compounds
[0221] A939572 was purchased from BioFine International. MF-438 (2-methyl-5-(6-(4-(2-(trifluoromethyl)phenoxy)piperidin-1-yl)pyridazin-3-yl)-1,3,4-thiadiazole) was synthesized by the medicinal chemistry group at Sanford-Burnham according to the published procedure, and was determined to by >95% pure by LC-MS. Carfilzomib and bortezomib were purchased from Selleck Chemicals.
Synthesis
Example 1—SSI-1
[0222] ##STR00029##
[0223] Step A
[0224] Potassium carbonate (2.76 g, 20 mmol) was added to a mixture of methyl bromoacetate (compound 1, 1.68 g, 11 mmol) and compound 2 (1.51 g, 0.01 mol) in DMF (50 mL) under vigorous stirring. The reaction mixture was stirred at r.t. for 24 h and then treated with water (200 mL) and extracted by CH.sub.2Cl.sub.2 (3×30 mL). The organic layer was washed with brine and dried under Na.sub.2SO.sub.4. The solvent was removed in vacuum giving compound 3 which was used for the next step without purification. Yield: 1.56 g (700).
[0225] Step B
[0226] Compound 3 (1.56 g, 7 mmol) in MeOH (20 mL) of was added to 10% NaOH (5 mL). The reaction mixture was stirred at r.t for 8 h and then treated with 50 HCl until pH˜3. The precipitate formed was filtered, dried and used for the next step without purification. Yield: 1.33 g (91%).
[0227] Step C
[0228] CDI (117 mg, 0.72 mmol) was added to a solution of compound 4 (125 mg, 0.6 mmol) in dioxane (15 mL) under stirring and the mixture was heated at 50° C. for 30 minutes until end of liberation of gas. Then compound 5 (155 mg, 0.6 mmol) was added and the mixture was left stirring at 60° C. for 2 days (reaction is monitored by TLC). When reaction completed the mixture was treated with water (150 mL), extracted by CH.sub.2Cl.sub.2 (3×30 mL) washed with 5% Na.sub.2CO.sub.3 (30 mL), water (30 mL) and brine (30 mL), dried under Na.sub.2SO.sub.4. Then the solvent was removed in vacuum and the obtained residue was purified by flash chromatography to afford SSI-1. Yield: 135 mg (50%).
[0229] .sup.1H NMR and LC/MS data for SSI-1 are shown in Exhibits A and B, incorporated herein in their entirety.
Example 2—SSI-2
[0230] ##STR00030##
[0231] To a solution of compound 1 (200 mg, 1 mmol) in CH.sub.3CN (20 mL) trifluoroethyl chlorocarbonate (240 mg, 1.2 mmol) and DIPEA (322 mg, 2.5 mmol) were added under stirring at r.t. After 30 min of stirring amine 2 (258 mg, 1 mmol) the reaction mixture was heated at 100° C. for 24 h, then cooled, treated with water (250 mL) and extracted by CH.sub.2Cl.sub.2 (3×30 mL), washed with water (30 mL) and brine (30 mL), dried under Na.sub.2SO.sub.4. Then the solvent was removed in vacuum and the obtained residue was purified by flash chromatography giving pure SSI-2. Yield: 266 mg (50%).
Example 3—SSI-3
[0232] ##STR00031##
[0233] To a solution of compound 2 (214 mg, 1 mmol) in CH.sub.3CN (30 mL) trifluoroethyl chloroformate (195 mg, 12 mmol) was added under stirring. Then diisopropyl ethyl amine (150 g, 2.5 mmol) and amine 3 (258 mg, 1 mmol). The reaction mixture was stirred at 100 C for 24 h. Then the mixture was treated with water (100 mL) and extracted by CH.sub.2Cl.sub.2 (3×30 mL). The organic layer was washed with water (30 mL) and brine (30 mL) and dried under Na.sub.2SO.sub.4. The solvent was removed in vacuum and the residue was purified by flash chromatography to give SSI-3. Yield: 314 mg (63%).
[0234] .sup.1H NMR and LC/MS data for SSI-3 are shown in Exhibits C and D, incorporated herein in their entirety.
Example 4—SSI-4
[0235] ##STR00032##
[0236] Step A
[0237] To a solution of compound 1 (1.52 g, 10 mmol) in CH.sub.3CN (30 mL), compound 2 (1.95 g, 12 mmol) was added under stirring. Then diisopropyl ethyl amine (1.5 g, 25 mmol) and amine 3 (2.11 g, 10 mmol). The reaction mixture was stirred at 100° C. for 24 h. Then the mixture was treated with water (150 mL) and extracted by CH.sub.2Cl.sub.2 (3×30 mL). The organic layer was washed with water (30 mL) and brine (30 mL) and dried under Na.sub.2SO.sub.4. The solvent was removed in vacuum giving product 4 which was used for the next step without purification. Yield: 3.12 g (80%).
[0238] Step B
[0239] Compound 4 (2.73 g, 7 mmol) in MeOH (20 mL) of was added to 10% NaOH (5 mL). The reaction mixture was stirred at r.t for 8 h and then treated with 5% HCl until pH˜3. The precipitate formed was filtered, dried giving compound 5 which was used for the next step without purification. Yield: 2.24 g (85%).
[0240] Step C
[0241] To a solution of compound 5 (376 mg, 1 mmol) in dioxane (20 mL) CDI (194 mg, 1.2 mmol) was added and heated at 50° C. for 30 min until completion of gas liberation. Then methyl amine hydrochloride (96 mg, 3 mmol) was added and the mixture was stirred at 60 C for 2 h. Then the reaction mixture was cooled and treated with water (100 mL) and extracted by CH.sub.2Cl.sub.2. The organic layer was washed with 10% Na.sub.2CO.sub.3 (20 mL), brine (20 mL) and dried under Na.sub.2SO.sub.4. The solvent was removed in vacuum and the residue was purified by flash chromatography to afford SSI-4. Yield: 148 mg (38%).
[0242] .sup.1H NMR and LC/MS data for SSI-4 are shown in Exhibits E and F, incorporated herein in their entirety.
Methods of Use
General Materials and Methods
[0243] DNA isolation and STR Analysis
[0244] Genomic DNA was extracted from previously established cell lines (MDA-MB-468, MDA-MB-231, A375, HovTax2, OVCA420, Capan-2, MiaPaca2, DU-145, LNCAP, CaCo2, HT29, SNU449, A549, H1792), and cell lines established in the Copland laboratory (THJ16T, THJ29T, BCJ4T, and MelalS) using Purelink™ Genomic DNA mini kit (Invitrogen).
[0245] Sixteen STR markers were PCR amplified using fluorescently labeled primers from ABI (Applied Biosystems), and were analyzed using ABI 3130 (Applied Biosystems). Peak sizes were calculated versus a co-injected size standard using Gene Marker (Soft Genetics, State College, Pa.).
DNA Microarray
[0246] RNA purified from subject tissues were sent to Mayo Clinic Advanced Genomic Technology Center Gene Expression Core for gene-array expression analysis using Affymetrix Human Genome U133 Plus 2.0 Array chips. Expression data is deposited at Gene Expression Omnibus Database (Accession #GSE-TBD). Details of data processing and methodology are previously described (Tun H W, Marlow L A, von Roemeling C A, Cooper S J, Kreinest P, Wu K, Luxon B A, Sinha M, Anastasiadis P Z, Copland J A. Pathway signature and cellular differentiation in clear cell renal cell carcinoma. PLoS One. 2010; 5(5):e10696). Genespring GX 7.3.1 (Agilent Technologies) was used to create heatmaps using Affymetrix default analysis settings and standard Genespring normalizations. Ingenuity® Systems was used to model signaling pathways.
Growth Assays
[0247] Cells were seeded at 5,000 cells/well in clear-bottom 96-well plates in triplicate in Maintenance Media. Drug treatment was applied at a concentration of 1:1000 in reduced serum (3%) Maintenance Media. After 72 hours, cells were washed with PBS, and stored at −80 OC prior to analysis using CyQuant® Proliferation Analysis Kit (Invitrogen) as per manufacturers' protocol for relative fluorescence units. Alternatively, cells were plated 2×10.sup.5/well in 12-well plates (Midwest Scientific) in triplicate prior to drug treatment. After 120 hour treatment, cell number was established using a Coulter Particle Counter (Beckman). Or, cells were plated (0.5 or 1×105/well) in 24-well plates (Midwest Scientific), 3×. After 72 hour treatment, cell number established using Coulter Particle Counter (Beckman). Oleic acid-albumin (Sigma Aldrich) was added to media at 5 μM, and was applied adjuvant to drug treatment. Drug stocks were prepared in DMSO (Sigma) at 1000×. EC.sub.50 dosing per cell line was calculated using CalcuSyn® analytical software.
Luciferase Assay
[0248] A498 and ACHN cells were transiently transfected with p5×ATF6-GL3 UPR luciferase reporter (Addgene plasmid#11976) and pRL-CMV-renilla (Promega) using Lipofectamine 2000 (Invitrogen). Cells were treated as indicated for 24H, prior to collection and analysis using Promega Dual Luciferase assay kit per manufacturer's specifications. Luciferase activity was measured using Veritas Luminometer (Promega); and results are reported as relative luminescence.
Western Blot Analysis
[0249] Protein extraction and western blot analysis was performed as previously described (Copland J A, Marlow L A, Kurakata S, et al. Novel high-affinity PPARgamma agonist alone and in combination with paclitaxel inhibits human anaplastic thyroid carcinoma tumor growth via p21WAF1/CIP1. Oncogene. Apr. 13 2006; 25(16):2304-2317). Primary antibodies included SCD1 (Sigma-Aldrich, #HPA012107), BiP (Cell Signaling, #3183), CHOP (Cell Signaling, #2895), sXBP1(Santa Cruz Biotechnology, #sc-7160), PARP(Cell Signaling, #9542), and f3-actin (Sigma-Aldrich, #A5441).
Meta Analysis
[0250] Meta Analysis was performed as previously described (Kupershmidtl, SuQ J et al. Ontology-based meta-analysis of global collections of high-throughput public data. PLoS One 2010). The online platform Gene expression-based Outcome for Breast cancer Online (GOBO), including data from 1,881 patients and 11 studies employing Affimetrix U133A microarrays, was used for assessment of differential SCD1 expression in different breast cancer subtypes. Relationship between SCD1 expression and patient survival in different cancer subtypes was determined using KMPlotter, for lung and breast cancer. Affymetrix probe ID 200832 was identified as optimal probe for SCD1 analysis using jetset analysis was performed for relapse-free survival, patients split by median expression with best cutoff selected, no censoring for follow up threshold selected.
RNA Isolation and QPCR
[0251] RNA isolation, preparation of cDNA, and QPCR performed as previously described (Tun H W, Marlow L A, von Roemeling C A, Cooper S J, Kreinest P, Wu K, Luxon B A, Sinha M, Anastasiadis P Z, Copland J A. Pathway signature and cellular differentiation in clear cell renal cell carcinoma. PLoS One. 2010; 5(5):e10696). TaqMan®FAM™ dye-labeled probes: GAPDH(Hs99999905_m1), POLR2A(Hs00172187_m1), SCD1(Hs01682761_m1), HSPA5(Hs99999174_m1), GADD45A(Hs00169255_m1), DDIT3(Hs01090850 m1), and HERPUD1(Hs01124269_m1). Fold-change comparisons between normal vs. tumor, and DMSO vs. drug treated samples calculated using the ΔΔCt method (Schmittgen T D, Livak K J. Analyzing real-time PCR data by the comparative C(T) method. Nat Protoc. 2008; 3(6):1101-8).
Immunohistochemistry and Immunofluorescence Analysis
[0252] Formalin-fixed, paraffin-embedded subject tissues were mounted on slides, blocked with Diluent (DakoCytomation) for 30 min, and then probed for SCD (Sigma-Aldrich, #HPA012107). IHC scoring was performed as previously described (von Roemeling C A, Marlow L A, Wei J J, et al. Stearoyl-CoA desaturase 1 is a novel molecular therapeutic target for clear cell renal cell carcinoma. Clin Cancer Res. May 1 2013; 19(9):2368-2380). Cases where insufficient tumor tissue presented were excluded. 20× images were obtained using Scanscope X T and Imagescope software.
[0253] Cells were plated in 4-chamber slides (Thermo Scientific) prior to drug treatment. After 24H drug treatment, cells were fixed using 4% paraformaldehyde (Sigma), permeabilized using 0.1% Triton X-100, and blocked with Diluent (DakoCytomation) for 1H. Primary antibody was applied: ATF6 and HERPUD1 (Lifespan, # ABIN466153). Species specific secondary was applied (Jackson Labs). VECTASHIELD mounting media (Vector Labs) containing DAPI was used. Negative sections were prepared by incubating the slides in the absence of the primary antibody.
Flow Cytometry
[0254] After treatment, adhered and floating cells were collected using Accutase (Innovative Cell Technologies, Inc.), washed with PBS, and were suspended in 1× cold binding buffer (BD Pharmingen) at 1×10.sup.6 cells/mL. Cells were stained with Propidium Iodide (BD Pharmingen). Analysis was performed using Accuri C6 flow cytometer. Unstained DMSO cells were used to set population parameters.
In Vivo Analysis
[0255] 1×10.sup.6 THJ16T ATC cells were subcutaneously injected in female athymic nu/nu mice (Harlan Laboratories). Treatment was initiated once tumor volumes reached 50-100 mm.sup.3. MF-438 was suspended in 0.5% carboxymethyl-cellulose containing strawberry drink flavoring (0.1 g/mL) in sterilized H.sub.2O at 25 mg/kg in a 100 μl dose, and administered via oral gavage once daily. Carfilzomib was solubilized in DMSO (4% of FC), suspended in 100% corn oil at 4 mg/kg per 50 uL dose and administered via intraperitoneal injection twice weekly on consecutive days. Tumor volume (0.5236[L*W*H]) and body weight were measured 2×/week. N=10 mice/group.
Biological Assays: Statistical Analysis
[0256] Data values are presented as fold change or percent of control±standard deviation unless otherwise specified. Fold change values 1.5<are considered statistically significant. Treatment group comparisons were analyzed using two-tailed paired Student's t-test with p<0.05 being considered statistically significant, and is indicated by asterisk (*). Drug synergy determined using CalcuSyn® (Chou T C, Hayball M P. CalcuSyn for Windows: multiple-drug dose effect analyzer and manual. Biosoft. 1997; Cambridge (UK)).
Example 5—Cell Activity of Compounds
[0257] In order to identify potential SCD1 inhibitors, a high-throughput proliferative-based screening method was used, with four ccRCC cell lines including A498, ACHN, Caki1, and Caki2. The SCD1 inhibitor MF-438 was included as a positive control. Known compounds ChemBL375265 (Liu G, Lynch J K, Freeman J, et al. Discovery of potent, selective, orally bioavailable stearoyl-CoA desaturase 1 inhibitors. Journal of medicinal chemistry. Jun. 28 2007; 50(13): 3086-3100) (SetA.100) and SAR707 (Voss M D, Zoller G, Matter H, et al. Discovery and pharmacological characterization of SAR707 as novel and selective small molecule inhibitor of stearoyl-CoA desaturase (SCD1). European journal ofpharmacology. May 5 2013; 707(1-3): 140-146) (TC03.100) were included as single-blinded positive controls, and are indicated with an asterisk (*).
[0258]
[0259] Exogenous application of OA (oleic acid), the primary product of SCD1 enzymatic activity, demonstrates rescue of the proliferative defects induced by SCD1 inhibitors (Roongta U V, Pabalan J G, Wang X, et al. Cancer cell dependence on unsaturated fatty acids implicates stearoyl-CoA desaturase as a target for cancer therapy. Mol Cancer Res. November 2011; 9(11): 1551-1561). A498, ACHN, and Caki1 cell lines were treated with the EC.sub.50 dose of each MF-438, ChemBL375265, SSI-1, SSI-4, SSI-3, and SSI-2 with or without concomitant application of OA (5 μg/μL). Near total rescue of cell proliferation was observed with OA in all three cell lines treated with MF-438, ChemBL375265, SSI-1, SSI-4, SSI-3, and SSI-2 (
Example 6—Functional Characterization of Novel Compounds
[0260] Activating transcription factor 6 (ATF6) is a key regulator of the unfolded protein response (UPR) that recognizes unfolded protein response elements (UPRE) in the promoter regions of several key mediators of the ER stress response, initiating their transcription (Wang Y, Shen J, Arenzana N, Tirasophon W, Kaufman R J, Prywes R. Activation of ATF6 and an ATF6 DNA binding site by the endoplasmic reticulum stress response. J Biol Chem. Sep. 1 2000; 275(35):27013-27020). A498 and ACHN transfected with an ATF6-UPRE luciferase reporter were treated with the EC.sub.50 doses of ChemBL375265, SSI-1, SSI-4, SSI-3, and SSI-2 with or without OA supplementation were evaluated in order to determine whether the identified compounds could recapitulate activation of the UPR. ChemBL375265, SSI-1, SSI-4, and SSI-2 treatment resulted in a significant upregulation of luciferase activity in both cell lines that was completely blocked with exogenous application of OA (
Example 7—SCD1 Expression Profile in Aggressive Malignancies
[0261] Meta analysis was performed using public gene arrays that included normal and tumor datasets in order to evaluate SCD1 transcript expression. Multiple datasets were queried per cancer type for SCD1 transcript expression. These results revealed an overall trend for aberrant SCD1 expression in tumor versus normal, with elevated expression observed in several aggressive malignancies such as kidney, liver, breast, lung, and pancreatic cancer.
[0262] The meta analysis of published gene array datasets compared tumor versus normal controls. Cancer types are listed by score where SCD1 transcript expression is upregulated, in descending order. Gene scoring is established by numerical score, where a gene is ranked based on statistical significance and consistency of expression across queried biosets. A numerical score of 100 is assigned to the highest ranked gene, and all other scores are then normalized to that gene. Number of queried datasets, and the predominant trend of SCD1 expression per cancer type is given.
[0263] Upregulated SCD1 transcript expression was found in the following cancers: kidney cancer, liver cancer, breast cancer, adrenal cancer, some forms of lymphoma, malignant tumor of muscle, thymus cancer, uterine cancer, gastric cancer, thyroid cancer, secondary malignant neoplastic disease, cancer of the head and neck, lung cancer, pancreatic cancer, primary malignant neoplasm of the bone, and ovarian cancer. Downregulated SCD1 transcript expression was found in the following cancers: some forms of leukemia, T-cell lymphoma, myeloid leukemia, brain cancer, prostate cancer, bladder cancer, lymphoid leukemia, neuroendocrine tumor, skin cancer, B-cell lymphoma, esophageal cancer, testicular cancer, and multiple myeloma/plasmacytoma.
[0264] Immunohistochemistry (IHC) of subject primary tumor tissues including bladder carcinoma, colon adenocarcinoma, lung adenocarcinoma, hepatocellular carcinoma, malignant melanoma, ovarian carcinoma, and prostate adenocarcinoma revealed strong positive staining in a large proportion of the samples examined (
Example 8—Gene-Array Analysis in Thyroid Tissue
[0265] Gene-array analysis was performed using 12 ATC (anaplastic thyroid cancer) tumor and 13 normal thyroid (NT) tissue specimens. Results revealed altered expression in fatty acid metabolism including fatty acid synthesis, cholesterol synthesis, mitochondrial and peroxisomal fatty acid oxidation, and cellular uptake of fatty acids. Findings are depicted in the heatmap in
TABLE-US-00002 TABLE 1 Change in Fatty Acid Synthesis in Thyroid Cancer Tissue Gene Fold Symbol Change Fatty Acid Synthesis Acetyl-CoA Carboxylase ACACA 1.74* ACACB 0.69 Fatty Acid Synthase FASN 1.36 Elongation of very long chain fatty ELOVL1 1.28 acids ELOVL4 2.22* ELOVL5 0.82 ELOVL7 0.30 Stearoyl-CoA Desaturase SCD 8.84* SCD5 2.38* Diacylglycerol O-acyltransferase DGAT2 1.36 Cholesterol Synthesis HMG-CoA Synthase HMGCS1 1.04 HMG-CoA Reductase HMGCR 0.72 Mevalonate Kinase MVK 0.89 Isopentenyl Diphosphate-Isomerase IDI1 0.96 IDI2 2.19* Farnesyl Diphosphate Synthetase FDPS 1.38 Squalene Epoxidase SQLE 2.72* Lanosterol Synthase LSS 1.15 Sterol C4-methyl Oxidase SC4MO 0.97 7-Dehydrocholesterol Reductase DHCR7 0.93 Hydroxysteroid (17-beta) HSD17B1 0.71 Dehydrogenase HSD17B4 0.44 HSD17B6 0.10 HSD17B7 0.99 HSD17B8 0.25 HSS17B12 0.82 Mitochondrial Fatty Acid Oxidation Carnitine palmitoyltransferase 2 CPT1A 1.38 Carnitine palmitoyltransferase 2 CPT2 1.03 Trifunctional protein HADHA 1.02 HADHB 0.75 Acyl-CoA dehydrogenases ACADS 0.32 ACADM 0.60 ACADL 0.24 ACADVL 0.90 Acetyl-CoA acetyltransferase ACAT1 1.16 ACAT2 1.73* Peroxisomal Fatty Acid Oxidation Peroxisomal acyl-CoA oxidase 1 ACOX1 0.85 ACOX2 0.40 ACOX3 1.09 ATP-Binding cassette, Sub-family D ABCD1 0.85 ABCD3 0.73 ABCD4 0.85 Acetyl-CoA acyltransferase 1 ACAA1 1.02 Acetyl-CoA acyltransferase 2 ACAA2 0.88 Sterol carrier protein SCP2 1.16 Carnitine acetyl transferase CRAT 1.03 2-Enoyl-CoA hydratase ECH1 0.98 Cellular Uptake of Fatty Acids Fatty acid translocase FAT/CD36 2.80* Fatty acid binding protein FABP2 0.60 FABP4 6.03* FABP5 4.33* Solute carrier Family (Fatty acid SLC27A1 0.86 transporter) SLC27A2 0.36 SLC27A3 1.96* SLC27A4 0.80
[0266] In order to evaluate the expression profile of SCD1 in thyroid malignancy, quantitative PCR (QPCR) as well as immunohistochemistry (IHC) of subject samples was performed. SCD1 was transcriptionally upregulated in all ATC and papillary thyroid carcinoma (PTC) samples examined, as well as several samples of follicular adenoma (FA) and follicular thyroid carcinoma (FTC) (
[0267] Gene-array analysis of ATC subject samples illuminates significant alterations in fatty acid metabolism in these tumors (
Example 9—Effect of SCD1 Inhibitor on Proliferation of Thyroid Cancer Cells
[0268] The efficacy of pharmacologic inhibition of this enzyme on tumor cell proliferation after a 72H treatment was determined, using A939572—a commercially available small molecule SCD1 inhibitor (Xin Z, Zhao H, Serby M D, Liu B, Liu M, Szczepankiewicz B G, Nelson L T, Smith H T, Suhar T S, Janis R S, Cao N, Camp H S, Collins C A, Sham H L, Surowy T K, Liu G. Discovery of piperidine-aryl urea-based stearoyl-CoA desaturase 1 inhibitors. Bioorg Med Chem Lett. 2008; 18(15):4298-302). No response was observed in either NT or FA cells (
[0269] Exogenous application of MUFAs, such as oleic or palmitoleic acid, can rescue the proliferative defects generated by SCD1 inhibition as these are the primary products of SCD1 enzymatic activity (Roongta U V, Pabalan J G, Wang X, Ryseck R P, Fargnoli J, Henley B J, Yang W P, Zhu J, Madireddi M T, Lawrence R M, Wong T W, Rupnow B A. Cancer cell dependence on unsaturated fatty acids implicates stearoyl-CoA desaturase as a target for cancer therapy. Mol Cancer Res. 2011; 9(11):1551-61). THJ29T, THJ16T and KTC2 cells were treated with the EC.sub.50 dose of A939572 or MF-438 for 72H with or without 5 μM of oleic acid (OA). Concomitant treatment of cells using either SCD1 inhibitor with OA resulted in complete rescue of proliferation (
Example 10—SCD1 Inhibitor Synergy in Combination with Proteasome Inhibitors
[0270] The UPR pathway is activated by a variety of cellular stressors which leads to accumulation of mis-folded proteins within the ER. There are three transmembrane ER resident master regulators of the UPR: PERK (Eukaryotic translation initiation factor 2-alpha kinase 3, EIF2AK3), IRE1 (Endoplasmic to nucleus signaling 1, ERN1), and ATF6 (Activating transcription factor 6) (Xu C, Bailly-Maitre B, Reed J C.
[0271] Endoplasmic reticulum stress: cell life and death decisions. J Clin Invest. 2005; 115(10):2656-64; Walter P, Ron D. The unfolded protein response: from stress pathway to homeostatic regulation. Science. 2011; 334(6059):1081-6; Hetz C, Chevet E, Harding H P. Targeting the unfolded protein response in disease. Nat Rev Drug Discov. 2013; 12(9):703-19). PERK activation leads to repression of protein translation. IRE1 activation triggers endoribonuclease activity that splices XBP1, a molecular chaperone and transcriptional activator of other ER stress response proteins, leading to growth arrest or apoptosis. ATF6 is a transcription factor that is proteolytically processed at the Golgi into its active state, whereby it targets promoter regions containing UPR elements (UPRE; ER stress elements, ERSE). Altogether the UPR facilitates the attenuation of protein translation, molecular chaperone mediated protein refolding, and ERAD. The primary goal of this pathway is to restore cellular homeostasis; however in extreme or prolonged cases of stress it can also initiate cellular senescence or death (Kim I, Xu W, Reed J C. Cell death and endoplasmic reticulum stress: disease relevance and therapeutic opportunities. Nat Rev Drug Discov. 2008; 7(12):1013-30). Targeted inhibition of the ERAD component of the UPR using a proteosome inhibitor such as bortezomib or carfilzomib in conjunction with SCD1 inhibition may enhance cellular stress and drive tumor cells toward cell death in a synergistic manner.
[0272] THJ29T, THJ16T, and KTC2 were treated with carfilzomib (
[0273] Anti-proliferative synergy was evaluated with increased cell death. THJ29T and THJ16T treated for 48H with EC.sub.50 doses of either A939572 or MF-438 in combination with either carfilzomib or bortezomib were probed for PARP cleavage and CHOP expression, both markers indicative of apoptosis (
Example 11—SCD1 Inhibitor Synergy in Combination with mTor Inhibitors
[0274]
Example 12—SCD1 Inhibitor in Combination with Proteasome Inhibitor in an In Vivo Model
[0275] SCD1 inhibition in vivo using MF-438 fails to demonstrate tumor response as a monotherapy, yet effectively leads to decreased tumor growth when combined with carfilzomib (
Example 13—Overexpression of SCD1 in HCC Cells and Synergy Observed with Combinations of an SCD1 Inhibitor and a Serine:Threonine:Tyrosine Kinase Inhibitor
[0276] As shown in
[0277] SNU449 HCC cells were plated at 20,000 cells/well in 12-well plates. The next day, cells were treated with SSI-4, sorafenib or sorafenib plus SSI-4 at the indicated doses. The doses were chosen by first determining the IC.sub.50 (dose at which 50% of cell proliferation is inhibited) concentrations for SSI-4 (IC.sub.50=3.2 nM) and sorafenib (IC.sub.50=2.0 μM). Using fixed ratios and dosing down from the IC.sub.50 concentrations stepwise (25%, 12.5%, and 6.25%) was performed for each compound alone or in combination. On day 5, cells were frozen, DNA isolated and quantitated by immunofluorescence (Hoechst reagent) in a spectrophotometer. Cellular DNA is directly proportional to cell number and is commonly used as a measure of cell number. All doses are in replicates of three with the mean+/−standard deviation determined. Using the method of Chou and Talalay, combination index (CI) was used to determine whether these two compounds when combined act synergistically (<0.8), additively ((<1.1>0.8), or antagonistically (>1.1). Sorafenib is currently the only clinical standard of care for metastatic HCC. As seen in
OTHER EMBODIMENTS
[0278] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.