TUMOR IMMUNOTHERAPY USING SINDBIS VIRAL VECTORS AND AGONIST MONOCLONAL ANTIBODIES
20220265820 · 2022-08-25
Inventors
- Daniel Meruelo (Scarborough, NY)
- Iris SCHERWITZL (New York, NY, US)
- Silvana OPP (New York, NY, US)
- Minjun YU (Dobbs Ferry, NY, US)
- Alicia HURTADO-MARTINEZ (New York, NY, US)
- Christine Pampeno (New York, NY)
Cpc classification
C07K16/2875
CHEMISTRY; METALLURGY
A61K39/3955
HUMAN NECESSITIES
A61K48/0083
HUMAN NECESSITIES
C12N2770/36143
CHEMISTRY; METALLURGY
C12N2770/36134
CHEMISTRY; METALLURGY
C07K16/2878
CHEMISTRY; METALLURGY
International classification
A61K39/395
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The present disclosure provides compositions and methods for the treatment of cancer. More specifically, the present disclosure provides compositions and methods utilizing a combination of an oncolytic viruses, such as Sindbis virus, and antibodies directed against a co-stimulatory molecule or to an immune system agonist molecule, such as anti-OX40 antibodies and anti-4-1BB antibodies.
Claims
1. A method for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector and (b) an antibody directed against a co-stimulatory molecule, or a nucleic acid encoding same; or an antibody to an immune system agonist molecule, or a nucleic acid encoding same.
2. The method of claim 1, wherein the antibody is selected from the group consisting of anti-OX40 antibody, anti-4-1BB antibody, anti-CD28 antibody, anti-GITR antibody, anti-CD137 antibody, anti-cd37 antibody, and anti-HVEM antibody.
3. The method of claim 1, wherein the Sindbis viral vector comprises at least one nucleic acid encoding an immunostimulatory or an immunomodulatory protein.
4. The method of claim 2, wherein the immunostimulatory or immunomodulatory protein is IL-I, IL-2, IL-3, IL-4, IL-5, IL-6 IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-34, IL-35 or IL-36.
5. The method of claim 3, wherein the immunostimulatory or immunomodulatory protein is IL-12.
6. The method of claim 1, wherein the Sindbis viral vector and the antibody induce an immune response in a tumor associated antigen (TAA) nonspecific manner.
7. A method for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject.
8. The method of claim 7, wherein the Sindbis viral vector comprising the nucleic acid encoding interleukin-12 further comprises the nucleic acid encoding the anti-OX40 monoclonal antibody.
9. The method of claim 7, comprising administering a Sindbis viral vector comprising the nucleic acid encoding interleukin-12 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody.
10. The method of claim 7, wherein the nucleic acid encoding interleukin-12 comprises the nucleic acid sequence encoding interleukin 12 alpha subunit of SEQ ID NO: 1, the nucleic acid encoding interleukin 12 beta subunit of SEQ ID NO: 2, or a combination thereof.
11. The method of claim 7, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence selected from of SEQ ID NO:6, SEQ ID NO:10, SEQ ID NO:32, SEQ ID NO:36, SEQ ID NO:40, SEQ ID NO:44 and SEQ ID NO:48 encoding an anti-OX40 antibody heavy chain, a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the nucleic acid sequence of SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:34, SEQ ID NO:38, SEQ ID NO:42, SEQ ID NO:46 and SEQ ID NO:50 encoding an anti-OX40 antibody light chain, or any combination of heavy chain nucleic acid sequence or light chain nucleic acid sequence thereof.
12. The method of claim 7, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13, or a combination thereof.
13. The method of claim 7, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered systemically.
14. The method of claim 7, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered parenterally.
15. The method of claim 7, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered intraperitoneally.
16. The method of claim 7, wherein the Sindbis viral vector is replication defective.
17. The method of claim 7, wherein the cancer comprises a solid tumor.
18. The method of claim 7, wherein the cancer is colon cancer, prostate cancer or ovarian cancer.
19. A Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding an anti-OX40 monoclonal antibody.
20. The Sindbis viral vector of claim 19, wherein the nucleic acid encoding interleukin-12 comprises the nucleic acid sequence encoding interleukin 12 alpha subunit of SEQ ID NO: 1, the nucleic acid encoding interleukin 12 beta subunit of SEQ ID NO: 2, or a combination thereof.
21. The Sindbis viral vector of claim 19, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence selected from of SEQ ID NO:6, SEQ ID NO:10, SEQ ID NO:32, SEQ ID NO:36, SEQ ID NO:40, SEQ ID NO:44 and SEQ ID NO:48 encoding an anti-OX40 antibody heavy chain, a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the nucleic acid sequence of SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:34, SEQ ID NO:38, SEQ ID NO:42, SEQ ID NO:46 and SEQ ID NO:50 encoding an anti-OX40 antibody light chain, or any combination of heavy chain nucleic acid sequence or light chain nucleic acid sequence thereof.
22. A composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same.
23. A composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-OX40 monoclonal antibody.
24. A method for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 or (b) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1, thereby treating cancer in the subject.
25. The method of claim 24, wherein the nucleic acid encoding interleukin-12 comprises the nucleic acid sequence encoding interleukin 12 alpha subunit of SEQ ID NO: 1, the nucleic acid encoding interleukin 12 beta subunit of SEQ ID NO: 2, or a combination thereof.
26. The method of claim 24, wherein the nucleic acid encoding NY-ESO-1 comprises a nucleic acid sequence of SEQ ID NO: 14.
27. The method of claim 24, wherein the (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 or (b) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1 are administered systemically.
28. The method of claim 24, wherein the (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 or (b) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1 are administered parenterally.
29. The method of claim 24, wherein the (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 or (b) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1 are administered intraperitoneally.
30. The method of claim 24, wherein the Sindbis viral vector is replication defective.
31. The method of claim 24, wherein the cancer comprises a solid tumor.
32. The method of claim 24, wherein the cancer is colon cancer, prostate cancer or ovarian cancer.
33. A Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding an NY-ESO-1.
34. The Sindbis viral vector of claim 33, wherein the nucleic acid encoding interleukin-12 comprises the nucleic acid sequence encoding interleukin 12 alpha subunit of SEQ ID NO: 1, the nucleic acid encoding interleukin 12 beta subunit of SEQ ID NO: 2, or a combination thereof.
35. The Sindbis viral vector of claim 33, wherein the nucleic acid encoding the NY-ESO-1 comprises a nucleic acid sequence of SEQ ID NO: 14.
36. A composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) a Sindbis viral vector comprising a nucleic acid encoding an NY-ESO-1.
37. A method for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject.
38. The method of claim 37, wherein the Sindbis viral vector comprising the nucleic acid encoding NY-ESO-1 further comprises the nucleic acid encoding the anti-OX40 monoclonal antibody.
39. The method of claim 37, comprising administering a Sindbis viral vector comprising the nucleic acid encoding NY-ESO-1 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody.
40. The method of claim 37, wherein the nucleic acid encoding NY-ESO-1 comprises a nucleic acid sequence of SEQ ID NO: 14.
41. The method of claim 37, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence selected from of SEQ ID NO:6, SEQ ID NO:10, SEQ ID NO:32, SEQ ID NO:36, SEQ ID NO:40, SEQ ID NO:44 and SEQ ID NO:48 encoding an anti-OX40 antibody heavy chain, a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the nucleic acid sequence of SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:34, SEQ ID NO:38, SEQ ID NO:42, SEQ ID NO:46 and SEQ ID NO:50 encoding an anti-OX40 antibody light chain, or any combination of heavy chain nucleic acid sequence or light chain nucleic acid sequence thereof.
42. The method of claim 37, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13, or a combination thereof.
43. The method of claim 37, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered systemically.
44. The method of claim 37, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered parenterally.
45. The method of claim 37, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered intraperitoneally.
46. The method of claim 37, wherein the Sindbis viral vector is replication defective.
47. The method of claim 37, wherein the cancer comprises a solid tumor.
48. The method of claim 37, wherein the cancer is colon cancer, prostate cancer or ovarian cancer.
49. A Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and a nucleic acid encoding an anti-OX40 monoclonal antibody.
50. The Sindbis viral vector of claim 49, wherein the nucleic acid encoding the NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14.
51. The Sindbis viral vector of claim 49, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence selected from of SEQ ID NO:6, SEQ ID NO:10, SEQ ID NO:32, SEQ ID NO:36, SEQ ID NO:40, SEQ ID NO:44 and SEQ ID NO:48 encoding an anti-OX40 antibody heavy chain, a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the nucleic acid sequence of SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:34, SEQ ID NO:38, SEQ ID NO:42, SEQ ID NO:46 and SEQ ID NO:50 encoding an anti-OX40 antibody light chain, or any combination of heavy chain nucleic acid sequence or light chain nucleic acid sequence thereof.
52. The Sindbis viral vector of claim 49, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13, or a combination thereof.
53. A composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same.
54. A composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-OX40 monoclonal antibody.
55. A method for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount (a) a Sindbis viral vector and (b) an anti-4-1BB monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject.
56. The method of claim 55, wherein the Sindbis viral vector and the anti-4-1BB monoclonal antibody are administered systemically.
57. The method of claim 55, wherein the Sindbis viral vector and the anti-4-1BB monoclonal antibody are administered parenterally.
58. The method of claim 55, wherein the Sindbis viral vector and the anti-4-1BB monoclonal antibody are administered intraperitoneally.
59. The method of claim 55, wherein the Sindbis viral vector is replication defective.
60. The method of claim 55, wherein the cancer is a hematologic cancer.
61. The method of claim 55, wherein the cancer is a B cell lymphoma.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
[0142]
[0143]
[0144]
[0145]
[0146]
[0147]
[0148]
[0149]
[0150]
[0151]
[0152]
[0153]
[0154]
[0155]
[0156]
[0157]
[0158]
[0159]
[0160]
[0161]
[0162]
[0163]
[0164]
[0165]
[0166]
[0167]
[0168]
DETAILED DESCRIPTION OF THE INVENTION
[0169] Oncolytic virus (OV) therapy has become a novel immunotherapeutic approach to treat cancer. A rationale for oncolytic virus is that they can infect and lyse the tumor cell. They have been made to selectively replicate in tumor cells either through the direction of tumor specific promoters or through direct intratumoral administration. Most OVs encounter a number of barriers to systemic administration. Once lysed by OVs, tumor cells release tumor associated antigens (TAAs) that can stimulate cytotoxic T cells. OV infection also induces an inflammatory response that helps to trigger an immune anti-tumor response. Several OV clinical trials are underway and have shown promising results. However, whether OV therapy can effectively treat tumors that they are unable to infect remains an unresolved limitation.
[0170] Sindbis virus (SV) belongs to alphavirus genus and is one type of OV. Although it does not lyse infected tumor cells, it can cause their apoptotic death. It offers several important benefits. SV is known as one of the least virulent alphaviruses with clinical signs and symptoms usually unapparent. It has been estimated that there are 17 times more subclinical than symptomatic SV infections. In general, when symptoms do occur in humans they consist of a self-limiting, mild, febrile disease with vesicular exanthema and arthralgia from which most patients recover within 14 days. The disease is in part self-limiting because SV is an RNA virus that does not integrate in the host genome and hence its presence is transitory. The lack of an integrative step in its replication cycle also avoids insertional mutagenesis risks. In addition, SV vectors of the present disclosure were generated from the laboratory strain AR339, which is not known to cause disease in humans. These vectors were further attenuated by rendering them replication-defective.
[0171] SV vectors can target tumors systemically and can reach metastatic tumor cells throughout the body. They can target tumors without infecting normal tissues. However, susceptibility to infection by SV vectors depends on a number of factors including laminin receptor expression and distribution, as well as, defects in IFN signaling in tumors. The present disclosure demonstrates that SV vectors can effectively help cure tumors that they are unable to infect and further demonstrates that the combination antibodies and SV vectors provide a surprising synergistic therapeutic effect against cancer.
[0172] The present disclosure provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a oncolytic viral vector and (b) an antibody directed against a co-stimulatory molecule or a nucleic acid encoding same; or an antibody to an immune system agonist molecule or a nucleic acid encoding same.
[0173] The oncolytic viral vector can be a Sindbis viral vector. The Sindbis viral vector can be replication defective. Sindbis viral vectors were produced as described in U.S. Pat. No. 8,093,021 (incorporated herein by reference in its entirety). The Sindbis viral vector can comprise at least one nucleic acid encoding a therapeutic protein. The Sindbis viral vector can comprise at least one nucleic acid encoding an immunostimulatory or an immunomodulatory protein. The immunostimulatory or immunomodulatory protein can be IL-1, IL-2, IL-3, IL-4, IL-5, IL-6 IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-34, IL-35, IL-36, or any combination thereof. In a preferred aspect, the immunostimulatory or immunomodulatory protein is IL-12. The Sindbis viral vector can comprise at least one nucleic acid encoding LacZ, Flue or GFP.
[0174] The antibody can be an anti-OX40 antibody, an anti-4-1BB antibody, an anti-CD28 antibody, an anti-GITR antibody, an anti-CD137 antibody, an anti-cd37 antibody, an anti-HVEM antibody, or a combination thereof.
[0175] The Sindbis viral vector and the antibody can induce an immune response in a tumor associated antigen (TAA) nonspecific manner. The induced and nonspecific immune response can be a first immune response. The first immune response can be followed by a secondary immuneresponse. The secondary immune response can be the result of one or more TAAs released from the dead tumor cells. The secondary immune response can comprise memory T cells directed against one or more TAAs released from the dead tumor cells.
[0176] The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject.
[0177] The Sindbis viral vector can be replication defective. The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 and can further comprise the nucleic acid encoding the anti-OX40 monoclonal antibody. The method can comprise administering a Sindbis viral vector comprising the nucleic acid encoding interleukin-12 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody.
[0178] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 α, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 β, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit of GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin-12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2.
[0179] The nucleic acid encoding interleukin-12 alpha subunit (IL-12 α, IL-12, p35 subunit) comprises the nucleic acid sequence of SEQ ID NO: 1 shown in the following Table.
TABLE-US-00001 The nucleic acid encoding interleukin-12 alphasubunit (IL-12α, IL-12, p35 subunit) 1 gcaagagaca cagtcctggg aaagtctgcc ggctatccag acaattataa aaatgtgtct 61 cccaaggtca gcgttccaac agcctcaccc tcggcatcca gcagctcctc tcagtgccgg 121 tccagcatgt gtcaatcacg ctacctcctc tttttggcca cccttgccct cctaaaccac 181 ctcagtttgg ccagggtcat tccagtctct ggacctgcca ggtgtcttag ccagtcccga 241 aacctgctga agaccacaga tgacatggtg aagacggcca gagaaaaact gaaacattat 301 tcctgcactg ctgaagacat cgatcatgaa gacatcacac gggaccaaac cagcacattg 361 aagacctgtt taccactgga actacacaag aacgagagtt gcctggctac tagagagact 421 tcttccacaa caagagggag ctgcctgccc ccacagaaga cgtctttgat gatgaccctg 481 tgccttggta gcatctatga ggacttgaag atgtaccaga cagagttcca ggccatcaac 541 gcagcacttc agaatcacaa ccatcagcag atcattctag acaagggcat gctggtggcc 601 atcgatgagc tgatgcagtc tctgaatcat aatggcgaga ctctgcgcca gaaacctcct 661 gtgggagaag cagaccctta cagagtgaaa atgaagctct gcatcctgct tcacgccttc 721 agcacccgcg tcgtgaccat caacagggtg atgggctatc tgagctccgc ctgaaagctc 781 aaggccctct gccacagcgc cctcctcaca cagataggaa acaaagaaag attcataaga 841 gtcaggtggt cttggcctgg tgggcttaag ctccttcagg aatctgttct cccatcacat 901 ctcatctccc caaaggtggc acagctacct cagcatggtg ccctccatcg cttctctcat 961 attcactata caagttgttt gtaagttttc atcaaaatat tgttaagggg cgaagacgtc 1021 ctcccctcaa tgtgttagca gaagagcaag aactgataag ctattgtttt tgtgccaaag 1081 tgtttatgaa aacactcagt caccccttat ttaaaaatat ttattgctat attttatact 1141 catgaaagta catgagccta tttatattta tttattttct atttattata atatttctta 1201 tcagatgaat ttgaaacatt ttgaaacata ccttattttg tggttctaat aaagtaatgt 1261 tatca (SEQ ID NO: 1)
[0180] The nucleic acid encoding interleukin-12 beta subunit (IL-12 β, IL-12, p40 subunit) comprises the nucleic acid sequence of SEQ ID NO: 2 shown in the following Table.
TABLE-US-00002 The nucleic acid encoding interleukin-12 beta subunit (IL-12β, IL-12, p40 subunit) 1 gcacatcaga ccaggcagct cgcagcaaag caagatgtgt cctcagaagc taaccatctc 61 ctggtttgcc atcgttttgc tggtgtctcc actcatggcc atgtgggagc tggagaaaga 121 cgtttatgtt gtagaggtgg actggactcc cgatgcccct ggagaaacag tgaacctcac 181 ctgtgacacg cctgaagaag atgacatcac ctggacctca gaccagagac atggagtcat 241 aggctctgga aagaccctga ccatcactgt caaagagttt ctagatgctg gccagtacac 301 ctgccacaaa ggaggcgaga ctctgagcca ctcacatctg ctgctccaca agaaggaaaa 361 tggaatttgg tccactgaaa ttttaaaaaa tttcaaaaac aagactttcc tgaagtgtga 421 agcaccaaat tactccggac ggttcacgtg ctcatggctg gtgcaaagaa acatggactt 481 gaagttcaac atcaagagca gtagcagttc ccctgactct cgggcagtga catgtggaat 541 ggcgtctctg tctgcagaga aggtcacact ggaccaaagg gactatgaga agtattcagt 601 gtcctgccag gaggatgtca cctgcccaac tgccgaggag accctgccca ttgaactggc 661 gttggaagca cggcagcaga ataaatatga gaactacagc accagcttct tcatcaggga 721 catcatcaaa ccagacccgc ccaagaactt gcagatgaag cctttgaaga actcacaggt 781 ggaggtcagc tgggagtacc ctgactcctg gagcactccc cattcctact tctccctcaa 841 gttctttgtt cgaatccagc gcaagaaaga aaagatgaag gagacagagg aggggtgtaa 901 ccagaaaggt gcgttcctcg tagagaagac atctaccgaa gtccaatgca aaggcgggaa 961 tgtctgcgtg caagctcagg atcgctatta caattcctca tgcagcaagt gggcatgtgt 1021 tccctgcagg gtccgatcct aggatgcaac gttggaaagg aaagaaaagt ggaagacatt 1081 aaggaagaaa aatttaaact caggatggaa gagtccccca aaagctgtct tctgcttggt 1141 tggctttttc cagttttcct aagttcatca tgacaccttt gctgatttct acatgtaaat 1201 gttaaatgcc cgcagagcca gggagctaat gtatgcatag atattctagc attccacttg 1261 gccttatgct gttgaaatat ttaagtaatt tatgtattta ttaatttatt tctgcatttc 1321 acatttgtat accaagatgt attgaatatt tcatgtgctc gtggcctgat ccactgggac 1381 caggccctat tatgcaaatt gtgagcttgt tatcttcttc aacagctctt caatcagggc 1441 tgcgtaggta cattagcttt tgtgacaacc aataagaaca taatattctg acacaagcag 1501 tgttacatat ttgtgaccag taaagacata ggtggtattt ggagacatga agaagctgta 1561 aagttgactc tgaagagttt agcactagtt tcaacaccaa gaaagacttt ttagaagtga 1621 tattgataag aaaccagggc cttctttaga agggtaccta aatttaaaag aattttgaaa 1681 ggctgggtat cggtggtata tgcttttaat tccagcactc aggagaccaa ggcaggcaga 1741 tctctgtgag tttgaggaca gcctggtgta cagagggagt tccagcacag ccagtgccac 1801 acagaaattc tgtctcaaaa acaattaaaa aaaaaaaaaa (SEQ ID NO: 2)
[0181] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4.
[0182] The Sindbis viral vector can comprise the nucleic acid encoding the interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and a nucleic acid encoding the interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit comprises the amino acid sequence of SEQ ID NO: 3 shown in the following Table.
TABLE-US-00003 The amino acid sequence of the interleukin-12 alpha subunit 1 MCQSRYLLFL ATLALLNHLS LARVIPVSGP ARCLSQSRNL LKTTDDMVKT AREKLKHYSC 61 TAEDIDHEDI TRDQTSTLKT CLPLELHKNE SCLATRETSS TTRGSCLPPQ KTSLMMTLCL 121 GSIYEDLKMY QTEFQAINAA LQNHNHQQII LDKGMLVAID ELMQSLNHNG ETLRQKPPVG 181 EADPYRVKMK LCILLHAFST RVVTINRVMG YLSSA (SEQ ID NO: 3)
[0183] The amino acid sequence of the interleukin-12 beta subunit comprises the amino acid sequence of SEQ ID NO: 4 shown in the following Table.
TABLE-US-00004 The amino acid sequence of the interleukin-12 beta subunit 1 MCPQKLTISW FAIVLLVSPL MAMWELEKDV YVVEVDWTPD APGETVNLTC DTPEEDDITW 61 TSDQRHGVIG SGKTLTITVK EFLDAGQYTC HKGGETLSHS HLLLHKKENG IWSTEILKNF 121 KNKTFLKCEA PNYSGRFTCS WLVQRNMDLK FNIKSSSSSP DSRAVTCGMA SLSAEKVTLD 181 QRDYEKYSVS CQEDVTCPTA EETLPIELAL EARQQNKYEN YSTSFFIRDI IKPDPPKNLQ 241 MKPLKNSQVE VSWEYPDSWS TPHSYFSLKF FVRIQRKKEK MKETEEGCNQ KGAFLVEKTS 301 TEVQCKGGNV CVQAQDRYYN SSCSKWACVP CRVRS (SEQ ID NO: 4)
[0184] The Sindbis viral vector can comprise a nucleic acid encoding an interleukin-12 alpha subunit that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 3 and a nucleic acid encoding an interleukin-12 alpha subunit that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 4.
[0185] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8.
[0186] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO:5 shown in the following Table.
TABLE-US-00005 anti-OX40 variable heavy chain amino acid (mouse anti-OX40 variable heavy chain) 1 MAEVQLVESG GGLVQPGGSL RLSCAASGFT FSNYTMNWVR QAPGKGLEWV 51 SAISGSGGST YYADSVKGRF TISRDNSKNT LYLQMNSLRA EDTAVYYCAK 101 DRYSQVHYAL DYWGQGTLVT V (SEQ ID NO: 5)
[0187] The nucleic acid sequence encoding the anti-OX40 variable heavy chain comprises the nucleic acid sequence of SEQ ID NO:6 shown in the following Table.
TABLE-US-00006 anti-OX40 variable heavy chain nucleic acid (mouse anti-OX40 variable heavy chain) 5′atggccgaggtgcagctggtggagagcggcggcggcctggtgcagcc cggcggcagcctgaggctgagctgcgccgccagcggcttcaccttcagc aactacaccatgaactgggtgaggcaggcccccggcaagggcctggagt gggtgagcgccatcagcggcagcggcggcagcacctactacgccgacag cgtgaagggcaggttcaccatcagcagggacaacagcaagaacaccctg tacctgcagatgaacagcctgagggccgaggacaccgccgtgtactact gcgccaaggacaggtacagccaggtgcactacgccctggactactgggg ccagggcaccctggtgaccgtg 3′ (SEQ ID NO: 6)
[0188] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO:7 shown in the following Table.
TABLE-US-00007 anti-OX40 variable light chain amino acid (mouse anti-OX40 variable light chain) (SEQ ID NO: 7) 1 DIQMTQSPDS LPVTPGEPAS ISCRSSQSLL HSNGYNYLDW YLQKAGQSPQ 51 LLIYLGSNR
[0189] The nucleic acid sequence encoding the anti-OX40 variable light chain comprises the nucleic acid sequence of SEQ ID NO:8 shown in the following Table.
TABLE-US-00008 anti-OX40 variable light chain nucleic acid (mouse anti-OX40 variable light chain) (SEQ ID NO: 8) 5′gacatccagatgacccagtcccccgactccctgcccgtgacccccggc gagcccgcctccatctcctgccggtcctcccagtccctgctgcactccaa cggctacaactacctggactggtacctgcagaaggccggccagtcccccc agctgctgatctacctgggctccaaccgggcctccggcgtgcccgaccgg ttctccggctccggctccggcaccgacttcaccctgaagatctcccgggt ggaggccgaggacgtgggcgtgtactactgccagcagtactacaaccacc ccaccaccttcggccagggcaccaagctggagatcaagcgg-3′
[0190] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain of amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding an anti-OX40 variable light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding an anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%˜ or 100% identical to amino acid sequence of SEQ ID NO: 7.
[0191] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO:9 shown in the following Table.
TABLE-US-00009 anti-OX40 antibody heavy chain amino acid sequence (mouse anti-OX40 IgG2a antibody heavy chain) (SEQ ID NO: 9) MGQSRYLLFLATLALLNHLSLAMAEVQLVESGGGLVQPGGSLRLSCAASG FTFSNYTMNWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSK NTLYLQMNSLRAEDTAVYYCAKDRYSQVHYALDYWGQGTLVTVAAKTTAP SVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAV LQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI PAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVV DVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWM SGKEEKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVT LTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEK KNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[0192] The nucleic acid sequence encoding the anti-OX40 antibody heavy chain comprises the nucleic acid sequence of SEQ ID NO: 10 shown in the following Table.
TABLE-US-00010 anti-OX40 antibody heavy chain nucleic acid sequence (mouse anti-OX40 IgG2a antibody heavy chain) (SEQ ID NO: 10)
[0193] In SEQ ID NOs: 9 and 10, the underlined residues indicate IL-2 signal peptide; the Bold residues indicate variable antigen binding region; the non-underlined residues indicate mouse heavy chain IgG2a constant region, GB Accession BC080671; and the bold and underlined residues indicate the Hinge and disulfide bond region. The double underlined residue in SEQ ID NO: 9 indicates change from C to T to remove ApaI site. The dotted underlined residues in SEQ ID NO: 9 indicate Kozak sequence.
[0194] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID NO:11 shown in the following Table.
TABLE-US-00011 anti-OX40 antibody light chain amino acid sequence (mouse anti-OX40 IgG2a antibody light chain) (SEQ ID NO: 11) MGQSRYLLFLATLALLNHLSLADIQMTQSPDSLPVTPGEPASISCRSSQS LLHSNGYNYLDWYLQKAGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTL KISRVEAEDVGVYYCQQYYNHPTTFGQGTKLEIKRADAAPTVSIFPPSSE QLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTY SMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
[0195] The nucleic acid sequence encoding the mouse anti-OX40 antibody light chain comprises the nucleic acid sequence of SEQ ID NO 12 shown in the following Table
TABLE-US-00012 anti-OX40 antibody light chain nucleic acid sequence (mouse anti-OX40 IgG2a antibody light chain) (SEQ ID NO: 12)
[0196] In SEQ ID NOs: 11 and 12, the underlined residues indicate IL-2 signal peptide; the Bold residues indicate variable antigen binding region; the non-underlined residues indicate light constant region, GB Accession BC091750.1. The dotted underlined residues in SEQ ID NO: 12 indicate Kozak sequence.
[0197] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12.
[0198] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12.
[0199] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO:13 shown in the following Table.
TABLE-US-00013 amino acid sequence of the Target antigen (Target Antigen: OX40/CD134, Receptor for TNFSF4/OX40L/GP34) (SEQ ID NO: 13) 1 MCVGARRLGR GPCAALLLLG LGLSTVTGLH CVGDTYPSND RCCHECRPGN 51 GMVSRCSRSQ NTVCRPCGPG FYNDVVSSKP CKPCTWCNLR SGSERKQLCT 101 ATQDTVCRCR AGTQPLDSYK PGVDCAPCPP GHFSPGDNQA CKPWTNCTLA 151 GKHTLQPASN SSDAICEDRD PPATQPQETQ GPPARPITVQ PTEAWPRTSQ 201 GPSTRPVEVP GGRAVAAILG LGLVLGLLGP LAILLALYLL RRDQRLPPDA 251 HKPPGGGSFR TPIQEEQADA HSTLAKI
[0200] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 antibody variable heavy chain comprising the amino acid sequence of SEQ ID NO: 31 shown in the following Table.
TABLE-US-00014 Human anti-OX40 antibody, 1-12Z5 (ATCC No. PTA-7216) Heavy chain variable region amino acid sequence. Leader sequence in bold. (SEQ ID NO: 31) 1 MTMITPSLVP SSDPLVTAAS VLEFALLIRL TIGQAVVSTQ STGGGLVQPG RSLRLSCAAS 61 GFTLDDYGMH WVRQAPGKGL EWVSGISWNS DSIGYVDSVK GRFTISRDNA KNSLYLQMNS 121 LRVEDTALYY CVKDISGWYS FDYWGQGTLV TVSS
[0201] The nucleic acid sequence encoding the human anti-OX40 antibody heavy chain variable region comprises the nucleic acid sequence of SEQ ID NO: 32 shown in the following Table.
TABLE-US-00015 Human anti-OX40 antibody 1-12Z5 (ATCC No. PTA-7216) Heavy chain variable region nucleic acid sequence (SEQ ID NO: 32) 5′-atgaccatgattacgccaagcttggtaccgagctcggatccactagt aacggccgccagtgtgctggaattcgcccttctaatacgactcactatag ggcaagcagtggtatcaacgcagagtacggggggaggcttggtacagcct ggcaggtccctgagactctcctgtgcagcctctggattcacccttgatga ttatggcatgcactgggtccggcaagctccagggaagggcctggagtggg tctcaggtattagttggaatagtgatagtataggctatgtggactctgtg aagggccgattcaccatctccagagacaacgccaagaactccctgtatct gcaaatgaacagtctgagagttgaggacacggccttgtattactgtgtaa aagatattagtggctggtacagctttgactactggggccagggaaccctg gtcaccgtctcctca-3′
[0202] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 antibody variable light chain comprising the amino acid sequence of SEQ ID NO: 33 shown in the following Table.
TABLE-US-00016 Human anti-OX40 antibody 1-12Z5 (ATCC No. PTA-7216) Light chain variable region amino acid sequence (SEQ ID NO: 33) 1 MEAPAQLLFL LLLWLPDTTG EIVLTQSPAT LSLSPGERAT LSCRASQSVS SYLAWYQQKP 61 GQAPRLLIYD ASNRATGIPA RFSGSGSGTD FTLTISSLEP EDFAVYYCQQ RSNWPITFGQ 121 GTRLEIK
[0203] The nucleic acid sequence encoding the human anti-OX40 antibody light chain variable region comprises the nucleic acid sequence of SEQ ID NO: 34 shown in the following Table.
TABLE-US-00017 Human anti-OX40 antibody 1-12Z5 (ATCC No. PTA-7216) Light chain variable region nucleic acid sequence (SEQ ID NO: 34) 5′atggaagccccagctcagcttctcttcctcctgctactctggctccca gataccaccggagaaattgtgttgacacagtctccagccaccctgtcttt gtctccaggggaaagagccaccctctcctgcagggccagtcagagtgtta gcagctacttagcctggtaccaacagaaacctggccaggctcccaggctc ctcatctatgatgcatccaacagggccactggcatcccagccaggttcag tggcagtgggtctgggacagacttcactctcaccatcagcagcctagagc ctgaagattttgcagtttattactgtcagcagcgtagcaactggccgatc accttcggccaagggacacgactggagattaaa-3′
[0204] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 antibody variable heavy chain comprising the amino acid sequence of SEQ ID NO: 35 shown in the following Table.
TABLE-US-00018 Human anti-OX40 antibody 112F32 (ATCC No. PTA-7217) Heavy chain variable region amino acid sequence (SEQ ID NO: 35) 1 MEWGPCWVFL VVILEGVQCG VQLVESGGGL VQPGGSLRLS CAASGFTFSS YSMNWVRQAP 61 GKGLEWVSYI SSSSSTIYYA DSVKGRFTIS RDNAKNSLYL QMNSLRDEDT AVYYCARGVY 121 HNGWSFFDYW GQGTLLTVSS
[0205] The nucleic acid sequence encoding the human anti-OX40 antibody heavy chain variable region comprises the nucleic acid sequence of SEQ ID NO: 36 shown in the following Table.
TABLE-US-00019 Human anti-OX40 antibody 112F32 (ATCCNo. PTA-7217) Heavy chain variable region nucleic acid sequence (SEQ ID NO: 36) 5′atggagtgggggccgtgctgggttttccttgttgttattttagaaggt gtccagtgtggggtgcagctggtggagtctgggggaggcttggtacagcc tggggggtccctgagactctcctgtgcagcctctggattcaccttcagta gctatagcatgaactgggtccgccaggctccagggaaggggctggagtgg gtttcatacattagtagtagtagtagtaccatatactatgcagactctgt gaagggccgattcaccatctccagagacaatgccaagaactcactgtatc tgcaaatgaacagcctgagagacgaggacacggctgtgtattactgtgcg agaggagtgtatcacaatggctggtccttctttgactactggggccaggg aaccctactcaccgtctcctca-3′
[0206] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 antibody variable light chain comprising the amino acid sequence of SEQ ID NO: 37 shown in the following Table.
TABLE-US-00020 Human anti-OX40 antibody 112F32 (ATCC No. PTA-7217) Light chain variable region amino acid sequence. (SEQ ID NO: 37) 1 MDMRVLAQLL GLLLLCFPGA RCDIQMTQSP SSLSASVGNR VTITCRASQD ISSWLAWYQQ 61 KPEKAPKSLI YAASSLQSGV PSRFSGSGSG TDFTLTISSL QPEDFATYYC QQYNSYPLTF 121 GQGTRLEIKR
[0207] The nucleic acid sequence encoding the human anti-OX40 antibody light chain variable region comprises the nucleic acid sequence of SEQ ID NO: 38 shown in the following Table.
TABLE-US-00021 Human anti-OX40 antibody 12F32 LV (ATCC No. PTA-7217) Light chain variable region nucleic acid sequence (SEQ ID NO: 38) 5′-atggacatgagggtcctcgctcagctcctggggctcctgctgctctg tttcccaggtgccagatgtgacatccagatgacccagtccccatcctcac tgtctgcatctgtaggaaacagagtcaccattacttgtcgggcgagtcag gatattagcagctggttagcctggtatcagcagaaaccagagaaagcccc taagtccctgatctatgctgcatccagtttgcaaagtggggtcccatcaa ggttcagcggcagtggatctgggacagatttcactctcaccatcagcagc ctgcagcctgaagattttgcaacttattactgccaacagtataatagtta ccccctcaccttcggccaagggacacgactggagattaaacga-3′
[0208] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 antibody variable heavy chain comprising the amino acid sequence of SEQ ID NO: 39 shown in the following Table.
TABLE-US-00022 Human anti-OX40 antibody 112Y1 31 (ATCC NO. PTA-7218) Heavy chain variable region amino acid sequence (SEQ ID NO: 39) 1 MDTLCSTLLL LTIPSWVLSQ ITLKESGPTL VKPTQTLTLT CTFSGFSLST SGVGVGWIRQ 61 PPGKALEWLA LIYWDDHSPY SPSLKSRLTI TKDTSKNQVV LTMTNMDPVD TATYYCARTR 121 GAFDIWGQGT MVTVSS
[0209] The nucleic acid sequence encoding the human anti-OX40 antibody heavy chain variable region comprises the nucleic acid sequence of SEQ ID NO: 40 shown in the following Table.
TABLE-US-00023 Human anti-OX40 antibody 112Y1 31 (ATCC NO. PTA-7218) Heavy chain variable region nucleic acid sequence (SEQ ID NO: 40) 5′-atggacactctttgctccacgctcctgctgctgaccatcccttcatg ggtcttgtcccagatcaccttgaaggagtctggtcctacgctggtgaaac ccacacagaccctcacgctgacctgcaccttctctggattctcactcagc actagtggagtgggtgtgggctggatccgtcagcccccaggaaaggccct ggagtggcttgcactcatttattgggatgatcatagcccctacagcccat ctctgaagagcaggctcaccatcaccaaggacacctccaaaaaccaggtg gtccttacaatgaccaacatggaccctgtggacacagccacatattactg tgcacgcacccggggggcttttgatatctggggccaagggacaatggtca ccgtctcttca-3′
[0210] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 antibody variable light chain comprising the amino acid sequence of SEQ ID NO: 41 shown in the following Table.
TABLE-US-00024 Human anti-OX40 antibody 112Y1 31 (ATCC NO. PTA-7218) Light chain variable region amino acid sequence (SEQ ID NO: 41) 1 MEAPAQLLFL LLLWLPDTTG EIVLTQSPAT LSLSPGERAT LSCRASQGVS SYLAWYQQKP 61 GQAPRLLIYD ASNRATGIPA RFSGSGPGTD FTLTISSLEP EDFAVYYCQQ RSNWHPTFGQ 121 GTKVEIK
[0211] The nucleic acid sequence encoding the human anti-OX40 antibody light chain variable region comprises the nucleic acid sequence of SEQ ID NO: 42 shown in the following Table.
TABLE-US-00025 Human anti-OX40 antibody 112Y1 31 (ATCC NO. PTA-7218) Light chain variable region nucleic acid sequence (SEQ ID NO: 42) 5′-atggaagccccagcgcagcttctcttcctcctgctactctggctccc agataccaccggagaaattgtgttgacacagtctccagccaccctgtctt tgtctccaggggaaagagccaccctctcctgcagggccagtcagggtgtt agcagctacttagcctggtaccagcagaaacctggccaggctcccaggct cctcatctatgatgcatccaacagggccactggcatcccagccaggttca gtggcagtgggcctgggacagacttcactctcaccatcagcagcctagag cctgaagattttgcagtttattactgtcagcagcgtagcaactggcatcc gacgttcggccaagggaccaaggtggaaatcaaacgaactgtggctgcac catc-3′
[0212] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 antibody variable heavy chain comprising the amino acid sequence of SEQ ID NO: 43 shown in the following Table.
TABLE-US-00026 Human anti-OX40 antibody 112V8 (ATCC NO. PTA-7219) Heavy chain variable region amino acid sequence (SEQ ID NO: 43) 1 MDTLCSTLLL LTIPSWVLSQ ITLKESGPTL VKPKQTLTLT CTFSGFSLST SGMGVGWIRQ 61 PPGKALEWLA VIYWDDHQLY SPSLKSRLTI TKDTSKNQVV LTMTNMDPVD TATYYCAHRR 121 GAFQHWGQGT LVTVSSASTK
[0213] The nucleic acid sequence encoding the human anti-OX40 antibody heavy chain variable region comprises the nucleic acid sequence of SEQ ID NO: 44 shown in the following Table.
TABLE-US-00027 Human anti-OX40 antibody 112V8 (ATCC NO. PTA-7219) Heavy chain variable region nucleic acid sequence (SEQ ID NO: 44) 5′-atggacacactttgctccacgctcctgctgctgaccatcccttcatg ggtcttgtcccagatcaccttgaaggagtctggtcctacgctagtgaagc ccaaacagaccctcacgctgacctgcaccttctctggattctcactcagc actagtggaatgggtgtgggctggatccgtcagcccccaggaaaggccct ggagtggcttgcagtcatttattgggatgatcatcaactctacagtccat ctctgalgagcaggctcaccatcaccaaggacacctccaaaaaccaggtg gtccttacaatgaccaacatggaccctgtggacacagccacatattactg tgcacacagacgaggggccttccagcactggggccagggcaccctggtca ccgtctcctcagcttccaccaagggc-3′
[0214] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 antibody variable light chain comprising the amino acid sequence of SEQ ID NO: 45 shown in the following Table.
TABLE-US-00028 Human anti-OX40 antibody 112V8 (ATCC NO. PTA-7219) Light chain variable region amino acid sequence (SEQ ID NO: 45) 1 METPAQLLFL LLLWLPDTTG EIVLTQSPGT LSLSPGERAT LSCRASQSVS SSYLAWYQQK 61 PGQAPRLLIY GASSRATGIP DRFSGSGSGT DFTLTISRLE PEDFAVYYCQ QYDSSLTFGG 121 GTKVEIKRT
[0215] The nucleic acid sequence encoding the human anti-OX40 antibody light chain variable region comprises the nucleic acid sequence of SEQ ID NO: 46 shown in the following Table.
TABLE-US-00029 Human anti-OX40 antibody 112V8 (ATCC NO. PTA-7219) Light chain variable region nucleic acid sequence (SEQ ID NO: 46) 5′-atggagtgggggccgtgctgggttttccttgttgttattttagaagg tgtccagtgtgggatggaaaccccagcgcagcttctcttcctcctgctac tctggctcccagataccaccggagaaattgtgttgacgcagtctccaggc accctgtctttgtctccaggggaaagagccaccctctcctgcagggccag tcagagtgttagcagcagctacttagcctggtaccagcagaaacctggcc aggctcccaggctcctcatctatggtgcatccagcagggccactggcatc ccagacaggttcagtggcagtgggtctgggacagacttcactctcaccat cagcagactggagcctgaagattttgcagtgtattactgtcagcagtatg atagctcgctcactttcggcggagggaccaaggtggagatcaaacgaac t-3′
[0216] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 antibody variable heavy chain comprising the amino acid sequence of SEQ ID NO: 47 shown in the following Table.
TABLE-US-00030 Human anti-OX40 antibody 112Y55 (ATCC No. PTA-7220) Heavy chain variable region amino acid sequence (SEQ ID NO: 47) 1 MDTLCSTLLL LTIPSWVLSQ ITLKESGPTL VKPTQTLTLS CTFSGFSLST SGVGVGWIRQ 61 PPGKALEWLA LIHWDDAERY SPSLKSRLTI TKDTSKNQVV LTMTNMDLVD TATYYCAHTR 121 GAFDIWGQGT MVTVSS
[0217] The nucleic acid sequence encoding the human anti-OX40 antibody heavy chain variable region comprises the nucleic acid sequence of SEQ ID NO: 48 shown in the following Table.
TABLE-US-00031 Human anti-OX40 antibody 112Y55 (ATCC No. PTA-7220) Heavy chain variable region nucleic acid sequence (SEQ ID NO: 48) 5′-atggacacactttgctccacgctcctgctgctgaccatcccttcatg ggtcttgtcccagatcaccttgaaggagtctggtcctacgctggtgaaac ccacacagaccctcacgctgtcctgcaccttctctgggttctcactcagc actagtggagtgggtgtgggctggatccgtcagcccccaggaaaggccct ggaatggcttgcactcattcattgggatgatgctgagcgctacagtccat ctctgaagagcaggctcaccatcaccaaggacacctccaaaaaccaggtg gtccttacaatgaccaacatggaccttgtggacacagccacatattactg tgcacacacccggggggcttttgatatctggggccaagggacaatggtca ccgtctcttca-3′
[0218] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 antibody variable light chain comprising the amino acid sequence of SEQ ID NO: 49 shown in the following Table.
TABLE-US-00032 Human anti-OX40 antibody 112Y55 (ATCC No. PTA-7220) Light chain variable region amino acid sequence (SEQ ID NO: 49) 1 METPAQLLFL LLLWLPDTTG EIVLTQSPGT LSLSPGERAI LSCRASQSVS SSFLAWYQQK 61 PGQAPRLLIY GAFSRATGIP DRFSGSGSGT DFTLTISRLE PEDFAVYYCQ QYDSSRTFGQ 121 GTKVEIK
[0219] The nucleic acid sequence encoding the human anti-OX40 antibody light chain variable region comprises the nucleic acid sequence of SEQ ID NO: 50 shown in the following Table.
TABLE-US-00033 Human anti-OX40 antibody 112Y55 (ATCC No. PTA-7220) Light chain variable region nucleic acid sequence (SEQ ID NO: 50) 5′-atggaaaccccagcgcagcttctcttcctcctgctactctggctccc agataccaccggagaaattgtgttgacgcagtctccaggcaccctgtctt tgtctccaggggaaagagccatcctctcctgcagggccagtcagagtgtt agcagcagcttcttagcctggtaccaacagaaacctggccaggctcccag gctcctcatctatggtgcatttagcagggccactggcatcccagacaggt tcagtggcagtgggtctgggacagacttcactctcaccatcagcagactg gagcctgaagattttgcagtgtattactgtcagcagtatgatagctcacg gacgttcggccaggggaccaaggtggaaatcaaa-3′
[0220] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 IgG2a antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 IgG2a antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0221] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and a mouse anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0222] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8.
[0223] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti-OX40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 7.
[0224] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10.
[0225] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12.
[0226] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12.
[0227] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12.
[0228] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 31. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 32. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 33. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 34.
[0229] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 31. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 32. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 33. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 34.
[0230] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 35. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 36. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 37. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 38.
[0231] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 35. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 36. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 37. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 38.
[0232] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 39. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 40. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 41. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 42.
[0233] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 39. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 40. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 41. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 42.
[0234] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 43. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 44. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 45. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 46.
[0235] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 43. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 44. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 45. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 46.
[0236] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 47. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 48. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 49. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 50.
[0237] The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 47. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 48. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 49. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 50.
[0238] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0239] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0240] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0241] The Sindbis viral vector and the anti-OX40 monoclonal antibody can be administered sequentially or concurrently. The Sindbis viral vector can be administered systemically. The anti-OX40 monoclonal antibody can be administered systemically. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered systemically. The Sindbis viral vector can be administered parenterally. The anti-OX40 monoclonal antibody can be administered parenterally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered parenterally. The Sindbis viral vector can be administered intraperitoneally. The anti-OX40 monoclonal antibody can be administered intraperitoneally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered intraperitoneally.
[0242] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against OX-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against OX40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the OX40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX-40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab′)2, Fab′, dsFv, scFv, sc(Fv)2, scFv-CH3, scFv-Fc, and diabody fragments.
[0243] The cancer can be a solid cancer or a liquid/hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is colon cancer. In one preferred aspect, the cancer is prostate cancer. In one preferred aspect, the cancer is ovarian cancer.
[0244] Sindbis Viral Vector and Anti-OX40 Monoclonal Antibody
[0245] The present disclosure further provides a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding an anti-OX40 monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-OX40 monoclonal antibody.
[0246] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 α, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 β, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit of GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin-12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2.
[0247] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4.
[0248] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8.
[0249] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti-OX40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 7.
[0250] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10.
[0251] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12.
[0252] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12.
[0253] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12.
[0254] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0255] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0256] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0257] The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject.
[0258] The Sindbis viral vector can be replication defective. The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 and can further comprise the nucleic acid encoding the anti-OX40 monoclonal antibody. The method can comprise administering a Sindbis viral vector comprising the nucleic acid encoding interleukin-12 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody.
[0259] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 α, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 β, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit of GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin-12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2.
[0260] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4.
[0261] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8.
[0262] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti-OX40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 7.
[0263] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10.
[0264] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12.
[0265] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12.
[0266] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12.
[0267] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0268] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0269] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0270] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against OX-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against OX40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the OX40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX-40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab′)2, Fab′, dsFv, scFv, sc(Fv)2, scFv-CH3, scFv-Fc, and diabody fragments.
[0271] The Sindbis viral vector and the anti-OX40 monoclonal antibody can be administered sequentially or concurrently. The Sindbis viral vector can be administered systemically. The anti-OX40 monoclonal antibody can be administered systemically. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered systemically. The Sindbis viral vector can be administered parenterally. The anti-OX40 monoclonal antibody can be administered parenterally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered parenterally. The Sindbis viral vector can be administered intraperitoneally. The anti-OX40 monoclonal antibody can be administered intraperitoneally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered intraperitoneally.
[0272] The cancer can be a solid cancer or a liquid/hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is colon cancer. In one preferred aspect, the cancer is prostate cancer. In one preferred aspect, the cancer is ovarian cancer.
[0273] Sindbis virus can be administered at least one time, at least two times, at least three times, at least four times or at least five times per week. Sindbis virus can be administered for at least one week, at least two weeks, at least three weeks, or at least four weeks. Sindbis virus can be administered from 10.sup.6-10.sup.9 TU/mL. Preferably, Sindbis virus can be administered from 10.sup.6-10.sup.9 TU/mL.
[0274] An anti-OX40 monoclonal antibody can be administered at least one time, at least two times, at least three times, at least four times or at least five times per week. An anti-OX40 monoclonal antibody can be administered for at least one week, at least two weeks, at least three weeks, or at least four weeks. An anti-OX40 monoclonal antibody can be administered from 25 μg-500 μg, 25 μg-450 μg, 50 μg-400 μg, from 50 μg-350 μg, from 50 μg-300 μg, from 50 μg-250 μg, from 50 μg-200 μg, from 50 μg-150 μg or from 50 μg-100 μg. An anti-OX40 monoclonal antibody can be administered at 250 μg. An anti-OX40 monoclonal antibody can be administered at 250 μg once a week for one week. An anti-OX40 monoclonal antibody can be administered at 250 μg once a week for two weeks. An anti-OX40 monoclonal antibody can be administered at 250 μg once a week for three weeks. An anti-OX40 monoclonal antibody can be administered at 250 μg three times a week for one week. An anti-OX40 monoclonal antibody can be administered at 250 μg three times a week for two weeks. An anti-OX40 monoclonal antibody can be administered at 250 μg three times a week for three weeks.
[0275] The results provided in the instant disclosure demonstrate that administration of the a Sindbis virus expressing IL-12 (SV.IL12) markedly increases the expression of OX40 on CD4 T cells and demonstrate that administration of a combination of SV.IL12 and anti-OX40 monoclonal antibody resulted in complete tumor regression in colon cancer, prostate cancer and ovarian cancer in vivo models and led to a greater than 60% survival rate (in some instances to a greater than 90% survival rate). This combined therapeutic effect was dramatically more effective when compared to either SV.IL12 or anti-OX40 monoclonal antibody treatment alone. These results also confirm that the oncolytic activity of the Sindbis virus is not required to induce a robust and effective anti-tumor response.
[0276] The results provided in the instant disclosure demonstrate that the combination of SV.IL12 or anti-OX40 monoclonal antibody treatment markedly changes the transcriptome signature of T cells and favors the differentiation of terminal effector T cells (e.g., effector T cells with a Th1 type phenotype). In particular, pathways upregulated by the combination treatment were dominated by DNA replication, chromosomal organization and cell cycle regulation, but also included various metabolic and immunological processes, such as mitochondrial respiration, nucleotide metabolism and adaptive immune responses. Specifically, only T cells from combined therapy expressed the gene signature of terminally differentiated effector T cells, which are characterized by high expression of the killer lectin-like receptor (KLRG1) and low expression of the interleukin 7 receptor (IL-7R). Furthermore, genes encoding products associated with the differentiation and function of effector cells, such as Batf Id2, Tbet, Gzmb and Ifng, were also highly expressed in T cells following combination therapy. Furthermore, CD4 T cells also expressed a marked anti-tumor effector phenotype (ICOS*Tbet*) which was on average 2 to 3-fold higher during combined therapy compared with SV.IL12 or anti-OX40 treatment.
[0277] The tumor microenvironment can be a very challenging milieu for an effector T cell as it is characterized by hypoxia, acidosis and low levels of nutrient sources such as glucose and glutamine. Even if T cell activation and initiation of effector function is allowed, T cells may be unable to generate the bioenergetics intermediates necessary to carry out effector function in the tumor microenvironment. Thus, providing a metabolic support for T cells is crucial for the success of cancer treatments. The results provided in the instant disclosure demonstrate that the combination of SV.IL12 or anti-OX40 monoclonal antibody promotes metabolic reprogramming of T cells. Specifically, the basal rate of oxygen consumption (OCR) was enhanced and spare respiratory capacity was dramatically increased in T cells following combination treatment. The combination also induced elevated protein expression of c-MYC as well as rate of extracellular acidification (ECAR). Collectively, these results show that SV.IL12 induces enhanced oxidative phosphorylation in CD8 T cells and the combination treatment is required to push CD4 T cells towards glycolysis by increasing the protein expression of c-MYC. Thus, the combination of SV.IL12 or anti-OX40 monoclonal antibody metabolically rewires T cells to an energetic state using both metabolic pathways, oxidative phosphorylation and glycolysis.
[0278] The results provided in the instant disclosure demonstrate that metabolic reprogrammed T cells display enhanced CD4 mediated cytokine production and anti-tumor activity following treatment with the combination of SV.IL12 and anti-OX40 monoclonal antibody. Specifically, genes encoding pro-inflammatory cytokines ifng and il2 were upregulated in T cells and the secretion of interferon-γ (IFNγ) by splenocytes was increased following combination treatment. Additional, the levels of the cytotoxic proteases, granzyme A and B, were upregulated following combination treatment. Further, granzyme B positive cells were detected in CD8 as well as CD4 T cells, indicating the presence of cytotoxic CD4 T cells following combination treatment. In addition, tumor growth was markedly reduced when co-cultured with splenocytes from mice receiving combined therapy. Surprisingly, tumor growth inhibition was mediated by CD4 T cells. Together, these results clearly show that T cells from combined therapy elicit enhanced anti-tumor and functional activity, such as granzyme B and IFNγ production driven by CD4 T cells.
[0279] The results provided in the instant disclosure demonstrate that treatment with the combination of SV.IL12 and anti-OX40 monoclonal antibody results in enhanced T cell migration and intratumoral T cell immunity. Specifically, CXCR3 levels were significantly upregulated on CD4 T cells following combination therapy. In contrast, CXCR3 expression on CD8 T cells only appeared later on in treatment, indicating that CD4 T cells are first recruited to the inflamed site followed by CD8 T cells. Combination therapy also enhanced the production of CXCL9 and CXCL10 in the tumor microenvironment, indicating that CXCR3 positive T cells migrate to the tumor site. These results clearly show that the combination of SV.IL12 and anti-OX40 monoclonal antibody alter the tumor microenvironment by facilitating T cell infiltration via modulation of the CXCR3/CXCL9-11 axis. Not only did combination therapy increase T cell infiltration but CD4 as well as CD8 T cells also demonstrated enhanced functional activity in the tumor, as judged by the Ki-67 and granzyme B expression. These results indicate that the presence of activated T cells in the tumor microenvironment exert anti-tumor activity which inhibits tumor growth. Enhanced iNOS production was also demonstrated in tumors treated with combination therapy. Interestingly, the amount of iNOS inversely correlated with arginase1 production, indicating a repolarization of tumor associated macrophages from the M2-like (pro-tumor) into Ml-like (anti-tumor) phenotype during combination therapy.
[0280] Thus, the data provided herein clearly shows that even in absence of direct Sindbis virus infectivity, SV.IL12 in combination with an anti-OX40 monoclonal antibody alter the tumor microenvironment by enhancing T cell infiltration and intratumoral T cell immunity, especially against low immunogenic tumors. The synergistic therapeutic efficacy of the systemic administration of the combination is driven by T cell modulation and reprogramming of its metabolic state, in order to enhance the anti-tumor response in the periphery and in the tumor microenvironment. Furthermore, the use of Sindbis virus allows these metabolically reprogrammed T cells to better infiltrate the tumor microenvironment, which is crucial for an adequate immunotherapy.
[0281] Sindbis Viral Vector and Anti-4-1BB Monoclonal Antibody
[0282] The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount (a) a Sindbis viral vector and (b) an anti-4-1BB monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject. The present disclosure further provides in vitro or ex vivo methods for treating cancer or assessing the treatment of cancer in a subject comprising contacting a biological sample from the subject with (a) a Sindbis viral vector and (b) an anti-4-1BB monoclonal antibody or a nucleic acid encoding same. Preferably, the Sindbis viral vector does not comprise an endogenous nucleic acid encoding any protein. Sindbis viral vectors were produced as described in U.S. Pat. No. 8,093,021 (incorporated herein by reference in its entirety).
[0283] The Sindbis viral vector is replication defective. The Sindbis viral vector can comprise a nucleic acid sequence encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein. The Sindbis viral vector can comprise the nucleic acid encoding the therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and further comprise the nucleic acid encoding the anti-4-1BB monoclonal antibody. The Sindbis viral vector can comprise a nucleic acid sequence encoding LacZ (lac operon structural gene lacZ encoding β-galactosidase), Flue (firefly luciferase) or GFP (green fluorescent protein). The Sindbis viral vector can comprise the nucleic acid encoding LacZ, Flue or GFP and further comprise the nucleic acid encoding the anti-4-1BB monoclonal antibody.
[0284] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the heavy chain complementarity determining region 1 (HCDR1), HCDR2 and HCDR3 amino acid sequences as follows: HCDR1: GFIFSYFDMA (SEQ ID NO: 16), HCDR2: SISPDGSIPYYRDSVK (SEQ ID NO: 17) and HCDR3: RSYGGYSELDY (SEQ ID NO: 18).
[0285] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB heavy chain comprising the amino acid sequence of SEQ ID NO:19 shown in the following Table.
TABLE-US-00034 anti-4-1BB heavy chain amino acid (SEQ ID NO: 19) DVQLVESGGGLVQPGRSLKLSCAASGFIFSYEDMAWVRQAPTKGLEWVAS ISPDGSIPYYRDSVKGRFTVSRENAKSSLYLQMDSLRSEDTATYYCARRS YGGYSELDYWGQGVMVTVSS.
[0286] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody light chain comprising the light chain complementarity determining region 1 (LCDR1), LCDR2 and LCDR3 amino acid sequences as follows: LCDR1: QASQDIGNWLA (SEQ ID NO: 20), LCDR2: GSTSLAD (SEQ ID NO: 21) and LCDR3: LQAYGAPW (SEQ ID NO: 22).
[0287] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB light chain comprising the amino acid sequence of SEQ ID NO:23 shown in the following Table.
TABLE-US-00035 anti-4-1BB light chain amino acid (SEQ ID NO: 23) DIQMTQSPASLSASLEEIVTITCQASQDIGNWLAWYHQKPGKSPQLLIYG STSLADGVPSRFSGSSSGSQYSLKISRLQVEDIGIYYCLQAYGAPWTEGG GTKLELK
[0288] The Sindbis viral vector can comprise a nucleic acid encoding anti-4-1BB antibody heavy chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen comprising the amino acid sequence of SEQ ID NO:24 shown in the following Table.
TABLE-US-00036 anti-4-1BB target antigen (SEQ ID NO: 24) 1 MGNNCYNVVV IVLLLVGCEK VGAVQNSCDN CQPGTFCRKY NPVCKSCPPS 51 TFSSIGGQPN CNICRVCAGY FRFKKFCSST HNAECECIEG FHCLGPQCTR 101 CEKDCRPGQE LTKQGCKTCS LGTFNDQNGT GVCRPWTNCS LDGRSVLKTG 151 TTEKDVVCGP PVVSFSPSTT ISVTPEGGPG GHSLQVLTLF LALTSALLLA 201 LIFITLLFSV LKWIRKKFPH IFKQPFKKTT GAAQEEDACS CRCPQEEEGG 251 GGGYEL
[0289] The Sindbis viral vector can comprise a nucleic acid encoding a 4-1BB heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 19 and a nucleic acid encoding a 4-1BB light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 23.
[0290] The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen (4-1BB antigen) of the amino acid sequence of (SEQ ID NO: 24). The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain amino acid sequence that binds to a target antigen (4-1BB antigen) of the amino acid sequence of (SEQ ID NO: 24). The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain amino acid sequence that binds to a target antigen (4-1BB antigen) of the amino acid sequence of (SEQ ID NO: 24).
[0291] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the heavy chain complementarity determining region 1 (HCDR1), HCDR2 and HCDR3 amino acid sequences of SEQ ID NOs: 16, 17 and 18, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 19. The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the light chain complementarity determining region 1 (LCDR1), LCDR2 and LCDR3 amino acid sequences of SEQ ID NOs: 20, 21 and 22, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody light chain comprising the amino acid sequence of SEQ ID NO: 23.
[0292] The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24.
[0293] The immunostimulatory or immunomodulatory protein can be IL-1, IL-2, IL-3, IL-4, IL-5, IL-6 IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-34, IL-35, IL-36, or any combination thereof. In a preferred aspect, the immunostimulatory or immunomodulatory protein is IL-12. The anti-4-1BB antibody can be urelumab, utomilumab or a combination thereof. The anti-4-1BB antibody can be InVivoMAb anti-mouse 4-1BB (BioXCell, Clone: LOB12.3, Cat. No. BE0169).
[0294] The Sindbis viral vector and the anti-4-1BB monoclonal antibody can be administered sequentially or concurrently. The Sindbis viral vector can be administered systemically. The anti-4-1BB monoclonal antibody can be administered systemically. Both the Sindbis viral vector and the anti-4-1BB monoclonal antibody, or a nucleic acid encoding same, can be administered systemically. The Sindbis viral vector can be administered parenterally. The anti-4-1BB monoclonal antibody can be administered parenterally. Both the Sindbis viral vector and the anti-4-1BB monoclonal antibody, or a nucleic acid encoding same, can be administered parenterally. The Sindbis viral vector can be administered intraperitoneally. The anti-4-1BB monoclonal antibody can be administered intraperitoneally. Both the Sindbis viral vector and the anti-4-1BB monoclonal antibody, or a nucleic acid encoding same, can be administered intraperitoneally.
[0295] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against 4-1BB or an anti-4-1BB monoclonal antibody, as described herein, can be a full length antibody against 4-1BB antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the 4-1BB receptor on a cell surface. An “antigen-binding fragment” of an anti-4-1BB antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab′)2, Fab′, dsFv, scFv, sc(Fv)2, scFv-CH3, scFv-Fc, and diabody fragments.
[0296] The cancer can be a solid cancer or a liquid/hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is a lymphoma. In one preferred aspect, the cancer is a B cell lymphoma.
[0297] The present disclosure provides a Sindbis viral vector comprising a nucleic acid encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and a nucleic acid encoding an anti-4-1BB monoclonal antibody. The present disclosure provides a Sindbis viral vector comprising a nucleic acid encoding LacZ, Flue or GFP and a nucleic acid encoding an anti-4-1BB monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-4-1BB monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding LacZ, Flue or GFP and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-4-1BB monoclonal antibody. The present disclosure further provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and (b) an anti-4-1BB monoclonal antibody or a nucleic acid encoding same. The present disclosure provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding encoding LacZ, Flue or GFP and (b) an anti-4-1BB monoclonal antibody or a nucleic acid encoding same.
[0298] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1 in antibody heavy chain comprising the heavy chain complementarity determining region 1 (HCDR1), HCDR2 and HCDR3 amino acid sequences of SEQ ID NOs: 16, 17 and 18, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 19. The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the light chain complementarity determining region 1 (LCDR1), LCDR2 and LCDR3 amino acid sequences of SEQ ID NOs: 20, 21 and 22, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody light chain comprising the amino acid sequence of SEQ ID NO: 23.
[0299] The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24.
[0300] The immunostimulatory or immunomodulatory protein can be IL-1, IL-2, IL-3, IL-4, IL-5, IL-6 IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-34, IL-35, IL-36, or any combination thereof. In a preferred aspect, the immunostimulatory or immunomodulatory protein is IL-12. Additional cytokines include IL-I8-IL-36. In addition to CCL17, other chemokines can also be used, including, but not limited to, CCL1-CCL27 and other CC chemokines, CXCLI-CXCL13 and other CXC chemokines, C chemokines, and CX3C chemkines. Cytokine or chemokine receptors and soluble receptors can also be used. Additional immune modulators that can be used include TGF-β and TNFα. In addition, different combinations of the above-mentioned (or alternative) cytokines can be used.
[0301] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against 4-1BB or an anti-4-1BB monoclonal antibody, as described herein, can be a full length antibody against 4-1BB antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the 4-1BB receptor on a cell surface. An “antigen-binding fragment” of an anti-4-1BB antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab′)2, Fab′, dsFv, scFv, sc(Fv)2, scFv-CH3, scFv-Fc, and diabody fragments.
[0302] Sindbis virus can be administered at least one time, at least two times, at least three times, at least four times or at least five times per week. Sindbis virus can be administered for at least one week, at least two weeks, at least three weeks, or at least four weeks. Sindbis virus can be administered from 10.sup.6-10.sup.9 TU/mL. Preferably, Sindbis virus can be administered from 10.sup.6-10.sup.9 TU/mL.
[0303] An anti-4-1BB monoclonal antibody can be administered at least one time, at least two times, at least three times, at least four times or at least five times per week. An anti-4-1BB monoclonal antibody can be administered for at least one week, at least two weeks, at least three weeks, or at least four weeks. An anti-4-1BB monoclonal antibody can be administered from 25 μg-500 μg, 25 μg-450 μg, 50 μg-400 μg, from 50 μg-350 μg, from 50 μg-300 μg, from 50 μg-250 μg, from 50 μg-200 μg, from 50 μg-150 μg or from 50 μg-100 μg. An anti-4-1BB monoclonal antibody can be administered at 50 μg. An anti-4-1BB monoclonal antibody can be administered at 50 μg once a week for three weeks. An anti-4-1BB monoclonal antibody can be administered at 250 μg. An anti-4-1BB monoclonal antibody can be administered at 250 μg three times week for two weeks. An anti-4-1BB monoclonal antibody can be administered at 350 μg. An anti-4-1BB monoclonal antibody can be administered at 350 μg three times week for two weeks.
[0304] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in complete tumor regression in an lymphoma in vivo model and that this therapeutic effect was dramatically more effective when compared to either Sindbis virus or anti-4-1BB monoclonal antibody treatment alone. Tumor elimination involves a synergistic effect of the combination that significantly boosts T cell cytotoxicity, IFNγ production, T cell proliferation, migration, and glycolysis. As described in more detail below, the data identified the molecular pathways, including upregulated cytokines, chemokines and metabolic pathways in T cells that are triggered by the combined therapy and help to achieve a highly effective anti-tumor response.
[0305] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in increased T cell cycle progression, cytokine production and activation. T cell proliferation is critical for an effective anti-tumor response.
[0306] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in increased cytotoxicity (e.g., increased cytotoxic T cell function). Specifically, genes such as Gzmb (granzyme B), Prfl (perforin) and Klrkl (NKG2D) are significantly upregulated in T cells (particularly CD8 T cells) following administration of Sindbis virus and anti-4-1BB monoclonal antibody.
[0307] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in increased IFNγ production from T cells and Th1 differentiation. The combination of Sindbis virus and anti-4-1BB monoclonal antibody upregulated the expression of STAT4, Ccr5, Cxcr3, Havcr2(Tim3), IL12rbl and Klrcl in T cells, which are required for the development of Th1 cells from naïve CD4+ T cells and IFNγ production. This increase was independent of the presence or absence of TAA. The combination of Sindbis virus and anti-4-1BB monoclonal antibody increased IFNγ production from both CD4 and CD8 T cells (with a larger portion CD4 T cells producing IFNγ) and demonstrated that antigen presenting cells (APCs) are essenTh1tial for helping T cells product IFNγ. The combination of Sindbis virus and anti-4-1BB monoclonal antibody also increased T-bet in T cells. T-bet is a key transcription factor which is essential for type I immune response (IFNγ production, T cell cytotoxicity) and memory T cell differentiation. Thus, this indicates that the combination of Sindbis virus and anti-4-1BB monoclonal antibody boosts the type I immune response, which is critical for controlling tumor growth. The combination of Sindbis virus and anti-4-1BB monoclonal antibody also increased Eomesodermin (EOMES) in T cells. EOMES, another important transcription factor, is upregulated in activated T cells and is essential for memory CD8 T cell development.
[0308] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in increased chemotaxis, adhesion and enhanced T cell infiltration and activation in tumors. Specifically, the combination significantly upregulates CD11a and ICAM-1(CD54) in both CD4 and CD8 T cells, which are two adhesion molecules expressed on activated T cells and are essential for the formation of immune synapses between T cells and APCs and are also required for T cell/T cell homotypic aggregation and activation. The combination of Sindbis virus and anti-4-1BB monoclonal antibody also significantly upregulated OX40 and ICOS in T cells. OX40 engagement promotes effector T cell function and survival and ICOS is another key CD4 T cell costimulatory molecule. Tumor infiltrating lymphocytes play a critical anti-tumor role and are an important marker for prognosis. The percentage of CD3 and CD8 T cells increased about two-fold following combination treatment. Thus, these results demonstrate that combination treatment enhanced T cell infiltration, division, activation, cytotoxicity and downregulated the inhibitory Treg population.
[0309] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in enhanced T cell glycolysis and oxidative phosphorylation. T cell activation requires a quick consumption of energy through both enhanced glycolysis and oxidative phosphorylation. Metabolic switch is a major feature of T cell activation and memory T cell development. Upregulation of glycolysis genes quickly produce ATP and supports T cell migration and cytotoxicity in hypoxic or acidific microenvironments (such as in and around a tumor). The instant results demonstrate that combination treatment significantly increased both oxygen consumption rate (OCR, represents oxidative phosphorylation) and extracellular acidification rate (ECAR, represents glycolysis). This indicates that both glycolysis and oxidative phosphorylation are activated in combination treated T cells.
[0310] The results provided in the instant disclosure demonstrate that mice cured by the administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody are completely protected from cancer rechallenge demonstrating that these mice acquired long lasting antitumor immunity.
[0311] The conventional view of oncolytic virus therapy against tumors is that it requires selective infection of cancer cells resulting in the induction of cancer cell lysis and apoptosis. Tumor specific antigens (TAAs), released from dead tumor cells, attract and further stimulate an antitumor immune response. The data presented herein demonstrates that encoding a TAA is not necessary for the combination of Sindbis virus and anti-4-1BB monoclonal antibody to be fully successful in eradicating growing tumors.
[0312] The quick inhibition of tumor growth is critical for cancer therapy because tumor cells undergo exponentially rapid division. However, the induction of adaptive immunity and establishment of tumor specific immunity takes a long time. An ideal therapy requires an early, quick reduction of tumor burden, and a later induction of anti-tumor specificity that prevents relapse. The data presented herein demonstrates that the combination of Sindbis virus and anti-4-1BB monoclonal antibody treatment induced massive T cell activation due to viral induced immune response. This massive activation helps to control the tumor in a TAA nonspecific manner.
[0313] It was shown herein that both NKG2D (KLRKI) and granzyme B are highly expressed under combination treatment. This massive nonspecific activation is critical for controlling tumor growth at an early time point (day 7). This step is also important for inducing anti-tumor specificity that is mediated by TAAs released from dead tumor cells due to nonspecific killing. After tumor regression, T cells from treated animals were able maintain the ability to produce IFNγ and acquired immunological memory to rapidly reject tumor rechallenges. IFNγ production from purified T cells of cured mice was significantly enhanced after encountering tumor cells. This demonstrates that anti-tumor specificity is fully established in cured mice.
[0314] The data also shows that Sindbis viral infection of tumor cells, inclusion of dendtric cells and lymphodepletion are not necessary for successful cancer treatment. The omission of these additional features decreases costs, any risks related to toxicity and infection.
[0315] Thus, the data provided herein demonstrates that the combination of Sindbis virus and anti-4-1BB monoclonal antibody completely eradicated a B-cell lymphoma in a preclinical mouse model, a result that could not be achieved with either treatment alone. Tumor elimination involves a synergistic effect of the combination that significantly boosts T cell cytotoxicity, IFN-γ production, migration, tumor infiltration and oxidative phosphorylation. In addition, all mice that survived after treatment developed long lasting antitumor immunity.
[0316] Sindbis Viral Vector and Sindbis Viral Vector NY-ESO-1
[0317] The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1, thereby treating cancer in the subject. The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1, thereby treating cancer in the subject.
[0318] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 α, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 β, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit of GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin-12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2.
[0319] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4.
[0320] The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO:14 shown in the following Table.
TABLE-US-00037 Nucleic acid sequence encoding NY-ESO-1 (NM_001327.1) (SEQ ID NO: 14) 1 agcagggggc gctgtgtgta ccgagaatac gagaatacct cgtgggccct gaccttctct 61 ctgagagccg ggcagaggct ccggagccat gcaggccgaa ggccggggca cagggggttc 121 gacgggcgat gctgatggcc caggaggccc tggcattcct gatggcccag ggggcaatgc 181 tggcggccca ggagaggcgg gtgccacggg cggcagaggt ccccggggcg caggggcagc 241 aagggcctcg gggccgggag gaggcgcccc gcggggtccg catggcggcg cggcttcagg 301 gctgaatgga tgctgcagat gcggggccag ggggccggag agccgcctgc ttgagttcta 361 cctcgccatg cctttcgcga cacccatgga agcagagctg gcccgcagga gcctggccca 421 ggatgcccca ccgcttcccg tgccaggggt gcttctgaag gagttcactg tgtccggcaa 481 catactgact atccgactga ctgctgcaga ccaccgccaa ctgcagctct ccatcagctc 541 ctgtctccag cagctttccc tgttgatgtg gatcacgcag tgctttctgc ccgtgttttt 601 ggctcagcct ccctcagggc agaggcgcta agcccagcct ggcgcccctt cctaggtcat 661 gcctcctccc ctagggaatg gtcccagcac gagtggccag ttcattgtgg gggcctgatt 721 gtttgtcgct ggaggaggac ggcttacatg tttgtttctg tagaaaataa aactgagcta 781 cgaaaaaaaa aaaaaaaaaa aaaaaa
[0321] The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO:15 shown in the following Table.
TABLE-US-00038 Amino acid sequence of NY-ESO-1 (NP_001318.1) (SEQ ID NO: 15) 1 mqaegrgtgg stgdadgpgg pgipdgpggn aggpgeagat ggrgprgaga arasgpggga 61 prgphggaas glngccrcga rgpesrllef ylampfatpm eaelarrsla qdapplpvpg 121 vllkeftvsg niltirltaa dhrqlqlsis sclqqlsllm witqcflpvf laqppsgqrr
[0322] The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15.
[0323] A replication defective Sindbis viral vector as described herein can be any replication defective Sindbis viral vector including a replication defective viral vector described, for example, in U.S. Pat. Nos. 7,303,898, 7,306,792, and 8,093,021. Replication defective vectors are preferred for use in the present invention in order to prevent infection of healthy tissues.
[0324] The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered sequentially or concurrently. The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 can be administered systemically. The Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered systemically. Both the Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered systemically. The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 can be administered parenterally. The Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered parenterally. Both the Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered parenterally. The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 can be administered intraperitoneally. The Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered intraperitoneally. Both the Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered intraperitoneally.
[0325] The cancer can be a solid cancer or a liquid/hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is colon cancer. In one preferred aspect, the cancer is prostate cancer. In one preferred aspect, the cancer is ovarian cancer.
[0326] The present disclosure further provides a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1.
[0327] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 α, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 β, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit of GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin-12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2.
[0328] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4.
[0329] The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15.
[0330] The present disclosure provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject.
[0331] The Sindbis viral vector can be replication defective. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 and can further comprise the nucleic acid encoding the anti-OX40 monoclonal antibody. The method can comprise administering a Sindbis viral vector comprising the nucleic acid encoding NY-ESO-1 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15.
[0332] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8.
[0333] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti-OX40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 7.
[0334] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10.
[0335] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12.
[0336] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12.
[0337] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12.
[0338] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0339] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0340] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0341] The Sindbis viral vector and the anti-OX40 monoclonal antibody can be administered sequentially or concurrently. The Sindbis viral vector can be administered systemically. The anti-OX40 monoclonal antibody can be administered systemically. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered systemically. The Sindbis viral vector can be administered parenterally. The anti-OX40 monoclonal antibody can be administered parenterally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered parenterally. The Sindbis viral vector can be administered intraperitoneally. The anti-OX40 monoclonal antibody can be administered intraperitoneally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered intraperitoneally.
[0342] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against OX-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against OX40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the OX40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX-40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab′)2, Fab′, dsFv, scFv, sc(Fv)2, scFv-CH3, scFv-Fc, and diabody fragments.
[0343] The cancer can be a solid cancer or a liquid/hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is colon cancer. In one preferred aspect, the cancer is prostate cancer. In one preferred aspect, the cancer is ovarian cancer.
[0344] The present disclosure further provides a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and a nucleic acid encoding an anti-OX40 monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-OX40 monoclonal antibody. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15.
[0345] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8.
[0346] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti-OX40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 7.
[0347] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10.
[0348] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12.
[0349] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12.
[0350] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12.
[0351] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0352] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0353] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.
[0354] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against OX-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against OX40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the OX40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX-40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab′)2, Fab′, dsFv, scFv, sc(Fv)2, scFv-CH3, scFv-Fc, and diabody fragments.
[0355] The results provided in the instant disclosure demonstrate that administration of a combination of IL-12 and NY-ESO-1, expressed by separate Sindbis virus vector synergistically enhances the survival rate of a subject bearing an established tumor. The results described herein show that mice transplanted with Alm5-2Fluc-17 ovarian cancer cells by reinjection to establish tumor as depicted in
[0356] The results provided in the instant disclosure demonstrate that administration of a combination of IL-12 and NY-ESO-1, expressed by the same Sindbis virus vector synergistically enhances the survival rate of a subject bearing an established tumor. The results show that mice bearing established tumors of Alm5-2Fluc-17 ovarian cancer cells, when treated with a Sindbis viral vector that expresses both IL-12 and NYESO (SV-NYESO_SGP2_IL12), demonstrated synergistically enhanced survival as compared to mice treated with the SV-IL-12 or SV-NYESO. The results described herein clearly show the possibility of using a single SV vectors expressing both IL-12 and NY-ESO-1, for treatment of cancers that may be resistant to treatment with a SV expressing a tumor associated antigen.
[0357] Treating cancer means treating at least one symptom of cancer. Treating at least one symptom of cancer can include any of the following, or any combination thereof: inhibiting tumor growth, reducing tumor size, reducing tumor number, reducing tumor burden, preventing cancer recurrence, preventing metastasis of a primary tumor.
[0358] The terms “cancer” and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Included in this definition are benign and malignant cancers. Examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, leukemia and germ cell tumors. More particular examples of such cancers include adrenocortical carcinoma, bladder urothelial carcinoma, breast invasive carcinoma, cervical squamous cell carcinoma, endocervical adenocarcinoma, cholangiocarcinoma, colon adenocarcinoma, lymphoid neoplasm diffuse large B-cell lymphoma, esophageal carcinoma, glioblastoma multiforme, head and neck squamous cell carcinoma, kidney chromophobe, kidney renal clear cell carcinoma, kidney renal papillary cell carcinoma, acute myeloid leukemia, brain lower grade glioma, liver hepatocellular carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, mesothelioma, ovarian serous cystadenocarcinoma, pancreatic adenocarcinoma, pheochromocytoma, paraganglioma, prostate adenocarcinoma, rectum adenocarcinoma, sarcoma, skin cutaneous melanoma, stomach adenocarcinoma, testicular germ cell tumors, thyroid carcinoma, thymoma, uterine carcinosarcoma, uveal melanoma. Other examples include breast cancer, lung cancer, lymphoma, melanoma, liver cancer, colorectal cancer, ovarian cancer, bladder cancer, renal cancer or gastric cancer. Further examples of cancer include neuroendocrine cancer, non-small cell lung cancer (NSCLC), small cell lung cancer, thyroid cancer, endometrial cancer, biliary cancer, esophageal cancer, anal cancer, salivary, cancer, vulvar cancer, cervical cancer, Acute lymphoblastic leukemia (ALL), Acute myeloid leukemia (AML), Adrenal gland tumors, Anal cancer, Bile duct cancer, Bladder cancer, Bone cancer, Bowel cancer, Brain tumors, Breast cancer, Cancer of unknown primary (CUP), Cancer spread to bone, Cancer spread to brain, Cancer spread to liver, Cancer spread to lung, Carcinoid, Cervical cancer, Children's cancers, Chronic lymphocytic leukemia (CLL), Chrome myeloid leukemia (CML), Colorectal cancer, Ear cancer, Endometrial cancer, Eye cancer, Follicular dendritic cell sarcoma, Gallbladder cancer, Gastric cancer, Gastro esophageal junction cancers, Germ cell tumors, Gestational trophoblastic disease (GIT)), Hairy cell leukemia, Head and neck cancer, Hodgkin lymphoma, Kaposi's sarcoma, Kidney cancer, Laryngeal cancer, Leukemia, Gastric linitis plastica, Liver cancer, Lung cancer, Lymphoma, Malignant schwannoma, Mediastinal germ cell tumors, Melanoma skin cancer, Men's cancer, Merkel cell skin cancer, Mesothelioma, Molar pregnancy, Mouth and oropharyngeal cancer, Myeloma, Nasal and paranasal sinus cancer, Nasopharyngeal cancer, Neuroblastoma, Neuroendocrine tumors, Non-Hodgkin lymphoma (NHL), Esophageal cancer, Ovarian cancer, Pancreatic cancer, Penile cancer, Persistent trophoblastic disease and choriocarcinoma, Pheochromocytoma, Prostate cancer, Pseudomyxoma peritonei, Rectal cancer. Retinoblastoma, Salivary gland cancer, Secondary' cancer, Signet cell cancer, Skin cancer, Small bowel cancer, Soft tissue sarcoma, Stomach cancer, T cell childhood non Hodgkin lymphoma (NHL), Testicular cancer, Thymus gland cancer, Thyroid cancer, Tongue cancer, Tonsil cancer, Tumors of the adrenal gland, Uterine cancer. Vaginal cancer, Vulval cancer, Wilms' tumor, Womb cancer and Gynaecological cancer. Examples of cancer also include, but are not limited to, Hematologic malignancies, Lymphoma, Cutaneous T cell lymphoma, Peripheral T cell lymphoma, Hodgkin's lymphoma, Non-Hodgkin's lymphoma, Multiple myeloma, Chrome lymphocytic leukemia, chronic myeloid leukemia, acute myeloid leukemia, Myelodysplastic syndromes, Myelofibrosis, Biliary tract cancer, Hepatocellular cancer, Colorectal cancer, Breast cancer, Lung cancer, Non-small cell lung cancer, Ovarian cancer, Thyroid Carcinoma, Renal Cell Carcinoma, Pancreatic cancer, Bladder cancer, skin cancer, malignant melanoma, merkel cell carcinoma, Uveal Melanoma or Glioblastoma multiforme.
[0359] The nucleotide sequences encoding the TAAs to be expressed by a Sindbis viral vector as described herein are well known in the art and can be easily obtained from the literature. For example, the sequence of NY-ESO-1, a testicular antigen aberrantly expressed in human cancers was published in 1997 (http://www.pnas.org/content/94/5/1914.full, Yao-Tseng Chen, Matthew J. Scanlant, Ugur Sahin, Ozlem Tiireci, Ali O. Guret, Solam Tsangt, Barbara Williamsont, Elisabeth Stockertt, Michael Pfreundschuh, and Lloyd J. Old, PNAS 1997.), whereas the Carcinoembryonic antigen sequence was published in 1987 (http://mcb.asm.org/content/7/9/3221.short Isolation and characterization of full-length functional cDNA clones for human carcinoembryonic antigen. N Beauchemin, S. Benchimol, D Cournoyer, A Fuks and C P Stanners, Molecular and Cellular Biology.
[0360] Although in mice a single i.p. injection of the SV/TAA as described herein, is sufficient to elicit a detectable CD8+ mediated immune response directed against the tumor, other regimens may be necessary for achieving a maximal response. For example, between 1 and about 8 i.p. injections over a time period of between 1 week and many weeks, with the possibility of injecting one or more booster injections 1 or more years later, may be preferably administered for a maximum effect.
EXAMPLES
Example 1: Sindbis with Anti-OX40 Enable Immune Responses to Cold Tumors
[0361] This study, investigates the therapeutic efficacy of a replication-deficient oncolytic viral vector called Sindbis Virus. Because Sindbis Virus (SV) is a blood-borne pathogen, vectors from this virus can be administered in the bloodstream via the intravenous (i.v.) and intraperitoneal (i.p.) routes, which greatly facilitates their delivery [Tseng, J C, et al., Nature Biotech., 2004]. Furthermore, SV was genetically modified to be replication-defective by splitting its genome and deleting the packaging signal to block viral assembly after viral replication [Bredenbeek P J, et al., J. Virol. 1993]. This study shows that SV expressing the pro-inflammatory cytokine IL-12 (SV.IL12) activates T cells as well as enhances the expression of OX40 on CD4 T effector cells and, therefore, potentiates efficacy of the agonistic anti-OX40 antibody therapy. The data indicates that combination of SV.IL12 and anti-OX40 activates tumor immunity against low immunogenic tumors through the metabolic rewiring of T cells into highly activated effector cells. Furthermore, SV.IL12 in combination with anti-OX40 induces a marked immune cell infiltration into the tumor microenvironment. Considering that tumors tend to quickly escape the immune response by mutating or losing the expression of drug targets or tumor antigens targeted by the immune response, the treatment approach disclosed herein reduces the risk of developing tumor resistances and offers an attractive and safe strategy to change the immunogenic phenotype of various cancers without prior knowledge of tumor antigens.
[0362] The studies presented herein describe several, non-limiting examples of anti-OX-40 antibody, Sindbis viral vector (SV), Sindbis viral vector expressing IL-12 (SV.IL-12), Sindbis viral vector expressing an anti-OX-40 antibody and Sindbis viral vector expressing both IL-12 and an anti-OX-40 antibody. These examples are provided below to further illustrate different features of the present invention. The examples also illustrate useful methodology for practicing the invention. These examples do not and are not intended to limit the claimed invention.
[0363] Materials and Methods
[0364] Cell Lines
[0365] Baby hamster kidney (BHK), BALB/c colon carcinoma [CT26.WT (ATCC® CRL-2638™)] and FVB prostate carcinoma [MyC-CaP (ATCC® CRL-3255™)] cell lines were obtained from the American Type Culture Collection (ATCC). Firefly luciferase (Fluc)-expressing CT26 and MyC-CaP cells (CT26.Fluc and MyC-CaP.Fluc) were generated by stable transfection of pGL4.20_Fluc plasmid.
[0366] BHK cells were maintained in minimum essential a-modified media (a-MEM) (Corning CellGro) with 5% fetal bovine serum (FCS, Gibco) and 100 mg/ml penicillin-streptomycin (Corning CellGro). CT26.Fluc and MyC-CaP.Fluc cells were maintained in Dulbecco's modified Eagles medium containing 4.5 g/l Glucose (DMEM, Corning CellGro) supplemented with 10% FCS, 100 mg/ml penicillin-streptomycin, 7.5 μg/ml Puromycin or 400 g/ml Gentamycin, respectively. All cell lines were cultured at 37° C. and 5% C02.
[0367] SV Production
[0368] SV-LacZ production and titering were done the same as previously described [Scherwitzl I, Mal Ther Oncolytics. 2018]. SV.IL12 and SY.Lacz vectors were produced as previously described [Subramanian A et al., Proc Natl Acad Sci US A. 2005; Leonard W J et al., F1000Res. 2016; Rowell J F et al., J. Immunol. 1999; Metcalf T U et al., J. Virol. 2013]. All SV viral vectors used in these studies are replication-defective. Vectors were produced as previously described. SV.IL12 plasmid used in this study has been published in 2002 [Tseng J C et al., J Natl Cancer Inst. 2002]. To construct a Sindbis viral vector containing genes for interleukin 12 (IL-12), the Sindbis viral vector SinRep/2PSG was first constructed, which contains a secondary subgenomic promoter that is responsive to the Sindbis replicase. Two DNA oligonucleotide primers (sequence 5′ CGCGTAAAGCATCTCTACGGTGGTCCTAATAGTGCATG-3′; SEQ ID NO: 29) and its complementary strand 5′CACTATTAGGACCACCGTCGAGATGCTTTA-3′; SEQ ID NO: 30) containing the subgenomic promoter sequence were annealed and ligated into the MluI and SphI sites of the SinRep plasmid. The murine IL-12 α subunit gene (mp35; ATCC 87596) and the IL-12 β subunit gene (mp40; ATCC 87595) were subcloned into the MluI and the StuI sites of SinRep/2PSG, respectively, to produce the Sin-Rep/IL12 plasmid.
[0369] SV empty is the same plasmid without an additional gene of interest (e.g.IL12). SV.Luc was generated as described [Tseng, J C et al., Nature Biotech., 2004]. SV.GFP was generated as published in 2012 [Suzme R et al., Cancer Gene Ther., 2012]. Briefly, plasmids carrying the replicon (e.g. SinRep-IL12 or SinRep-IL-12) or DHBB helper RNAs were linearized with XhoI. In vitro transcription was performed using the mMessage mMachine RNA transcription kit (Ambion). Helper and replicon RNAs were then electroporated into BHK cells and incubated at 37° C. in αMEM supplemented with 10% FCS. After 12 hours, the media was replaced with OPTI-MEM (GIBCO-BRL) supplemented with CaCl.sub.2) (100 mg/l) and cells were incubated at 37° C. After 24 hours, the supernatant was collected, centrifuged to remove cellular debris, and frozen at −80° C. Vectors were titrated as previously described [Tseng J C et al., J. Natl. Can. Inst., 2002].
[0370] In Vivo Experiments and Tumor Models
[0371] All experiments were performed in accordance with the Institutional Animal Care and Use Committee of New York University Health. Six to 12-week old female BALB/c mice were purchased from Taconic (Germantown, N.Y.) and age matched male FVB/NJ mice were purchased from Jackson Laboratory.
[0372] Tumor Inoculation and Animal Studies
[0373] Treatment started on day 4 after i.p. inoculation of 7×10.sup.4 CT26.Fluc cells or 105 cells of MyC-CaP.Fluc in 500 μl OPTI-MEM. For treatments, mice were randomized and SV (10.sup.7 TU/ml), in a total volume of 500 μl, was injected i.p. into the left side of the animal once for CT26.Fluc and 4 days a week (days 1, 2, 3, 4) for a total of 4 weeks for MyC-CaP.Fluc inoculated mice. The immune checkpoint inhibitor anti-OX40 (clone OX-86, BioXCell) was injected i.p. into the left side of the animal at a dose of 250 μg per injection (1×/week for the CT26.Fluc and 3×/week for MyC-CaP.Fluc tumor bearing mice). Therapeutic efficacy of the treatment was monitored in two ways: tumor luminescence and survival. Noninvasive bioluminescent imaging was performed using the IVIS Spectrum imaging system (Caliper Life Science) at the indicated time points and tumor growth was quantified using the Living Image 3.0 software (Caliper Life Science) as previously described 86. Relative tumor growth for each mouse was calculated dividing total body counts of a given day by total body counts of the first IVIS image. Survival was monitored and recorded daily.
[0374] Flow Cytometry
[0375] For flow cytometry analysis, spleens and tumors were harvested from mice and processed as previously described [Scherwitzl I, et al., Mol. Ther. Oncol, 2018]. The extracted tumors were chopped into small pieces and incubated with a digestive mix containing RPMI with collagenase IV (50 μg/ml) and DNAse I (20 U/ml) for 1 hour at 37° C. Tumor samples had additional hyaluronidase V (50 μg/ml) in the digestive mix.
[0376] Spleens and digested tumors were mashed through a 70-μm strainer before red blood cells were lysed using ammonium-chloride-potassium (ACK) lysis (Gibco). Cells were washed with PBS containing 1% FCS and surface receptors were stained using various antibodies. Fluorochrome-conjugated antibodies against mouse CD3, CD4, CD44, ICOS, OX40, CD69, Foxp3, Granzyme B and Tbet, were purchased from Biolegend. Fluorochrome-conjugated antibodies against mouse CD8a were purchased from BD Biosciences. Mitotracker Deep Red FM, Mitotracker Green and Fluorchrome-conjugated antibodies against CXCR3 and Ki67 were purchased from Thermofisher. Stained cells were fixed with PBS containing 4% Formaldehyde. For intracellular staining, the forkhead box P3 (FOXP3) staining buffer set was used (eBioscience). Flow cytometry analysis was performed on a LSR II machine (BD Bioscience) and data were analyzed using FlowJo (Tree Star).
[0377] T Cell Isolation
[0378] Total T cells were freshly isolated with the EasySep™ mouse T Cell Isolation Kit. Freshly isolated lymphocytes were depleted of either CD4 or CD8 specific T cells using EasySep™ mouse CD4 and CD8 Positive Selection Kits II. Isolation of T cells and depletions were performed according to the manufacturer's protocols (Stemcell Technologies).
[0379] Enzyme-Linked Immunospot (ELISPOT)
[0380] Enzyme-linked immunospot was performed as previously described [Scherwitzl I, et al., Mol. Ther. Oncol, 2018]. Splenocytes and T cells were prepared as described for flow cytometry. Mouse IFNγ ELISPOT was performed according to the manufacturer's protocol (BD Bioscience). Lymphocytes (4×105 cells) and isolated (8×104) T cells were plated per well overnight in RPMI supplemented with 10% FCS. No additional stimulus was used in the ELISPOT. As positive control, cells were stimulated with 5 ng/ml PMA+1 g/ml Ionomycin.
[0381] Ex Vivo Cytotoxic Assay
[0382] T cells were isolated on day 7 and day 14 during treatment. 8×105/ml T cells were co-cultured with CT26.Fluc cells (2×104/ml) or MyC-CaP.Fluc cells (2×104/ml) in a 24 well plate for 2 days in 1 ml RPMI supplemented with 10% FCS. Cells were washed with PBS and lysed with 100 l of M-PER Mammalian Protein Extraction Reagent (Promega) per well. Cytotoxicity was assessed based on the viability of CT26 cells, which was determined by measuring the luciferase activity in each well. Luciferase activity was measured by adding 100 l of Steady-Glo reagent (Promega) to each cell lysate and measuring the luminescence using a GLOMAX portable luminometer (Promega).
[0383] CD8+ and CD4+ T-Cell Depletion In Vivo
[0384] CD8+ T cells were depleted using anti-CD8 antibody (clone 2.43) (Bio X cell, Lebanon, N.H.). 0.1 mg antibody in 0.2 ml PBS was injected into each mouse, starting 1 day before the first SV treatment, and then every 4 days for 2 weeks. CD4+ T cells were depleted using anti-CD4 antibody (clone GK 1.5) (Bio X cell, Lebanon, N.H.). 0.4 mg were injected into each mouse, starting day 1 before the first treatment. Control mice were injected with PBS and isotype controls.
[0385] Quantitative Real-Time PCR
[0386] RNA was extracted from tumor samples using RNeasy Kit (Qiagen), followed by cDNA synthesis with the iScript II Kit (Bio-Rad). qRT-PCR was performed using iQ™ SYBR Green Supermix (Biorad) and an StepOne™ Real-Time PCR Detection System (Applied Biosystems). PCR conditions were as follows: 95° C. for 10 min, followed by 40 cycles (94° C. for 30 s, 58° C. for 30 s) of amplification. For quantitation, CT values were normalized to GAPDH and expression was analysed using the 2-ΔΔCT method. Primers for CXCL9, CXCL10 and GAPDH were used. CXCL9 (Forward: GAAGTCCGCTGTTCTTTTCC; SEQ ID NO: 25 Reverse: TTGACTTCCGTTCTTCAGTG; SEQ ID NO: 26), CXCL10 (Forward: GCTGCAACTGCATCCATATC; SEQ ID NO: 27; Reverse: AGGAGCCCTTTTAGACCTTT; SEQ ID NO: 28).
[0387] Transcriptome Analysis of T Cells
[0388] Total RNA was extracted from freshly isolated T cells on day 7 of treatment from spleens using RNeasy Kit (Qiagen). For each group, 3 BALB/C mice or 3 FVB/J mice were used for biological repeats. RNA-seq was done by NYUMC Genome Center. RNA quality and quantity was analyzed. RNAseq libraries were prepared and loaded on the automated HiSeq 4000 Sequencing System (Illumina) and run as single 50 nucleotide reads.
[0389] Alignment and Differential Expression Analysis
[0390] Sequences were aligned to the mm10 mouse genome using Bowtie software, Version 1.0.0.sup.87 [Langmead R et al., Genome Biol. 2009] with two mismatches allowed. Uniquely mapped reads were further processed by removing PCR duplicates with Picard (“Picard Tools.” Broad Institute, GitHub repository. http://broadinstitute.github.io/picard/) MarkDuplicates and transcripts were counted using HTSeq.sup.88 and differential gene expression was performed between all groups using DESeq [Anders S et al., Genome Biol. 2010]. Differences in gene expression were considered significant if padj<0.05.
[0391] GSEA and Enrichment Map Analysis
[0392] The network-based method enrichment map 90 was used for gene-set enrichment visualization and interpretation of data. As a follow up analysis of Gene-Set Enrichment Analysis2 (GSEA) [Mootha V K et al., Nat. Genet., 2003] it reduces redundancy and helps in the interpretation of large gene sets and helps to quickly identify major enriched functional themes in the gene expression data. To perform this analysis, we first assigned a unique row identifier for each transcript and obtained differentially expressed genes through DESeq [Anders S et al., Genome Biol. 2010]. These genes were then ranked and GSEA was performed in Gene Pattern 92 server using GSEA pre-ranked module. We then obtained the gene identifiers corresponding to the gene names using the Bioconductor package ‘org.Mm.eg.db’ and the resulting positively and negatively regulated gene identifiers were used to generate enrichment maps in Cytoscape [Shannon P et al., Genome Res. 2003]. Expression heatmap is drawn by Morpheus (https://software.broadinstitute.org/morpheus/). Highest and lowest expression for each gene (row min. and row max.) were displayed as red or blue color, respectively.
[0393] Measurement of Oxygen Consumption and Extracellular Acidification Rates of T Cells
[0394] T cell metabolic output was measured by Seahorse technology as previously described [Scharping N E et al., Cancer Immunol. Res., 2017]. Purified T cells were plated at 6×10.sup.5 cells/well in a Seahorse XF24 cell culture microplate. Oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) were measured using an Agilent Seahorse XFe24 metabolic analyzer following the procedure recommended by the manufacturer (Agilent). For the mitochondrial stress test, 1) oligomycin (1 μM), 2) FCCP (1.5 μM) and 3) rotenone (100 nM) and antimycin A (1 μM) were injected sequentially through ports A, B and C.
[0395] Immunoblot Analysis
[0396] Cells were lysed in M-PER© Mammalian Protein Extraction Reagent according to the manufacturer's protocol. Lysates were separated by SDS-PAGE on 4-12% Bio-Rad gels, transferred to polyvinylidene difluoride (PVDF) membranes, blocked in 5% Milk in TBS buffer with 0.1% Tween-20 (TBST). Primary antibodies to c-Myc (Santa Cruz Biotechnology) and GAPDH (Thermofisher) were added at room temperature or overnight at 4° C. Secondary fluorescent antibodies (IRDye®, LI-COR) were added in 5% Milk in TBST for 1 h at room temperature. Odyssey® Classic Infrared Imaging System was used for visualization.
[0397] Histochemistry and Multiplex immunofluorescence (MIF)
[0398] Tumors of mice were collected, fixed in 4% PFA for 2 days and embedded in paraffin, sectioned and H&E stained. For Multiplex immunofluorescence staining and imaging, five micron paraffin sections were stained with Akoya Biosciences® Opal™ multiplex automation kit on a Leica BondRX® autostainer, according to the manufacturers' instructions. Prior to incubation with the first primary antibody, sections underwent heat retrieval with Bond Epitope Retrieval Buffer 2 (Leica ER2, AR9640) and blocking. Primary antibodies in Panel 1 were against CD3 (1:200, Biorad, MCA1477T), CD8 (1:2000, Cell Signaling, 98941S), Ki67 (1:200, Abcam, AB16667). Primary antibodies in Panel 2 recognized iNos (1:1000, Genetex, GTX130246), Arg1 (1:750, Genetex, GTX109242), Granzyme B (1:1000, Abcam, AB4059), CD11b (1:10,000, Abcam, AB133357), F480 (1:250, Cell Signaling, 70076S). Each primary antibody was followed by a cocktail of horse radish peroxidase-conjugated secondary antibodies against mouse and rabbit IgG (RTU, Akoya/Perkin Elmer, Cat # ARH1001) and then tyramide mediated signal amplification (TSA) with covalent linkage of the individual Opal fluorophor (each 1:250, Opal 520 (FP1496001KT), 540 (FP1487001KT), 570 (FP1494001KT), 620 (FP1488001KT), 650 (FP1495001KT) or 690 (FP1497001KT), Akoya/Perkin Elmer Cat #'s) to the tissue antigen. Antibodies were subsequently stripped using either ER1 (Leica, AR9961) or ER2 (Leica, AR9640) heat retrieval buffer and the next round of immunostaining initiated. After completion of the sequential incubations and stripping, slides were counterstained with spectral DAPI (Akoya/PerkinElmer, FP1490). Monoplex controls were used to confirm appropriate staining for antibodies integrated into the multiplex panels. Multispectral imaging was performed on a Vectra3 imaging system (Akoya/PerkinElmer) at 20×. The fluorophore emission signatures were captured by a multispectral camera and then unmixed with InForm software (Akoya/PerkinElmer). Autofluorescence, obtained from an unstained slide, was removed from the composites and pseudo-colored images exported as tif files.
[0399] Statistical Analysis
[0400] Statistical analysis was performed using GraphPad Prism 7.0 as described in Figure legends. All data are shown as mean±s.e.m. Figures were prepared using GraphPad Prism 7, Adobe Photoshop and ImageJ Software. Treated groups were compared, using a one-way analysis using Prism7 (GraphPad Software), to naïve mice. Differences with a P value of <0.05 were considered significant: *P<0.05; **P<0.005; ***P<0.0001.
[0401] SV Expressing IL-12 Enhances the Expression of OX40 on CD4 T Cells
[0402] The study described herein investigated the therapeutic effect of SV.IL12 in immune-competent tumor bearing mice (colon cancer; CT26). To exploit SV.IL12 for cancer therapy, tumor cells were i.p. implanted and after tumor establishment (4 days after tumor cell injection [day 0]), SV, SV.IL12 or IL-12 were i.p. injected on 4 consecutive days (day 1, 2, 3 and 4) for a total of 4 weeks (
[0403] Intraperitoneal Delivery of SV.IL12 and Anti-OX40 Antibody Cures Established Cancers
[0404] To investigate whether the oncolytic activity of SV.IL12 in combination with anti-OX40 is required for successful anti-cancer therapy, SV non-susceptible (colon cancer; CT26) and susceptible (prostate cancer; MyC-CaP) tumor cell lines were used in this study (
[0405] Combination Therapy Markedly Changes the Transcriptome Signature of T Cells
[0406] The requirement of T cells during SV.IL12 with anti-OX40 treatment was assessed. The presence of both CD4 and CD8 T cells was required for eliciting the observed therapeutic efficacy as mice treated with the corresponding depleting antibodies were unable to control tumor growth (
[0407] Unbiased pathway enrichment and network analyses of DEG from control versus combination therapy was performed to determine biological processes in T cells that are influenced by this treatment (
[0408] Combination Therapy Enhances Systemic T Cell Responses, Favoring Th1 Like ICOS CD4 T Cells
[0409] As T cells from combination therapy express a marked change in their transcriptome signature compared with all other groups, markers for T cell differentiation and activation (e.g., PD-1, ICOS, OX40, TIM3, KLRG1, IL7R) as well as T cell lineage transcription factors (e.g., EOMES, TBET, GATA3, BCL6, RORC, FOXP3) were analyzed (
[0410] CD4 and CD8 T Cells are Metabolically Reprogrammed in Mice Treated with SV.IL12 and Anti-OX40
[0411] The tumor microenvironment can be a very challenging milieu for an effector T cell as it is characterized by hypoxia, acidosis and low levels of nutrient sources such as glucose and glutamine [Delgoffe, G M et al, Cancer Immunol. Res., 2016; Scharping, N. E, Vaccines, 2016; Chang, C H et al., Cell, 2015]. Even if T cell activation and initiation of effector function is allowed, T cells may be unable to generate the bioenergetic intermediates necessary to carry out effector function in the tumor microenvironment. Thus, providing a metabolic support for T cells is crucial for the success of cancer treatments as previously reported [Scharping, N. E. et al., Immunity, 2016; Ho, P C et al., Cell, 2015; Siska P J., et al, Trends immunol., 2015; Zhao et al., Nat. Immunol., 2016]. To test if SV.IL12 in combination with anti-OX40 influences the metabolic state of T cells, Gene Set Enrichment Analysis (GSEA) of the RNA sequencing data was performed between T cells from combined therapy and control. GSEA analysis showed significantly higher expression of genes involved in oxidative phosphorylation and glycolysis pathways during combination therapy (
[0412] Analysis of mitochondrial mass (
[0413] To determine the kinetics of peripheral T cell metabolism over the course of treatment with SV.IL12 and anti-OX40, OCR and ECAR were measured on day 7, 14 and 40 in CT26.Fluc bearing mice (
[0414] Metabolic Reprogrammed T Cells in SV.IL12 with Anti-OX40 Treated Mice Display Enhanced CD4 Mediated Cytokine Production and Anti-Tumor Activity
[0415] To test if metabolic reprogrammed T cells in combined therapy possess enhanced effector functions, cytokine production and cytotoxicity were analyzed in T cells isolated from spleens on day 7. Genes encoding pro-inflammatory cytokines ifng and il2 were upregulated in T cells from mice treated with SV in combination with anti-OX40 (
[0416] In addition, RNA levels of the cytotoxic proteases, granzyme A and B, were upregulated in mice treated with combination therapy compared with all other groups (
[0417] Having observed upregulation of granzymes and cytotoxic receptors in combination therapy, the function of T cells was investigated using an ex vivo tumor growth assay. Splenocytes obtained from all groups were co-cultured at an effector-to-target cell ratio of 10:1 with either CT26.FLUC (
[0418] Mice Treated with SV.IL12 in Combination with Anti-OX40 Display Enhanced T Cell Migration and Intratumoral T Cell Immunity
[0419] Only a minority of the total of treated patients respond to current immunotherapy and the presence of TILs has been shown to be one of the main factors that influence the responsiveness towards various therapies in multiple cancers [Galon, J et al., Science 2006; Hwang W T et al., Gynecol Oncol 2012]. Due to the fact that SV elicited anti-tumor responses do not necessarily require direct infection of the tumor or intratumoral injection, whether SV.IL12 therapy in combination with anti-OX40 could nevertheless alter the local tumor microenvironment and favor intratumoral immunity, was investigated. To assess whether SV.IL12 in combination with anti-OX40 induces T cell infiltration into the tumor, the chemokine receptor CXCR3 on peripheral T cells was analyzed after one week of treatment. In the CT26.Fluc model CXCR3 levels were significantly upregulated on CD4 T cells during combination therapy compared with all other groups and CXCR3 levels remained elevated over the course of treatment (
[0420] The study described herein provides a practical strategy for cancer immunotherapy using an OV and anti-OX40. This strategy takes advantage of the preexisting T cell immune repertoire in vivo, removing the need to know about present tumor antigens. The study described herein shows that the combination of replication-deficient SV.IL12 and anti-OX40 amplifies these antitumor T cells and induces their action throughout the body against two distinct solid tumors, reversing effectively local tumor-mediated immune suppression. This effect was specific for combination therapy and was not observed during SV.IL12 or anti-OX40 treatment alone.
[0421] The high metabolic activity of cancer cells together with the poor vasculature blood supply in the tumor microenvironment can induce nutrient deprivation [Delgoffe, G M et al., Cancer Immunol Res. 2016; Scharping, N E & Delgoffe, GM, Vaccines, 2016; Chang, C H et al., Cell, 2015]. These conditions can impair TCR signaling, glycolytic and mitochondrial metabolism, as well as decrease mitochondrial mass, all hallmarks of T effector cells, resulting in impaired anti-tumor effector functions of tumor-specific T cells. 39-42 Scharping, N. E. et al., Immunity 2016; Ho, P. C. et al., Cell 2015; Siska, P J & Rathmell, J C, Trends Immunol., 2015; Zhao, E. et al., Nat Immunol, 2016]. The data in two distinct models of cancer immunotherapy disclosed in the study described herein, shows that SV.IL12 in combination with OX40 signaling provides the necessary metabolic support to T cells to generate an efficient antitumor response. This metabolic support is characterized most prominently by elevated mitochondrial function and mass in CD8 T cells as well as a switch to aerobic glycolysis in CD4 T cells. T cells from mice treated with SV.IL12 in combination with anti-OX40 demonstrated enhanced protein expression of c-Myc compared with all other groups. Thus, the study described herein clearly shows that T cells are metabolically reprogrammed in the periphery during combination therapy.
[0422] The study described herein strongly shows that the therapeutic efficacy of SV.IL12 with anti-OX40 is driven by T cell modulation and reprogramming of its metabolic state, in order to enhance the anti-tumor response in the periphery and in the tumor microenvironment. Furthermore, the use of SV allows these metabolically reprogrammed T cells to better infiltrate the tumor microenvironment, which is crucial for an adequate immunotherapy. Anti-OX40 antibody is currently being studied in phase 1 and 2 clinical trials. SV will be tested as a single agent in its first clinical trial in the third quarter of 2020. The results from our current preclinical studies provide a strong rationale for combining SV.IL12 with agonistic anti-OX40 antibodies in a therapeutic format in patients with solid tumors. In summary, the studies described herein clearly show that even in absence of direct SV tumor targeting, SV.IL12 in combination with anti-OX40, or SV vector encoding IL-12 and anti-OX40, can alter the tumor microenvironment in distinct solid tumors through an indirect and immunity driven mechanism that enhances T cell infiltration and intratumoral T cell immunity.
Example 2: Combination of IL-12 and Anti-OX40 Expressed by Sindbis Viral Vectors Synergistically Enhances Survival of Subjects with Established Tumors
[0423] The study described herein investigates the effect of administering IL-12 and anti-OX40 antibody, both expressed by Sindbis viral vectors, on established tumors. This strategy is particularly advantageous for treatment of cancers like ovarian cancer, wherein the combination of SV.IL-12 and anti-OX40 antibody is not found to be as effective, as observed in colon and prostate cancers. The administration of SV/IL-12 and an anti-OX40 antibody enhanced clearance of established tumor of colon and prostate cancer cell lines, CT26 and MyC-Cap respectively. C57/B16 albino (female) mice re-injected with Alm5-2Fluc-17 ovarian cancer cells to establish a tumor (
[0424] The study described herein, provides plasmid constructs for expressing IL-12, and anti-OX40 in a SV vector. The study described herein, provides plasmid constructs encoding IL-12 a and b subunits (
[0425] SV.IL12 plasmid used in this study has been published in 2002 [Tseng J C et al., J Natl Cancer Inst. 2002]. To construct a Sindbis viral vector containing genes for interleukin 12 (IL-12), the Sindbis viral vector SinRep/2PSG was first constructed, which contains a secondary subgenomic promoter that is responsive to the Sindbis replicase. Two DNA oligonucleotide primers (sequence 5′ CGCGTAAAGCATCTCTACGGTGGTCCTAATAGTGCATG-3′; SEQ ID NO: 29) and its complementary strand 5′CACTATTAGGACCACCGTCGAGATGCTTTA-3′; SEQ ID NO: 30) containing the subgenomic promoter sequence were annealed and ligated into the MluI and SphI sites of the SinRep plasmid. The murine IL-12 α subunit gene (mp35; ATCC 87596) and the IL-12 β subunit gene (mp40; ATCC 87595) were subcloned into the MluI and the StuI sites of SinRep/2PSG, respectively, to produce the Sin-Rep/IL12 plasmid.
[0426] The H and L chains of the OX40 Ab are expressed from a single SV using two subgenomic promoters. The synthesized sequences were designed to encode an IL-12 secretory signal peptide upstream of both H and L polypeptide sequences preceded by a ribosome binding site and the start codon. The variable Ab binding sequences that functionally bind to activate the OX40 Receptor contain complementarity determining regions that are not unique. The variable chain is linked to the respective L (GenBank accession BAR42292) and H chain (GenBank accession CAC20702) constant region sequences of mouse IgG2a; the murine IgG2a isotype is comparable to the BioXcell OX40 Ab used in parallel in vivo experiments.
[0427] In summary results described herein clearly show the possibility of using a combination of SV vectors expressing IL-12 and anti-OX40 antibody or a SV vector expressing both expressing IL-12 and anti-OX40 antibody, for treatment of cancers that may be resistant to treatment with anti-OX40 antibody administered directly.
Example 3. Molecular and Metabolic Pathways Mediating Curative Treatment of a Non-Hodgkin B Cell Lymphoma by Sindbis Viral Vectors and Anti-4-1BB Monoclonal Antibody
[0428] The studies described herein use an antibody directed at 4-1BB (CD137, TNFRSF9), a T cell costimulatory molecule. 4-1BB agonist stimulation greatly enhances NK and cytotoxic T cell activity. There are preclinical studies showing that α4-1BB effectively treats lymphoma and that depletion of Treg cells enhances the therapeutic effect of α4-1BB [Houot R et al., Blood, 2009]. The A20 tumor cells uses in the study described herein were derived from a spontaneously arising reticulum cell sarcoma (a non-Hodgkin lymphoma) in a BALB/c mouse.
[0429] Previously, SV carrying NYESO-1 was used, which encodes the cancer testis TAA, NYESO-1, to cure CT26 tumors expressing NYESO-1 [Scherwitzl I et al., Mol. Ther. Oncolytics, 2018]. The studies described herein show that systemically disseminated A20 lymphoma can be completely cured by SV plus α4-1BB mAb combination therapy without the need to produce a SV that encodes a TAA known to be present in the A20 lymphoma cells. Further, neither intratumoral injection of the SV vectors nor infection of the tumors is required as the A20 B lymphoma cells used in the current model are resistant to SV infection.
[0430] One difference in the current study, compared with those previously published, is the use of SV vector combination therapy that involves an agonistic mAb for a costimulatory receptor versus targeting checkpoint blockade molecules such as CTLA4 and PD-1. The studies described herein show that agonistic mAbs in combination with SV vectors trigger a cascade of events that results in curative results. The findings disclosed herein reveal the potential of SV combination therapy to cure tumors for which TAAs are completely unknown.
[0431] Materials and Methods
[0432] Firefly Luciferase (Fluc)-Expressing A20 Cells Generation
[0433] A20 cells were transfected with pGL4-neo_Fluc plasmid (Promega) by electroporation via Nucleofector™ kit V (Lonza). Fluc-A20 cell clones were selected and maintained in RPMI1640 (Cellgro)+10% FBS (Gibco)+250 μg/ml G418 (Gibco). One A20 clone stably expressed fLuc and was used for tumor inoculation and consecutive experiments.
[0434] SV Production
[0435] SV-LacZ production and titering were done the same as previously described [Scherwitzl I et al., Mol. Ther. Oncolytics, 2018].
[0436] SV-GFP Infection
[0437] A20 cells and control BHK cells were infected by SV carrying GFP for 1 h. The GFP expression was observed the next day by fluorescence microscopy.
[0438] A20 Tumor Inoculation and In Vivo Imaging System (IVIS) Imaging
[0439] 3×10.sup.6 fLuc-A20 cells were inoculated to BALB/C mice by i.p injection. Tumor growth was monitored as previously described [Scherwitzl I et al., Mol. Ther. Oncolytics, 2018].
[0440] SV and α4-1BB Ab treatment
[0441] Treatment was started after successful tumor inoculation (4 days after tumor cell injection, confirmed by IVIS imaging). Tumor growth was measured every week by noninvasive bioluminescent imaging. SVLacZ was injected 4 times per week, for totally 3 weeks. The virus (10.sup.7-10.sup.8 TU/mL) in a total volume of 500 μL was i.p. injected. For 2 groups (4-1BB and SV plus 4-1BB), 350 μg/mouse 41BB Ab was injected 3 times/week for 2 weeks. InVivo MAb anti-mouse 4-1BB was ordered from BioXCell (Clone: LOB12.3, Cat. No. BE0169). In low dose treatment protocol, SVLacZ was injected i.p. 3 times per week, for totally 3 weeks. 41BB Ab (50 g/mouse) was injected once a week for 3 weeks.
[0442] Elispot
[0443] Mouse IFNγ ELISPOT was performed according to the manufacturer's protocol (BD Biosciences). 2×10.sup.5 splenocytes or 1×10.sup.5 T cells were plated per well O/N in RPMI supplemented with 10% FBS. For a positive control, splenocytes were stimulated with 5 ng/ml PMA+1 μg/ml Ionomycin.
[0444] Flow Cytometry
[0445] Fluorochrome-conjugated antibodies against mouse CD3, CD4, CD8, CD25, CD44, CD62L, ICOS, CD11 a, ICAM-1 were purchased from Biolegend (San Diego, Calif.). Fluorochrome-conjugated antibodies against mouse Foxp3, EOMES and CCR5 were purchased from Thermofisher. BUV395 conjugated antibody against mouse CD8a was purchased from BD Biosciences. For surface staining, cells were washed and stained with anti-mouse direct conjugated antibodies. Cells were analyzed using the LSRII flow cytometer (BD Biosciences) and data were analyzed using Flowjo software (Treestar, Ashland, Oreg.). For intracellular cytokines staining, stimulated cells were fixed with cytofix/cytoperm solution (BD Biosciences), permeablized with perm/wash buffer (BD Biosciences) and stained with anti-mouse IFNγ antibodies. For nuclear antigen, cells were fixed and permeabilized by Foxp3 fixation/permeabilization buffer (eBioscience) and stained with anti-Foxp3, T-bet, Ki67 and EOMES antibody.
[0446] RNA Isolation and Transcriptome Analysis
[0447] Total RNA was harvested by RNAeasy isolation kit (Qiagen, Valencia, Calif.). For each group, 3 BALB/C mice were used as biological repeats. RNA-seq was performed by NYUMC Genome Technology Center (GTC). To identify significant differences in expression between any pair of groups, differential expression analysis was performed using Deseq2 and an adjusted p value cutoff of 0.05 was applied [19, Love M I et al, Genome Biol. 2014] (q<0.05). To increase stringency, only genes with a Log 2 fold change ≥1 (upregulated) or ≤−1 (downregulated) were selected for further analysis. Gene cluster analysis was performed by DAVID analysis using the selected differentially expressed genes [Huang da W et al., Nucleic Acids Res 2009, Huang da W et al., Nat Protoc. 2009]. RNA-seq results (normalized counts) were used as input to perform with Gene Set Enrichment Analysis (GSEA) [Subramanian A, et al., Proc Natl Acad Sci USA. 2005]. Molecular Signatures Database (MSigDB)v4.0 were used as screening database. For each gene, the gene expression value is normalized by the relative log 2 fold change compared to the median value of this gene. Expression heatmap is drawn by Morpheus (https://software. broadinstitute.org/morpheus/). Cannonical pathway and disease and biological functional analysis were generated by ingenuity pathway analysis (IPA; Ingenuity Systems, Redwood City, Calif.) using the statistical differential expressed genes list. To increase the sample representativeness, for IPA, we choose nominal p<0.05 as cutoff value.
[0448] Tumor Infiltrating Lymphocyte (TIL) Harvest
[0449] To investigate the phenotype of TIL, all treatments were started 11 days after tumor inoculation, After 7 days treatment, tumor mass was harvested and the phenotype of TIL were analyzed as previously described [18, Scherwitzl I, Mol Ther Oncolytics. 2018].
[0450] T Cell Seahorse Assay
[0451] T cells were isolated from spleen by using pan T cell isolation kit (Stemcells). T cells were plated at 6×10.sup.5 cells/well in 24 well plate. Oxygen consumption rate (OCR) and excellular acidification rate (ECAR) were measured by Agilent Seahorse XFe24.
[0452] Statistical Analysis
[0453] For the two group comparison, statistical difference was determined by unpaired two tail Student t-test. The multiple sample comparison was analyzed by one way ANOVA. P<0.05 was determined to be significant for all experiments. All values were calculated with Excel (Microsoft) and Prism software (GraphPad).
[0454] SV and α4-1BB mAb Combination Completely Cured A20 Lymphoma
[0455] To explore if SV has therapeutic effect on tumors not targeted or infected by SV vectors, the A20 B cell lymphoma was used, which is highly resistant to SV infection (
[0456] SV Alone and SV Plus α4-1BB mAb Stimulated Cell Cycle Progression, Cytokine Production, and Activation
In the study described herein, SV significantly inhibited tumor growth by day 7 (
TABLE-US-00039 TABLE 1 The SD expressed genes list for SV vs. untreated group by RNA-Seq (q < 0.05, Log2FC ≥ 1 and Log2FC ≤ −1). gene baseMean log2FC log2FCunshrunk pvalue padj Gm2762 38.5 3.15 4.04 0 0 Il21 229 2.57 3.66 1.81E−13 2.63E−11 Ascl2 24.4 2.55 3.83 2.83E−12 3.8E−10 Akr1c18 25.3 2.4 4.32 6.37E−11 6.98E−09 Angptl2 741.2 2.35 2.59 0 0 E2f8 535.1 2.33 2.61 0 0 Vat1l 14.9 2.33 4.01 1.65E−10 1.68E−08 Aurkb 806.6 2.3 2.46 0 0 Gzmb 4113.9 2.26 2.51 0 0 Cdc25c 143.9 2.08 2.51 3E−15 5.19E−13 Prr11 288 2.04 2.36 0 3.3E−14 Ighg2c 873 2.04 4.64 6.37E−08 4.29E−06 Tpx2 1113.7 2.03 2.19 0 0 Bub1 362.3 2.02 2.22 0 0 Bub1b 1344.3 2.01 2.14 0 0 Nusap1 813.1 2 2.12 0 0 Kntc1 402.4 2 2.22 0 0 Kif18b 606.6 1.99 2.14 0 0 Gzmk 1785.2 1.99 2.28 0 4E−15 Nuf2 279.6 1.97 2.25 0 1.8E−14 Mcm10 477.4 1.96 2.11 0 0 Mki67 5899.1 1.96 2.12 0 0 Ccnb2 1255.4 1.95 2.1 0 0 Rad54l 350.2 1.95 2.16 0 0 Hmmr 311.7 1.94 2.19 0 1E−15 Chn1 24 1.94 2.52 2.4E−09 2.01E−07 Ccna2 1680.2 1.93 2.04 0 0 Pclaf 522.9 1.93 2.17 0 5E−15 Cenpf 495.6 1.92 2.07 0 0 Kif2c 341.3 1.92 2.1 0 0 Cdkn3 129.2 1.92 2.16 0 0 Vdr 250.7 1.92 2.2 1.02E−13 1.57E−11 Fignl1 145.7 1.91 2.15 0 0 Ttk 211.5 1.9 2.14 0 5E−15 Diaph3 356.3 1.89 2.03 0 0 Oip5 50.6 1.88 2.49 1.92E−10 1.94E−08 Kif4 650.2 1.87 1.98 0 0 Rrm2 1718.2 1.87 2.01 0 0 Sccpdh 123.3 1.86 2.05 0 3.6E−14 Clspn 637.1 1.83 1.98 0 0 Padi4 34.4 1.83 2.41 6.18E−08 4.18E−06 Shcbp1 274.8 1.82 1.98 0 0 Rad51 401.4 1.82 1.99 0 0 Tox2 889.5 1.82 2.01 0 1.5E−14 Spc24 506 1.81 1.92 0 0 Sgo1 162.8 1.81 2.01 0 5E−15 Depdc1a 29.6 1.81 2.69 1.72E−08 1.26E−06 Lrr1 59 1.8 2.37 9.15E−10 8.14E−08 Cdca8 1251.5 1.79 1.91 0 0 Kif20a 898.5 1.78 1.9 0 0 Espl1 809.6 1.78 1.9 0 0 Cdk1 1228.8 1.78 1.92 0 0 Sapcd2 275.5 1.78 1.98 0 5E−14 Pbk 107.5 1.78 2.08 1.08E−13 1.63E−11 Gfra4 95 1.78 2.1 9.39E−11 9.94E−09 Fcer1a 69.7 1.77 2.87 1.43E−06 6.68E−05 Lag3 2916.7 1.76 1.84 0 0 Rad51ap1 205.6 1.76 1.92 0 0 Ube2c 1391 1.75 1.95 5E−15 9.54E−13 Knl1 203.3 1.75 1.98 2.7E−14 4.39E−12 Kif15 595.3 1.74 1.87 0 0 Cep55 503.9 1.74 1.88 0 0 Ticrr 558.4 1.74 1.88 0 0 Neil3 228.1 1.72 1.89 0 7E−15 Spc25 211.3 1.72 1.94 1.08E−13 1.63E−11 Lpar3 17.1 1.72 2.4 4.07E−07 2.23E−05 Ncapg 383.1 1.71 1.87 0 4E−15 Iqgap3 284.2 1.71 1.86 0 4E−15 Nek2 554.5 1.71 1.87 0 2.9E−14 1500009L16Rik 143.2 1.69 2.2 2.79E−08 1.97E−06 Ckap2l 455.4 1.68 1.86 3E−15 6.37E−13 Ncaph 822.4 1.67 1.76 0 0 Uhrf1 1603.6 1.67 1.77 0 0 Pimreg 230 1.67 1.88 1.32E−13 1.96E−11 Top2a 4726.3 1.66 1.73 0 0 Spag5 1183.2 1.66 1.77 0 0 Kif14 299.1 1.66 1.84 3E−15 6.22E−13 Il10 1005.5 1.66 1.83 3.1E−14 4.98E−12 Pif1 204 1.66 1.94 1.16E−11 1.41E−09 Parpbp 117.3 1.66 1.94 1.52E−11 1.79E−09 Ly6a 2208.2 1.65 2.56 2.41E−06 0.000106 Melk 329.8 1.64 1.75 0 0 Ccnb1 160.8 1.63 1.88 1.91E−11 2.2E−09 Cit 784.3 1.62 1.74 0 4E−15 Esco2 149.5 1.61 1.83 4.58E−12 5.99E−10 CT030166.6 24.2 1.61 2.49 2.45E−06 0.000107 Trip13 233.7 1.6 1.74 0 5E−14 Cenpe 685.5 1.59 1.71 0 1E−15 Fads2 70.5 1.57 1.98 1.07E−07 6.9E−06 Cdc45 628.7 1.56 1.62 0 0 Cdca5 791.4 1.56 1.63 0 0 Cdca3 1038.6 1.56 1.64 0 0 Coro2b 349.5 1.56 1.68 1.3E−14 2.31E−12 Cenph 201.9 1.55 1.73 2.02E−12 2.73E−10 Troap 236.4 1.54 1.73 6.69E−12 8.53E−10 Birc5 1540.7 1.54 1.73 3.18E−11 3.56E−09 Ifi27l2a 8730.4 1.54 1.88 1.34E−07 8.38E−06 Mcpt1 510.2 1.54 3.77 4.63E−05 0.001264 Plk1 794.8 1.53 1.65 1E−15 1.43E−13 Ankle1 238.9 1.53 1.72 1.64E−11 1.92E−09 Cd109 30.7 1.53 2.47 3.8E−05 0.001099 Cdca2 444.5 1.52 1.64 0 2.9E−14 Siglec1 622.7 1.52 1.69 1.49E−11 1.77E−09 Ska1 210.9 1.52 1.73 2.11E−10 2.12E−08 Igkv14-111 309.6 1.51 2.66 7.06E−05 0.001789 Alox5 104.2 1.5 2.08 6.41E−06 0.000241 Stmn1 257.1 1.49 1.61 1.1E−14 2E−12 Ect2 255.1 1.49 1.71 1.15E−09 9.97E−08 Asf1b 1276.4 1.48 1.55 0 0 Ncapg2 526.2 1.48 1.58 0 1.5E−14 Cenpm 289.6 1.48 1.64 8.64E−12 1.07E−09 Cenpp 81.2 1.48 1.69 2.19E−10 2.19E−08 F13a1 227.4 1.48 2.13 1.59E−05 0.000526 Oas1a 498.3 1.47 1.73 2.33E−08 1.66E−06 Oas2 1573.5 1.47 2.24 3.32E−05 0.000987 Cenpi 136.8 1.46 1.61 1.49E−12 2.03E−10 Tex15 58.4 1.46 1.88 2.46E−07 1.43E−05 Lif 439.6 1.45 1.5 0 0 Tk1 1004.9 1.45 1.54 0 1E−15 Kif22 1022.2 1.45 1.56 1.09E−13 1.63E−11 BC030867 129.6 1.45 1.65 7E−10 6.44E−08 Tnp2 17.6 1.45 2.43 6.42E−05 0.001655 Tph1 43 1.45 2.97 0.000121 0.0028 lghv1-39 28.6 1.45 2.67 0.000133 0.003011 Tyms 809.6 1.44 1.51 0 0 Kif11 1109.9 1.44 1.51 0 0 Ighv2-6 141.1 1.44 1.89 9.88E−06 0.000349 Gng3 34.8 1.44 2.26 1.32E−05 0.000449 Spdl1 204.5 1.43 1.54 1E−14 1.71E−12 Cdh23 89.8 1.43 1.55 8.05E−12 1.01E−09 Aspm 319.4 1.43 1.59 9.94E−11 1.04E−08 Dsp 79.2 1.43 1.78 2.44E−06 0.000107 Ighv1-19 10.2 1.43 2.88 0.000154 0.003401 Depdc1b 350.8 1.42 1.54 3.09E−13 4.45E−11 Ctsg 151.2 1.42 2.54 0.000128 0.002935 Mxd3 280.1 1.41 1.5 2E−15 3.2E−13 Chaf1a 1027.2 1.4 1.49 2E−15 4.68E−13 Aunip 24.6 1.4 2.68 8.31E−05 0.00205 Mt3 18.3 1.4 2.93 0.000162 0.003547 Tcf19 1158.6 1.39 1.45 0 0 Gpm6b 315 1.39 1.48 1.5E−13 2.21E−11 Cd5l 2824.6 1.39 1.52 7.15E−11 7.78E−09 Msr1 48.9 1.39 1.89 1.13E−05 0.000392 Ighg1 2604.8 1.39 3.8 0.00023 0.004805 Ncapd2 3741.3 1.38 1.42 0 0 Oas3 1474.3 1.38 1.71 2.37E−06 0.000105 Necab3 27.4 1.38 1.88 1.94E−05 0.000622 Tpsab1 262.4 1.37 1.66 1.78E−06 8.17E−05 Gm4951 44.3 1.37 1.8 3.61E−06 0.000148 Exo1 187.1 1.36 1.54 1.17E−08 8.79E−07 Adam33 60.3 1.36 1.62 1.37E−06 6.46E−05 Klrb1a 36.2 1.36 2 7.82E−05 0.001956 Ndc80 345.5 1.35 1.44 2.6E−14 4.36E−12 Slc16a2 105.6 1.35 1.56 1.32E−07 8.29E−06 Klhl23 20.6 1.35 2.46 0.000156 0.003429 Ckap2 394.5 1.32 1.39 0 2.3E−14 Cdc6 570.6 1.32 1.4 2.3E−14 3.85E−12 E2f7 275.3 1.32 1.48 3.98E−09 3.21E−07 Mpo 1003.3 1.32 2.2 0.000333 0.006459 Mastl 108.5 1.31 1.51 7.78E−08 5.19E−06 Cenpn 307 1.3 1.38 6.9E−14 1.09E−11 Rad51b 65.9 1.3 1.52 2.32E−07 1.37E−05 Pgam2 13 1.3 2.75 0.000571 0.009954 Smtn 271.7 1.29 1.4 2.59E−10 2.57E−08 Car5b 136 1.29 1.45 6.02E−10 5.61E−08 Wfdc17 99.9 1.29 1.47 2.18E−07 1.3E−05 Xkr5 39.4 1.29 1.62 5.06E−06 0.000197 Ifit1bl1 137.8 1.29 1.67 2.19E−05 0.000693 Dhfr 503.3 1.28 1.35 2.1E−14 3.58E−12 Ccne1 503.1 1.28 1.37 8.53E−12 1.06E−09 Il4 152.5 1.28 1.52 3.69E−06 0.000151 Ms4a3 31.1 1.28 2.52 0.000653 0.011034 Fancd2 392.9 1.27 1.33 0 3.4E−14 Syce2 175.1 1.27 1.39 1.01E−09 8.79E−08 Slc43a3 380.4 1.26 1.36 1.77E−11 2.05E−09 Mcpt2 69.1 1.26 3.47 0.000769 0.012455 Dna2 343.7 1.25 1.36 3.64E−10 3.52E−08 Stil 422.9 1.25 1.39 3.95E−08 2.72E−06 Ms4a4a 77.2 1.24 1.41 1.03E−07 6.69E−06 Ifit3 421.9 1.24 2 0.000649 0.010983 Ighv1-9 232.8 1.24 2.33 0.001087 0.016261 Brca1 443.2 1.23 1.32 6.31E−12 8.12E−10 Cks1b 772.5 1.22 1.32 1.23E−09 1.05E−07 Scin 117.4 1.22 1.59 0.000102 0.002435 Fanca 375.8 1.21 1.29 3.34E−12 4.44E−10 Sostdc1 55.7 1.2 1.42 2.05E−05 0.000654 Tmprss4 19.7 1.2 1.67 0.000585 0.010122 Pcdhgc4 19.5 1.2 1.98 0.000598 0.010298 C3 1368.2 1.19 1.36 9.68E−07 4.74E−05 Fbn2 27 1.19 1.43 6.33E−05 0.001639 Igf2bp2 71.9 1.19 1.64 0.000461 0.008431 Pask 202.9 1.18 1.28 1.46E−09 1.24E−07 Atp6v1g3 12.9 1.18 2.18 0.001663 0.022323 Tmem121 19.5 1.17 1.86 0.001247 0.017975 E2f1 876.4 1.16 1.19 0 0 Zan 929.3 1.16 1.27 3.35E−08 2.33E−06 Plac8 2583 1.16 1.28 1.19E−07 7.61E−06 Rad54b 114.1 1.16 1.29 1.79E−07 1.09E−05 Lig1 3384.1 1.15 1.2 7E−15 1.29E−12 Gins2 413.5 1.15 1.22 1.04E−11 1.28E−09 Gpsm2 436.7 1.15 1.23 2.7E−11 3.06E−09 Arhgap11a 847.4 1.15 1.22 7.3E−11 7.83E−09 Gbp11 355.1 1.15 1.23 6.55E−10 6.06E−08 Gm15987 44.4 1.15 1.51 0.000198 0.004191 Efcab11 31.5 1.15 1.62 0.000442 0.008194 Sncb 15 1.15 2.01 0.001303 0.018592 Il13 60.8 1.15 1.81 0.001306 0.01862 Smpdl3b 185.8 1.14 1.28 1.47E−07 9.11E−06 Ispd 31.4 1.14 1.42 0.000161 0.003543 Igf2bp3 26.6 1.14 1.91 0.001053 0.015932 Platr11 10.2 1.14 2.09 0.00249 0.029873 Cpa3 467.2 1.14 2.12 0.002534 0.03018 Tacc3 1922.3 1.13 1.16 0 1E−15 Rmi2 184.3 1.13 1.21 5.58E−10 5.23E−08 Nsl1 195.3 1.13 1.21 1.45E−09 1.23E−07 AC151730.1 71.6 1.13 1.55 0.000357 0.006861 Myh3 15.8 1.13 1.64 0.001352 0.019086 Ighg2b 522.3 1.13 2.65 0.002343 0.028708 Klrg1 746.6 1.12 1.21 3.27E−10 3.18E−08 Ociad2 184.7 1.12 1.27 1.87E−08 1.35E−06 Mis18bp1 180.6 1.12 1.24 1.95E−07 1.17E−05 Ccl1 31 1.12 1.77 0.001407 0.019614 Prtn3 290.9 1.12 2.13 0.002845 0.032835 Cdc20 1268.9 1.1 1.14 7.2E−14 1.12E−11 Tfec 71.7 1.1 1.32 6.43E−05 0.001657 Isg15 787.9 1.1 1.38 0.000249 0.005119 Klra7 38.4 1.1 1.58 0.00111 0.016512 Hist1h2bj 17.7 1.1 1.75 0.001687 0.022479 Kbtbd6 12 1.1 2.04 0.002527 0.030129 Stx11 1153.5 1.09 1.14 3.55E−12 4.68E−10 Lgals1 11014.9 1.09 1.15 9.3E−10 8.22E−08 Ccl8 29.5 1.09 4.6 0.003929 0.041586 Nt5dc2 188.1 1.08 1.22 4.38E−06 0.000174 Dnph1 136.4 1.08 1.29 6.66E−05 0.001706 Bcat1 363.8 1.07 1.14 8.94E−10 8.07E−08 Kifc1 310.5 1.07 1.17 8.33E−08 5.52E−06 Mybl2 481.2 1.07 1.17 5.93E−07 3.09E−05 Mx1 719.3 1.07 1.66 0.002705 0.031699 Mcm5 5776.8 1.06 1.1 0 9.6E−14 Cdkn2c 421.3 1.06 1.11 1.25E−11 1.49E−09 Ccl2 77.5 1.06 1.47 0.001637 0.022077 Ifit1 298.3 1.06 1.61 0.002709 0.031699 Ighv5-2 17.8 1.06 2.05 0.004935 0.049159 Ccr5 1338.8 1.05 1.1 1.43E−12 1.97E−10 Serpinb6b 1199 1.05 1.12 3.96E−09 3.2E−07 Smc2 1176.2 1.05 1.12 4.67E−09 3.71E−07 Isg20 861.4 1.05 1.15 1.91E−06 8.67E−05 Klrc3 41.9 1.05 1.37 0.000456 0.008347 Rtp4 1189.3 1.05 1.43 0.001656 0.022272 Nrg1 17.4 1.05 1.91 0.00423 0.043995 Gins1 191.5 1.04 1.17 3.75E−06 0.000152 Knstrn 855.1 1.03 1.06 5.4E−14 8.61E−12 Phf19 475.4 1.03 1.08 7.44E−11 7.92E−09 Art2a-ps 407.6 1.03 1.17 4.28E−05 0.001207 Rfc4 533.3 1.02 1.04 0 0 Tnfsf11 468.5 1.02 1.11 4.92E−07 2.61E−05 Fn1 453.7 1.02 1.33 0.001188 0.01738 Gna14 24.8 1.02 1.42 0.002372 0.028943 Bard1 316.8 1.01 1.07 2.26E−09 1.9E−07 Pole 1124.1 1.01 1.07 2.85E−08 2.01E−06 Pdcd1 880.8 1.01 1.08 6.75E−08 4.53E−06 Prc1 830.9 1.01 1.1 1.43E−06 6.68E−05 Art2b 542.6 1.01 1.19 0.000104 0.002467 Mcm8 150.3 1 1.09 8.42E−07 4.25E−05 Xaf1 1257.6 1 1.1 1.6E−06 7.42E−05 Tnfrsf8 167.1 1 1.1 4.36E−06 0.000173 Apitd1 305.6 1 1.14 2.51E−05 0.000779 Gstt3 58.6 1 1.15 5.96E−05 0.001564 Hist1h1b 56.5 1 1.32 0.001234 0.01782 Cfap77 26 1 1.31 0.001439 0.019968 Myo1d 68 1 1.42 0.002852 0.032892 4930438A08Rik 145.8 −1.01 −1.17 0.000312 0.006134 Gm7860 120.6 −1.02 −1.09 1.76E−07 1.08E−05 Gm38405 61.2 −1.03 −1.22 0.000285 0.005674 Gm5608 44.9 −1.03 −1.27 0.000717 0.011861 Fjx1 45.8 −1.03 −1.38 0.002866 0.033002 Gm37510 31.1 −1.03 −1.48 0.004083 0.042776 9230114K14Rik 64.2 −1.04 −1.19 6.16E−05 0.001606 Cd164l2 60 −1.04 −1.24 0.000281 0.005618 Podn 23.2 −1.04 −1.32 0.001135 0.016833 Mfrp 55.6 −1.04 −1.33 0.0016 0.021746 Timm8a2 27.2 −1.05 −1.28 0.000484 0.00875 Gm11210 24.9 −1.06 −1.38 0.000895 0.014062 Trim72 99 −1.08 −1.33 0.000468 0.008514 Rbm44 28.3 −1.09 −1.5 0.001468 0.020306 Pygm 1170.9 −1.12 −1.19 1.17E−10 1.2E−08 Prr15 32.2 −1.12 −1.31 5.32E−05 0.001422 Prdm14 18.6 −1.13 −1.53 0.001494 0.020587 Tm4sf1 20.6 −1.14 −1.56 0.001205 0.017549 Rpl31-ps6 17.6 −1.15 −1.6 0.000885 0.013952 Six4 17.7 −1.17 −1.57 0.000705 0.011726 Tex45 736.4 −1.19 −1.29 6.92E−09 5.36E−07 Apol8 1161.9 −1.2 −1.25 3E−15 4.88E−13 AC158622.5 86.8 −1.23 −1.44 9.3E−06 0.00033 Fgf17 23 −1.27 −1.72 0.000249 0.005119 AC166361.2 101 −1.3 −1.42 2.71E−09 2.24E−07 Gsdmc4 19.2 −1.33 −1.63 1.68E−05 0.00055 Ap3s1-ps2 15.1 −1.34 −1.96 0.000176 0.003785 Pmel 62.3 −1.73 −4.35 1.15E−06 5.52E−05
[0457] NIH DAVID cluster analysis was performed using the upregulated gene list. Enriched clusters were ranked based on enrichment score. Cell cycle gene cluster achieved the highest enrichment score (
TABLE-US-00040 TABLE 2 The upregulated cell movement pathway for SV vs. untreated group by IPA. SV induced SD upregulated gene sets are clustered by DAVID analysis (SV vs. Untreated). Gene clusters are ranked by enrichment score. Prediction (based on Genes in measurement Expr Log ID dataset direction) Ratio Findings Il21 IL21 Increased 2.57 Increases (2) Lag3 LAG3 Decreased 1.76 Decreases (3) Il10 IL10 Decreased 1.66 Decreases (2) Ccl1 CCL1 Increased 1.12 Increases (1) Ccr5 CCR5 Increased 1.05 Increases (3) Pdcd1 PDCD1 Decreased 1.01 Decreases (3) Tnfrsf8 TNFRSF8 Increased 1 Increases (1) Cxcr5 CXCR5 Increased 0.98 Increases (1) Ccr2 CCR2 Increased 0.9 Increases (9) Cxcr3 CXCR3 Increased 0.77 Increases (1) Sh2d1a SH2D1A Increased 0.68 Increases (1) Batf BATF Increased 0.67 Increases (7) Pycard PYCARD Increased 0.64 Increases (3) Ccr4 CCR4 Increased 0.62 Increases (4) Ccl5 CCL5 Increased 0.62 Increases (2) Itgb1 ITGB1 Increased 0.51 Increases (1) S1pr2 S1PR2 Increased 0.5 Increases (1) Lcp1 LCP1 Affected 0.5 Affects (1) Tnfsf14 TNFSF14 Increased 0.5 Increases (1) Hspd1 HSPD1 Decreased 0.41 Decreases (1) Cbfb CBFB Decreased 0.4 Decreases (1) Jak3 JAK3 Increased 0.36 Increases (1) Rap1a RAP1A Decreased 0.31 Decreases (3) Was WAS Increased 0.29 Increases (2) Etv6 ETV6 Increased 0.26 Increases (3) Rac2 RAC2 Increased 0.25 Increases (36) Apbb1ip APBB1IP Increased −0.21 Decreases (2) Pecam1 PECAM1 Decreased −0.34 Increases (10) Ldlr LDLR Decreased −0.41 Increases (1) Bach2 BACH2 Increased −0.46 Decreases (1) S1pr1 S1PR1 Decreased −0.58 Increases (6) Gpr132 GPR132 Increased −0.6 Decreases (1)
[0458] To understand why SV plus α4-1BB mAb achieves the best therapeutic effect, Deseq2 analysis was run for SV plus α4-1BB mAb vs. untreated samples. 1046 upregulated genes (q<0.05 and Log 2 Fold Change≥1) and 877 downregulated genes (q<0.05 and Log 2 Fold Change≤−1) in the SV plus α4-1BB mAb group were identified (
TABLE-US-00041 TABLE 3 The SD expressed genes list for SV + α4-1BB vs. untreated group by RNA- Seq (q < 0.05, Log2FC ≥ 1 and Log2FC ≤ −1). gene baseMean log2FC log2FCunshrunk pvalue padj Gzmk 1785.2 4.75 5.32 0 0 Gzmb 4113.9 4.37 4.81 0 0 Ccl8 29.5 3.64 8.24 0 0 Ociad2 184.7 3.53 3.76 0 0 Aurkb 806.6 3.51 3.73 0 0 Ret 794.7 3.51 4.41 0 0 E2f8 535.1 3.5 3.88 0 0 Tpx2 1113.7 3.34 3.58 0 0 Kif2c 341.3 3.33 3.58 0 0 Kif18b 606.6 3.29 3.51 0 0 Hmmr 311.7 3.26 3.61 0 0 Cdc25c 143.9 3.25 3.81 0 0 Pbk 107.5 3.24 3.63 0 0 Cenpf 495.6 3.23 3.46 0 0 Prr11 288 3.23 3.68 0 0 Ccna2 1680.2 3.18 3.34 0 0 Ccnb2 1255.4 3.16 3.38 0 0 Bub1 362.3 3.16 3.44 0 0 Pif1 204 3.16 3.57 0 0 Klrg1 746.6 3.15 3.34 0 0 Nusap1 813.1 3.14 3.31 0 0 Bub1b 1344.3 3.13 3.32 0 0 Rad54l 350.2 3.13 3.43 0 0 Cdk1 1228.8 3.11 3.32 0 0 Mki67 5899.1 3.11 3.36 0 0 Rad51 401.4 3.08 3.34 0 0 Ttk 211.5 3.08 3.4 0 0 Nuf2 279.6 3.08 3.46 0 0 Fignl1 145.7 3.07 3.37 0 0 Shcbp1 274.8 3.05 3.26 0 0 Cdkn3 129.2 3.05 3.35 0 0 Rrm2 1718.2 3.04 3.26 0 0 Ube2c 1391 3.03 3.35 0 0 Pclaf 522.9 3.03 3.36 0 0 Lrr1 59 3.03 3.74 0 0 Cdca8 1251.5 3.02 3.21 0 0 Cep55 503.9 3.02 3.24 0 0 Mem10 477.4 3.01 3.22 0 0 Sapcd2 275.5 2.99 3.28 0 0 Pimreg 230 2.99 3.3 0 0 Kif4 650.2 2.97 3.13 0 0 Kntc1 402.4 2.96 3.25 0 0 Ccr5 1338.8 2.95 3.07 0 0 Kif14 299.1 2.94 3.2 0 0 Sgo1 162.8 2.94 3.21 0 0 Spc24 506 2.93 3.08 0 0 Espl1 809.6 2.93 3.12 0 0 Clspn 637.1 2.93 3.14 0 0 Wdr95 226 2.88 3.09 0 0 Nek2 554.5 2.88 3.13 0 0 Ccnb1 160.8 2.88 3.25 0 0 Ncapg 383.1 2.86 3.09 0 0 Top2a 4726.3 2.85 2.96 0 0 Ncaph 822.4 2.85 3 0 0 Kif20a 898.5 2.85 3.03 0 0 Diaph3 356.3 2.85 3.04 0 0 Akr1c18 25.3 2.85 4.88 6E−15 1.84E−13 Ckap2l 455.4 2.83 3.1 0 0 Oip5 50.6 2.83 3.55 0 0 Ermn 17.7 2.82 5.41 3.2E−14 8.82E−13 Spag5 1183.2 2.81 2.97 0 0 Birc5 1540.7 2.81 3.13 0 0 Dpysl5 94.9 2.78 3.57 0 0 Cdca5 791.4 2.77 2.88 0 0 Iqgap3 284.2 2.77 2.98 0 0 Kif15 595.3 2.76 2.95 0 0 Plk1 794.8 2.75 2.94 0 0 Troap 236.4 2.75 3.04 0 0 Cenpe 685.5 2.73 2.91 0 0 Esco2 149.5 2.73 3.04 0 0 Gng3 34.8 2.72 3.74 0 1E−15 Cit 784.3 2.71 2.9 0 0 Kif22 1022.2 2.71 2.91 0 0 Car5b 136 2.71 2.94 0 0 Ncald 297.2 2.71 2.95 0 0 Cdca2 444.5 2.7 2.87 0 0 Knl1 203.3 2.7 3.01 0 0 Hist1h1b 56.5 2.7 3.28 0 0 Aunip 24.6 2.69 4.29 1.5E−14 4.26E−13 1500009L16Rik 143.2 2.68 3.37 0 0 Osr2 54.7 2.68 4.06 8E−15 2.43E−13 Depdc1b 350.8 2.67 2.86 0 0 Ticrr 558.4 2.67 2.87 0 0 Melk 329.8 2.66 2.82 0 0 Tpsab1 262.4 2.66 3.16 0 0 Smpdl3b 185.8 2.65 2.9 0 0 Spc25 211.3 2.65 2.95 0 0 Cdc45 628.7 2.64 2.73 0 0 Ccr2 1142.1 2.64 2.83 0 0 Il21 229 2.64 3.76 3.3E−14 9.01E−13 BC030867 129.6 2.63 2.93 0 0 Uhrfl 1603.6 2.61 2.76 0 0 Mxd3 280.1 2.61 2.76 0 0 Tyms 809.6 2.6 2.7 0 0 Neil3 228.1 2.6 2.82 0 0 Trip13 233.7 2.59 2.78 0 0 Rad51ap1 205.6 2.58 2.78 0 0 Asf1b 1276.4 2.57 2.69 0 0 Kif11 1109.9 2.55 2.67 0 0 Ska1 210.9 2.55 2.86 0 0 Stmn1 257.1 2.53 2.71 0 0 Ccl5 22142.8 2.53 2.75 0 0 Ly6a 2208.2 2.53 3.76 5.03E−13 1.2E−11 Igf2bp3 26.6 2.52 3.61 1.47E−13 3.72E−12 Aspm 319.4 2.51 2.77 0 0 Parpbp 117.3 2.51 2.86 0 0 Ect2 255.1 2.49 2.82 0 0 Cdca3 1038.6 2.48 2.6 0 0 E2f7 275.3 2.48 2.74 0 0 Depdc1a 29.6 2.48 3.46 2E−15 7.6E−14 Gm33460 48.9 2.47 2.96 0 0 Tex15 58.4 2.47 3 0 0 Tk1 1004.9 2.46 2.59 0 0 Lag3 2916.7 2.45 2.56 0 0 Spdl1 204.5 2.45 2.61 0 0 Gm15056 28.9 2.45 4.48 4.74E−11 8.5E−10 Ckap2 394.5 2.44 2.55 0 0 Ankle1 238.9 2.44 2.71 0 0 Mt3 18.3 2.42 4.28 3.9E−11 7.15E−10 Cenph 201.9 2.41 2.66 0 0 Arsb 1795.9 2.4 2.55 0 0 Cenpi 136.8 2.4 2.6 0 0 Gm6637 196.3 2.4 2.69 0 0 Ndc80 345.5 2.39 2.53 0 0 Chaf1a 1027.2 2.39 2.53 0 0 Cenpm 289.6 2.39 2.61 0 0 CT030166.6 24.2 2.37 3.39 1.66E−12 3.74E−11 Ms4a3 31.1 2.37 4.07 2E−10 3.29E−09 Il13 60.8 2.36 3.42 3.84E−11 7.06E−10 Ctsg 151.2 2.36 3.9 2.01E−10 3.3E−09 Col6a5 17.7 2.36 6.13 4.48E−10 6.83E−09 Ncapd2 3741.3 2.33 2.39 0 0 Tcf19 1158.6 2.32 2.41 0 0 Gbp11 355.1 2.31 2.46 0 0 Fhl2 217.6 2.3 2.44 0 0 Ncapg2 526.2 2.29 2.43 0 0 Cks1b 772.5 2.28 2.46 0 0 Gzma 3261.2 2.28 3.76 8.07E−10 1.18E−08 Nkg7 8456.1 2.27 2.34 0 0 Pask 202.9 2.27 2.43 0 0 Il10 1005.5 2.27 2.5 0 0 Prc1 830.9 2.26 2.46 0 0 Wipf3 37.6 2.26 3.33 3.67E−12 7.88E−11 Mpo 1003.3 2.26 3.54 7.46E−10 1.09E−08 Osbpl3 1358.5 2.25 2.33 0 0 Mastl 108.5 2.25 2.54 0 0 Serpinb6b 1199 2.24 2.38 0 0 Adgrg1 449.6 2.24 2.4 0 0 Slc16a2 105.6 2.24 2.53 0 0 Cel1 31 2.24 3.2 7.42E−11 1.29E−09 Cdc6 570.6 2.22 2.34 0 0 Bspry 174.2 2.22 2.64 1E−15 3.6E−14 Ccne1 503.1 2.21 2.36 0 0 Cenpp 81.2 2.21 2.47 0 0 Lxn 79 2.21 2.45 0 0 Lgals1 11014.9 2.2 2.34 0 0 Adap1 1257.2 2.18 2.3 0 0 F13a1 227.4 2.17 3.04 1.97E−10 3.24E−09 Cdc20 1268.9 2.16 2.24 0 0 Tigit 2942.9 2.16 2.38 0 0 Cdkn2a 59.4 2.15 2.56 3.4E−14 9.34E−13 Exo1 187.1 2.14 2.4 0 0 Clip4 39.8 2.14 2.75 7.69E−12 1.58E−10 F2rl2 42.8 2.13 2.58 1.57E−13 3.95E−12 Hist1h2bj 17.7 2.13 2.99 4.05E−10 6.22E−09 Gldc 15.3 2.13 3.09 1.37E−09 1.92E−08 Dhfr 503.3 2.12 2.24 0 0 Lig1 3384.1 2.11 2.19 0 0 Cenpn 307 2.11 2.23 0 0 Tox2 889.5 2.11 2.32 0 0 Cdkn2c 421.3 2.1 2.2 0 0 Kifc1 310.5 2.1 2.26 0 0 Slc22a3 85.3 2.1 2.57 1.47E−12 3.33E−11 Msr1 48.9 2.1 2.73 1.56E−11 3.04E−10 Trp73 22 2.1 3.54 2.07E−08 2.37E−07 Prtn3 290.9 2.1 3.62 2.37E−08 2.68E−07 Csf2 72.9 2.09 2.47 8E−14 2.1E−12 Fancd2 392.9 2.08 2.16 0 0 Gm2788 29.7 2.08 2.77 5.16E−11 9.2E−10 Nfe2 91.3 2.08 2.85 9.6E−10 1.38E−08 Rnase2a 5.3 2.08 6.48 1.58E−08 1.84E−07 Mis18bp1 180.6 2.07 2.26 0 0 Samd14 203.2 2.07 2.39 3E−15 8.5E−14 Oas1a 498.3 2.07 2.42 4E−15 1.1E−13 Hist1h3c 11.8 2.07 3.72 2.61E−08 2.93E−07 Tacc3 1922.3 2.06 2.12 0 0 Wdr31 15.1 2.06 3.44 1.23E−08 1.46E−07 Knstrn 855.1 2.05 2.12 0 0 Anxa2 5777.8 2.05 2.21 0 0 Tpbg 19.3 2.04 3.63 2.53E−08 2.85E−07 Cst7 1893.9 2.02 2.09 0 0 Slc43a3 380.4 2.02 2.16 0 0 Muc13 227 2.02 2.24 0 0 Rad51b 65.9 2.02 2.3 0 5E−15 Xkr5 39.4 2.02 2.42 2.9E−13 7.07E−12 Chil3 42.4 2.02 3.21 4.25E−08 4.61E−07 Bard1 316.8 2.01 2.11 0 0 Acot7 2318.6 2.01 2.12 0 0 Arhgap11a 847.4 2.01 2.13 0 0 Rad54b 114.1 2.01 2.21 0 0 Pcdhgc4 19.5 2.01 2.97 5.51E−09 6.96E−08 Mcm5 5776.8 2 2.06 0 0 Rmi2 184.3 2 2.12 0 0 Dna2 343.7 2 2.16 0 0 S100a6 3227.2 2 2.17 0 0 Mybl2 481.2 2 2.19 0 0 Brca1 443.2 1.99 2.11 0 0 Esm1 680.1 1.99 2.16 0 0 E2fl 876.4 1.98 2.04 0 0 F10 33.6 1.98 3.1 4.08E−08 4.44E−07 Lif 439.6 1.97 2.05 0 0 Pglyrp1 1046.5 1.97 2.15 0 0 Fam19a3 168.7 1.97 2.22 1E−15 1.9E−14 Spp1 51 1.97 2.41 2.47E−11 4.68E−10 Faxc 12.4 1.97 3.44 1.3E−07 1.3E−06 Stil 422.9 1.96 2.17 0 0 Dapk2 315.5 1.95 2.04 0 0 Serpinb9 1224.7 1.95 2.06 0 0 Fanca 375.8 1.95 2.06 0 0 Bcat1 363.8 1.95 2.06 0 0 Neurl1b 49.9 1.95 2.46 2.74E−10 4.38E−09 Gins1 191.5 1.94 2.14 0 0 Tg 98.4 1.94 2.15 0 1E−15 Dnph1 136.4 1.94 2.27 5.77E−13 1.36E−11 Tmem40 47.5 1.94 2.52 2.2E−09 2.98E−08 Hist1h3g 9.3 1.94 3.19 1.43E−07 1.41E−06 Ighg1 2604.8 1.94 4.76 2.48E−07 2.33E−06 Psrc1 122.1 1.93 2.07 0 0 Serpina3f 452 1.93 2.12 0 0 Robo3 27.3 1.93 2.44 7.7E−10 1.13E−08 Gcg 62.2 1.93 5.91 2.19E−07 2.08E−06 Smc2 1176.2 1.92 2.03 0 0 Sgo2a 143.4 1.92 2.11 0 0 Nt5dc2 188.1 1.92 2.15 0 5E−15 Klrc2 53.2 1.92 2.27 5.7E−13 1.35E−11 Prss57 9.8 1.92 3.88 2.9E−07 2.7E−06 Gpsm2 436.7 1.91 2.02 0 0 Nsl1 195.3 1.9 2.03 0 0 C3 1368.2 1.9 2.15 6E−15 1.81E−13 Angpt1 63.2 1.9 2.28 1.89E−11 3.65E−10 Popdc2 54.7 1.89 2.36 3.65E−10 5.66E−09 Kbtbd6 12 1.89 3.03 1.35E−07 1.34E−06 Stk32c 341 1.87 1.99 0 0 Syce2 175.1 1.87 2.03 0 0 Gp9 24.8 1.87 2.53 3.19E−08 3.56E−07 Poc1a 388.3 1.86 1.95 0 0 2610318N02Rik 193.2 1.86 2.02 0 0 Ifng 1413.7 1.86 2.11 5.7E−14 1.51E−12 Hcn2 36.3 1.86 2.42 6.4E−09 7.97E−08 Klhl23 20.6 1.86 3.13 1.4E−07 1.38E−06 Nrg1 17.4 1.86 3 3.31E−07 3.06E−06 Insrr 64.7 1.85 2.05 3E−15 1.03E−13 Cldnd2 53.5 1.85 2.12 3.45E−13 8.31E−12 Ifit1bl1 137.8 1.85 2.34 1.18E−09 1.67E−08 Scn11a 5.9 1.85 5.36 7.48E−07 6.42E−06 Pdzph1 10.7 1.85 4.11 9.95E−07 8.34E−06 Gins2 413.5 1.84 1.94 0 0 Gm12250 177.3 1.84 2.07 6E−15 1.73E−13 Dach1 18.3 1.84 2.8 3.05E−07 2.83E−06 Rasgef1a 270.7 1.83 1.94 0 0 Pcyt1b 106.8 1.83 2.01 0 0 Oas3 1474.3 1.83 2.25 3.83E−10 5.9E−09 Cd70 12.5 1.83 2.73 3.29E−07 3.05E−06 Tuba8 42.2 1.83 2.76 4.67E−07 4.21E−06 Tph1 43 1.83 3.53 1.35E−06 1.11E−05 Zbtb32 667.1 1.82 1.9 0 0 Tfr2 139.5 1.82 2.41 2.31E−08 2.62E−07 Mmrn1 13.3 1.82 2.99 7.75E−07 6.64E−06 Gm24289 6.9 1.82 5.21 1.22E−06 1.01E−05 Dlgap5 705.3 1.81 1.9 0 0 Ska3 252.1 1.81 1.91 0 0 Fam81a 55.4 1.81 2.16 1.92E−10 3.16E−09 Plppr3 42.4 1.81 2.74 7.18E−07 6.2E−06 Mpl 45.7 1.81 2.69 7.96E−07 6.8E−06 Hist1h2ag 6.4 1.81 3.59 1.52E−06 1.23E−05 Fbxo41 15.3 1.8 2.59 1.51E−07 1.48E−06 Mcm3 5809.4 1.79 1.84 0 0 Ska2 254.2 1.79 1.91 0 0 Art2b 542.6 1.79 2.08 6.27E−12 1.3E−10 Necab3 27.4 1.79 2.36 1.87E−08 2.16E−07 Lilr4b 1553.9 1.78 1.91 0 0 AA467197 30.3 1.78 2.21 9E−09 1.09E−07 Maats1 7.8 1.78 3.55 2.36E−06 1.84E−05 Col6a2 16.9 1.78 3.82 2.57E−06 1.99E−05 Cdca7 631.9 1.77 1.89 0 0 Serpina3g 2916.5 1.77 1.92 0 0 Dyrk3 249.1 1.77 1.95 2E−15 5.8E−14 Apitd1 305.6 1.77 1.98 9.1E−14 2.37E−12 AC153938.2 40.5 1.77 2.19 2.58E−09 3.47E−08 Eomes 4109.7 1.75 1.8 0 0 Pola1 686.1 1.75 1.83 0 0 Pole 1124.1 1.75 1.86 0 0 Eme1 219.4 1.75 1.88 0 0 Map6 151 1.75 1.88 0 0 Gm4951 44.3 1.75 2.24 1.88E−09 2.57E−08 Tff3 16.7 1.75 2.36 1.47E−07 1.45E−06 Nmral1 561.7 1.74 1.86 0 0 Plac8 2583 1.74 1.92 2E−15 6.3E−14 Klrc1 236.6 1.74 1.95 5E−14 1.34E−12 S100a4 1170.3 1.74 1.96 7.04E−13 1.66E−11 Mns1 129.3 1.74 2.05 2.42E−10 3.91E−09 Miat 31.2 1.74 2.07 5.13E−10 7.74E−09 Efcab11 31.5 1.74 2.33 6.62E−08 6.98E−07 Erfe 15.4 1.74 2.77 9.89E−07 8.3E−06 Kcnk5 399.5 1.73 1.81 0 0 Stx11 1153.5 1.73 1.81 0 0 Smtn 271.7 1.73 1.87 0 0 Anln 217.2 1.73 1.89 1E−15 3.1E−14 Gm17745 84 1.73 1.92 1.9E−14 5.44E−13 Krt18 26.4 1.73 2.17 1.75E−08 2.03E−07 2900011O08Rik 14.8 1.73 2.39 9.4E−07 7.92E−06 Tpi1 2445.6 1.72 1.78 0 0 Chsy1 2251.6 1.72 1.8 0 0 Gtse1 554 1.72 1.81 0 0 Pdcd1 880.8 1.72 1.84 0 0 Vdr 250.7 1.72 1.97 2.66E−11 5E−10 Ltb4r1 44.5 1.72 2.06 1.19E−09 1.68E−08 2010110K18Rik 30.1 1.72 2.11 9.25E−09 1.12E−07 Alox5 104.2 1.72 2.35 2.33E−07 2.2E−06 Pde10a 17 1.72 2.48 7.24E−07 6.24E−06 Dscc1 150.3 1.71 1.83 0 0 Mcm6 5226.1 1.7 1.74 0 0 Tfdp1 1161.4 1.7 1.76 0 0 E2f2 2088.1 1.7 1.78 0 0 1700011L03Rik 6.7 1.7 5.77 5.28E−06 3.81E−05 Col6a1 15.6 1.7 4.62 6.57E−06 4.64E−05 Chst11 1091.1 1.69 1.75 0 0 Il12rb1 1086.8 1.69 1.76 0 0 Gm4841 29.9 1.69 2.35 3.46E−07 3.19E−06 Treml1 31.4 1.69 2.36 1.75E−06 1.4E−05 Fcer1a 69.7 1.69 2.77 3.83E−06 2.85E−05 Rfc4 533.3 1.68 1.72 0 0 Rgs16 7742.7 1.68 1.75 0 0 Ezh2 1820.5 1.68 1.76 0 0 Lockd 222.2 1.68 1.85 3.1E−14 8.5E−13 Fam57b 23.3 1.68 5.08 4.18E−07 3.8E−06 Dixdc1 18.6 1.68 2.66 2.93E−06 2.25E−05 Trpc6 7.4 1.68 4.05 5.76E−06 4.12E−05 Adra1b 14.9 1.68 2.83 6.8E−06 4.78E−05 Ttc39c 656.7 1.67 1.72 0 0 Wee1 206.8 1.67 1.75 0 0 Neb 354.6 1.67 1.9 2.03E−11 3.9E−10 Prdm1 912.1 1.66 1.74 0 0 Gimap7 2437.5 1.66 1.76 0 0 Mcm8 150.3 1.66 1.79 0 4E−15 Tnfrsf8 167.1 1.66 1.82 1E−14 3.02E−13 Lgalsl 189.5 1.66 1.82 2.5E−14 7.06E−13 Ptgr1 201.9 1.66 1.84 1.25E−13 3.19E−12 Fads2 70.5 1.66 2.07 1.89E−08 2.18E−07 Usp18 491.6 1.66 2.34 1.26E−06 1.03E−05 Serpinb9b 63.4 1.66 2.45 1.55E−06 1.26E−05 Vwa2 4.2 1.66 5.89 3.9E−06 2.9E−05 Saa3 14.8 1.66 4.96 6.94E−06 4.87E−05 Mad2l1 857.6 1.65 1.69 0 0 Hells 609.3 1.65 1.71 0 0 Cisd1 468.5 1.65 1.73 0 0 Slc35d3 110.5 1.65 1.77 0 5E−15 Sncb 15 1.65 2.65 2.82E−06 2.17E−05 Ppbp 30.6 1.65 2.38 3.36E−06 2.54E−05 Tff1 8.6 1.65 3.22 1.24E−05 8.24E−05 Nsd2 2242.8 1.64 1.68 0 0 Phf19 475.4 1.64 1.71 0 0 Ccdc34 308.1 1.64 1.73 0 0 1700001O22Rik 140.3 1.64 1.78 4E−15 1.36E−13 Gm20667 5.2 1.64 4.98 1.13E−05 7.61E−05 Ppp1r3g 7.3 1.64 3.91 1.3E−05 8.58E−05 4930519L02Rik 9.9 1.64 4.33 1.41E−05 9.23E−05 Racgap1 3392.2 1.63 1.67 0 0 Lmnb1 6788.3 1.63 1.69 0 0 Kif23 1414.3 1.63 1.69 0 0 Ryk 207.2 1.63 1.76 1E−15 2.6E−14 Heatr9 204.6 1.63 1.85 1.58E−11 3.07E−10 Ifi27l2a 8730.4 1.63 1.99 2.36E−08 2.67E−07 Tnip3 36.1 1.63 2.1 2.07E−07 1.97E−06 Vat1l 14.9 1.62 3.1 9.48E−06 6.47E−05 Tpsb2 486.9 1.62 2.93 2.12E−05 0.000133 AW112010 5981.3 1.61 1.69 0 0 9630013D21Rik 122.8 1.61 1.8 4.6E−12 9.71E−11 Mtfp1 42.1 1.61 1.98 4.08E−08 4.44E−07 Col1a2 95 1.61 2.11 6.19E−07 5.41E−06 Ascl2 24.4 1.61 2.62 1.12E−05 7.53E−05 Ccdc18 45.6 1.6 1.91 1.15E−08 1.37E−07 Myct1 34.7 1.6 2.16 1.88E−06 1.49E−05 Hist1h2bm 8.5 1.6 3.51 2.45E−05 0.000151 Elane 132 1.6 3.14 2.69E−05 0.000165 Serping1 49.6 1.59 1.9 6.03E−09 7.54E−08 Rab44 136.4 1.59 2.08 8.37E−07 7.11E−06 Dcn 49 1.59 2.48 3.24E−06 2.45E−05 6530402F18Rik 553.7 1.58 1.63 0 0 Klrk1 793.9 1.58 1.68 0 0 Nup37 207.1 1.58 1.74 3.05E−13 7.43E−12 Bst1 74.2 1.58 1.75 1.64E−12 3.71E−11 Il1rl1 328.6 1.58 1.74 1.73E−12 3.88E−11 Klrc3 41.9 1.58 1.99 7.66E−08 7.98E−07 Adgrg7 5.3 1.58 5.46 9.43E−06 6.44E−05 Gp1bb 21.6 1.58 2.44 2.04E−05 0.000128 Sh2d1a 1356.7 1.57 1.64 0 0 Areg 192.8 1.57 1.78 1.04E−10 1.78E−09 Mlkl 114.8 1.57 1.78 1.33E−10 2.24E−09 D630039A03Rik 66.5 1.57 1.86 1.8E−08 2.09E−07 Sdsl 60 1.57 2.27 7.96E−06 5.53E−05 Oas2 1573.5 1.57 2.38 8.81E−06 6.05E−05 Tjp2 411.7 1.56 1.67 1E−15 3E−14 Fut7 69.8 1.56 1.8 1.61E−09 2.23E−08 Ces2g 190 1.56 2.29 8.88E−06 6.1E−05 Tmem59l 15.2 1.56 2.3 1.24E−05 8.24E−05 Kcnj5 5.3 1.56 5.41 1.25E−05 8.31E−05 Maob 9.3 1.56 3.57 3.89E−05 0.000229 Dut 2331.7 1.55 1.6 0 0 4933404O12Rik 326.5 1.55 1.66 0 1.4E−14 Alox8 57.9 1.55 1.79 1.05E−09 1.5E−08 Runx2os1 41.2 1.55 2.01 1.56E−06 1.26E−05 Etv4 18.3 1.55 2.25 1.04E−05 7E−05 Ccnf 676.9 1.54 1.62 0 0 Spns2 183.2 1.54 1.86 1.1E−07 1.11E−06 H1fx 65.9 1.54 1.97 1.34E−06 1.1E−05 Chtf18 707.9 1.53 1.58 0 0 Gbp2b 1682.8 1.53 1.59 0 0 Cmtm7 2372.8 1.53 1.59 0 0 Gstt3 58.6 1.53 1.73 3.64E−10 5.65E−09 Chek2 113.8 1.53 1.77 3.66E−09 4.79E−08 Rab39b 35.1 1.53 1.86 7.94E−08 8.25E−07 Vash1 14.6 1.53 2.36 2.63E−05 0.000162 Incenp 3803.5 1.52 1.56 0 0 Zwilch 309.4 1.52 1.59 0 0 Brip1 231.5 1.52 1.6 0 0 Gm14005 181.4 1.52 1.61 0 2E−15 Foxm1 1814.7 1.52 1.62 0 5E−15 1700020L24Rik 90.2 1.52 1.72 8.22E−10 1.2E−08 Il4 152.5 1.52 1.8 3.53E−08 3.9E−07 Mx1 719.3 1.52 2.3 2.01E−05 0.000127 Gna15 580.1 1.51 1.6 0 1E−15 Dctpp1 771.7 1.51 1.64 2.43E−13 5.96E−12 Angptl2 741.2 1.51 1.67 1.1E−11 2.2E−10 Mgarp 30.5 1.51 1.87 4.92E−07 4.41E−06 Gm19585 364.2 1.5 1.56 0 0 Zfp367 650.8 1.5 1.58 0 0 S100a10 7676.1 1.5 1.58 0 0 C330027C09Rik 421.9 1.5 1.63 1.44E−13 3.66E−12 Cenpk 43.5 1.5 1.73 9.19E−09 1.11E−07 Ly6e 13759 1.5 1.83 2.5E−07 2.35E−06 Ccl4 2257.9 1.5 1.9 1.59E−06 1.28E−05 Casp7 625.6 1.49 1.53 0 0 Zfand4 84.9 1.49 1.61 1.84E−13 4.58E−12 Tstd3 269.1 1.49 1.65 1.75E−11 3.39E−10 Lmtk3 107.1 1.49 1.75 4.88E−08 5.24E−07 AC153498.1 62.1 1.49 1.77 7.06E−08 7.4E−07 Grtp1 36.2 1.49 1.96 3.97E−06 2.94E−05 Gm2762 38.5 1.49 2.09 6.91E−06 4.85E−05 D130058E05Rik 5.1 1.49 5.39 2.27E−05 0.000142 Npy 11.8 1.49 2.45 6.48E−05 0.00036 Serpina3h 8.8 1.49 2.77 7.52E−05 0.000411 Ighg2c 873 1.49 3.73 7.66E−05 0.000418 Nkain1 8 1.49 3.23 7.74E−05 0.000421 Podnl1 2382.6 1.48 1.53 0 0 Gzmm 496.8 1.48 1.56 0 0 Haspin 214.2 1.48 1.6 1.76E−13 4.4E−12 Csfl 1178.9 1.48 1.64 5.94E−11 1.05E−09 Lamc2 28.8 1.48 1.89 2.97E−06 2.28E−05 Gm11454 22.4 1.48 1.93 3.25E−06 2.46E−05 Tal1 90.9 1.48 2.14 2.23E−05 0.000139 Ybx3 2394.9 1.47 1.56 0 0 Rln3 181.3 1.47 1.61 1.29E−11 2.56E−10 Rai14 77.8 1.47 1.68 9.24E−09 1.11E−07 Gmpr 24.8 1.47 2.3 5.94E−05 0.000334 Drp2 31.1 1.47 2.94 9.79E−05 0.000518 Cma1 339 1.47 2.71 0.00011 0.000572 Gbp5 1110.5 1.46 1.49 0 0 Alad 1397.6 1.46 1.63 2.48E−10 4E−09 Tnfsf4 81.6 1.46 1.73 2.63E−07 2.47E−06 Rtkn2 30.4 1.46 1.85 1.64E−06 1.32E−05 Klra7 38.4 1.46 2.03 1.43E−05 9.35E−05 Pf4 162.2 1.46 2.25 9.08E−05 0.000485 Gbp2 3001.3 1.45 1.5 0 0 Ercc6l 189.4 1.45 1.55 2.2E−14 6.19E−13 Iigp1 872.5 1.45 1.55 2.8E−14 7.75E−13 Gemin6 89.9 1.45 1.55 8.5E−14 2.2E−12 Paqr4 188.3 1.45 1.58 4.17E−12 8.88E−11 Cd160 483.3 1.45 1.63 1.06E−09 1.51E−08 Ttc16 66.2 1.45 1.72 1.54E−07 1.51E−06 Ulk4 24.5 1.45 1.83 2.23E−06 1.75E−05 Ccnb1ip1 40.8 1.45 1.87 6.02E−06 4.29E−05 Tubb1 17.5 1.45 2.25 5.51E−05 0.000312 Vax2 12.7 1.45 2.38 0.000106 0.000558 Slc16a11 9.1 1.45 2.57 0.000108 0.000563 Col3a1 82.1 1.45 2.78 0.000124 0.000638 Sdf2l1 994.9 1.44 1.51 0 0 Psmc3ip 149.8 1.44 1.53 1E−15 3.8E−14 Tmem107 70.8 1.44 1.63 4.82E−09 6.16E−08 Tmem121 19.5 1.44 2.22 6.17E−05 0.000344 Platr11 10.2 1.44 2.5 0.00012 0.000617 9230102O04Rik 5.8 1.44 3.53 0.000127 0.000649 Ms4a4b 9942.9 1.43 1.46 0 0 Gmnn 974.1 1.43 1.47 0 0 Bak1 2591.4 1.43 1.48 0 0 Casp3 2922.8 1.43 1.48 0 0 Sass6 197.1 1.43 1.51 0 4E−15 2310031A07Rik 64.6 1.43 1.81 4.21E−06 3.1E−05 Gda 44.3 1.43 2.06 3.9E−05 0.00023 Ckm 8 1.43 3.17 0.000143 0.000725 Mfsd13a 222.3 1.42 1.53 1.9E−13 4.74E−12 Gna14 24.8 1.42 1.92 1.63E−05 0.000106 Retnla 7.6 1.42 5.6 8.17E−05 0.000441 4930579G24Rik 292.8 1.41 1.44 0 0 Alcam 430 1.41 1.5 0 1.7E−14 Ak6 275.7 1.41 1.56 3.31E−10 5.2E−09 Ica1 85.1 1.41 1.64 1.66E−07 1.62E−06 Smo 59 1.41 1.66 3.83E−07 3.5E−06 A930002I21Rik 49.6 1.41 1.91 2.49E−05 0.000154 Col1a1 89.2 1.41 1.94 2.5E−05 0.000154 Cd34 96.8 1.41 2.01 5.84E−05 0.000329 Lhx2 15.9 1.41 2.11 6.05E−05 0.000339 Ptger3 20.8 1.41 2.29 0.000156 0.000779 Xdh 1588.9 1.4 1.45 0 0 Ttn 292.1 1.4 1.52 3.22E−11 5.97E−10 Asns 221.7 1.4 1.57 2.68E−09 3.59E−08 Cmc2 422.7 1.4 1.6 2.68E−08 3.01E−07 Cks2 105.1 1.4 1.64 3.29E−07 3.05E−06 Gzmc 56.6 1.4 1.74 4.29E−06 3.16E−05 Hist1h2bb 17.7 1.4 2 7.72E−05 0.00042 Epx 8 1.4 6.63 8.75E−05 0.00047 Gata2 341.6 1.4 2.14 0.000102 0.000536 Hp 143.1 1.4 2.47 0.000179 0.000879 Gm11843 7.5 1.4 4.37 0.000181 0.000888 Batf 1910.4 1.39 1.44 0 0 Hip1 1867.7 1.39 1.46 0 0 Havcr2 486.2 1.39 1.5 1.88E−12 4.18E−11 Acod1 232.1 1.39 1.69 1.35E−06 1.11E−05 Grb10 61 1.39 1.77 5.98E−06 4.26E−05 Reg2 5.6 1.39 5.03 7.66E−06 5.33E−05 N4bp1 3266.2 1.38 1.4 0 0 Prim1 1043.4 1.38 1.41 0 0 Mtfr2 115.7 1.38 1.47 2.56E−13 6.28E−12 Hmgb2 1572.1 1.38 1.49 1.93E−12 4.28E−11 Isg20 861.4 1.38 1.52 2.64E−10 4.24E−09 Cmpk2 311.4 1.38 1.66 1E−06 8.41E−06 Isg15 787.9 1.38 1.72 4.32E−06 3.17E−05 Il1rn 44.9 1.38 1.79 1.05E−05 7.06E−05 Fkbp1b 22.4 1.38 1.9 3.16E−05 0.00019 Nwd1 24.3 1.38 2.01 7.94E−05 0.000431 Tnp2 17.6 1.38 2.34 0.000128 0.000654 Ifit3 421.9 1.38 2.21 0.000147 0.00074 Hist1h2ai 9.8 1.38 2.17 0.000184 0.000901 Cdc20b 14.4 1.38 2.55 0.00019 0.000927 a 12.6 1.38 2.36 0.000204 0.000988 Tubb5 27245.9 1.37 1.4 0 0 Myo1f 6082 1.37 1.41 0 0 Cdc25b 5230.3 1.37 1.42 0 0 E2f3 421.5 1.37 1.42 0 0 Impa1 900.5 1.37 1.42 0 0 Kif24 76.5 1.37 1.56 2.19E−08 2.49E−07 Art2a-ps 407.6 1.37 1.56 4.59E−08 4.94E−07 Gp5 24.7 1.37 1.84 5.7E−05 0.000321 Dio2 18.9 1.37 2.13 0.000105 0.000551 Cdk6 2038 1.36 1.38 0 0 Ppil1 932 1.36 1.4 0 0 Shmt1 546.5 1.36 1.41 0 0 Plxdc1 231.9 1.36 1.46 6.89E−12 1.42E−10 Hopx 270.1 1.36 1.48 2.27E−11 4.33E−10 Serp2 160.9 1.36 1.5 5.14E−10 7.76E−09 Dusp14 437.4 1.36 1.5 1.35E−09 1.89E−08 Lgals7 154 1.36 1.59 1.04E−06 8.72E−06 Nqo1 35.8 1.36 1.7 5.6E−06 4.01E−05 Aldh1a1 40.1 1.36 1.98 0.000105 0.000552 Ifit1 298.3 1.36 2.02 0.000125 0.000642 Psat1 1715.9 1.35 1.37 0 0 Gins3 181.3 1.35 1.46 6.05E−11 1.07E−09 Slc16a3 161.5 1.35 1.49 3.5E−10 5.45E−09 Gbp10 432.2 1.35 1.51 4.13E−09 5.34E−08 Ube2l6 515.6 1.35 1.54 4.68E−08 5.03E−07 Slfn3 67.7 1.35 1.6 6.85E−07 5.93E−06 Nccrp1 65 1.35 1.64 4.48E−06 3.27E−05 Rgs8 18.7 1.35 1.85 9.21E−05 0.000492 Trim58 10.1 1.35 2.9 0.000362 0.001642 Cpa3 467.2 1.35 2.45 0.000376 0.001695 Fkbp5 2388.9 1.34 1.37 0 0 Tmpo 4623.5 1.34 1.39 0 0 Cxcr3 2032 1.34 1.39 0 0 Mrps25 464.1 1.34 1.41 0 7E−15 Zdhhc2 533.9 1.34 1.42 3E−15 8.8E−14 Slc25a13 161.1 1.34 1.42 1.21E−13 3.1E−12 Nudcd1 238.9 1.34 1.43 1.69E−13 4.24E−12 Phf11b 840.6 1.34 1.45 4.58E−12 9.71E−11 Galr3 5.7 1.34 4.53 0.000359 0.001631 Kctd17 526.7 1.33 1.39 0 0 Klre1 117.7 1.33 1.66 8.94E−06 6.13E−05 Gm14130 18.9 1.33 1.81 4.17E−05 0.000244 Myo1d 68 1.33 1.84 7.41E−05 0.000405 Ica1l 24.1 1.33 1.82 0.000114 0.00059 Coa6 201.6 1.32 1.4 5.2E−14 1.39E−12 Mettl7a1 240.2 1.32 1.42 4.43E−12 9.41E−11 Sytl3 850.3 1.32 1.44 5.64E−10 8.46E−09 Lrrc75a 59.6 1.32 1.6 5.23E−06 3.78E−05 Hspa1b 148.2 1.32 1.66 1.9E−05 0.000121 Serpina3i 24.8 1.32 2.37 0.000411 0.00183 Mmp8 16.8 1.32 2.57 0.000494 0.002149 Mcm2 4604.3 1.31 1.34 0 0 Wdr62 861.5 1.31 1.35 0 0 Cdk5r1 454.4 1.31 1.35 0 0 Cenpu 141.6 1.31 1.39 1.83E−13 4.57E−12 Myl6b 55.6 1.31 1.55 2.08E−06 1.64E−05 Nmur1 2.7 1.31 4.59 9.87E−05 0.000522 Prim2 843.4 1.3 1.34 0 0 Rrm1 4168.2 1.3 1.34 0 0 Dnajc15 778.1 1.3 1.35 0 0 Brip1os 583.1 1.3 1.37 1E−15 3.8E−14 Perp 113.8 1.3 1.41 4.33E−10 6.63E−09 Msantd3 9.2 1.3 2.05 0.000408 0.00182 Col6a6 6.3 1.3 4.16 0.000432 0.001913 Gnaz 9.7 1.3 2.35 0.000531 0.002295 Syt11 1025 1.29 1.31 0 0 Rab27a 1564.8 1.29 1.32 0 0 Stip1 4349.6 1.29 1.32 0 0 Cep19 280.3 1.29 1.34 0 0 Selenoh 1560.4 1.29 1.34 0 1E−15 Clec1b 45.4 1.29 1.59 1.54E−05 0.0001 Il5 3.6 1.29 5.79 0.000125 0.000643 Klrb1a 36.2 1.29 1.9 0.000175 0.000861 Serpina3n 16.7 1.29 2.04 0.000428 0.001901 Ms4a2 35.1 1.29 2.29 0.000563 0.002414 Tmem171 12.4 1.29 2.26 0.000567 0.002428 Snai3 164.9 1.28 1.39 2.53E−10 4.06E−09 CT030173.1 47.8 1.28 1.54 5.74E−06 4.11E−05 Iqcg 28.8 1.28 1.6 1.76E−05 0.000113 Mst1r 38.6 1.28 1.61 2.34E−05 0.000146 Serpine2 31.1 1.28 1.66 0.000104 0.000547 Pawr 19.1 1.28 1.82 0.00015 0.000752 D630045J12Rik 11.4 1.28 2.12 0.000411 0.001831 Oasl2 98.6 1.28 3 0.000737 0.003051 Rab19 1074.2 1.27 1.31 0 0 Rap2a 566 1.27 1.31 0 0 Tm6sf1 1262.4 1.27 1.32 0 0 Caskin2 253.4 1.27 1.33 6E−15 1.65E−13 Gm7901 153.5 1.27 1.38 7.96E−10 1.16E−08 Ly6c1 2390.4 1.27 1.41 2.71E−08 3.04E−07 Pxmp2 56.9 1.27 1.44 4.38E−07 3.98E−06 Il3 4 1.27 5.13 0.000123 0.000633 C1ql1 3.8 1.27 5.38 0.000393 0.001762 Car1 559.7 1.27 1.97 0.000423 0.001879 Sla 9431 1.26 1.29 0 0 Runx2 2056.2 1.26 1.3 0 0 Impa2 575 1.26 1.3 0 0 Atp2b4 1723.8 1.26 1.3 0 0 Cpsf2 1192.5 1.26 1.32 2.6E−14 7.37E−13 Bcl2l1 1866.8 1.26 1.33 3.2E−14 8.76E−13 2810006K23Rik 128.8 1.26 1.41 3.26E−08 3.63E−07 Sostdc1 55.7 1.26 1.49 6.65E−06 4.69E−05 Gm15987 44.4 1.26 1.64 4.28E−05 0.00025 Mest 21.1 1.26 1.73 0.000157 0.000783 Fkbp10 29.4 1.26 1.74 0.000252 0.001191 Hnf4a 4.7 1.26 3.99 0.000517 0.002238 Gp1ba 18.9 1.26 2.02 0.000659 0.002769 AC153369.2 8.4 1.26 2.51 0.000813 0.003321 Prss34 356.8 1.26 2.96 0.000841 0.003422 Tarm1 9.2 1.26 3.21 0.000847 0.003442 Nudt5 931.4 1.25 1.28 0 0 Aurka 633.5 1.25 1.29 0 0 C1qtnf6 340.9 1.25 1.3 0 0 Nrm 1120.2 1.25 1.3 0 0 Kifc5b 272.7 1.25 1.31 1E−15 3.3E−14 H2afx 3402.7 1.25 1.31 2E−15 5.8E−14 Gyg 764.1 1.25 1.31 8E−15 2.44E−13 Lsm2 779.8 1.25 1.34 8.52E−12 1.74E−10 Xaf1 1257.6 1.25 1.36 2.65E−09 3.56E−08 Kndc1 53.5 1.25 1.48 2.11E−06 1.66E−05 Xkr8 51.5 1.25 1.48 3.91E−06 2.91E−05 Gm37004 26 1.25 1.56 3.67E−05 0.000218 Scin 117.4 1.25 1.62 6.9E−05 0.000381 Sgms2 21.4 1.25 1.8 0.00038 0.00171 Vcan 11.1 1.25 2.23 0.000894 0.003604 Lrp3 7.7 1.25 2.52 0.000956 0.003818 Nde1 1235.2 1.24 1.26 0 0 Hn1l 449.3 1.24 1.3 6E−15 1.74E−13 Lamc1 923.9 1.24 1.31 1.71E−13 4.3E−12 Alg6 94.2 1.24 1.39 1.32E−07 1.31E−06 AC126459.2 179 1.24 1.4 3.61E−07 3.32E−06 Dsp 79.2 1.24 1.55 4.45E−05 0.000258 Gm14148 21.4 1.24 1.54 5.86E−05 0.00033 AC151730.1 71.6 1.24 1.69 8.59E−05 0.000463 Gm13461 16.5 1.24 1.82 0.000465 0.002039 Fhl1 19.9 1.24 1.74 0.000492 0.002143 Smpx 6.2 1.24 4.22 0.000628 0.002658 Tom1l1 20.3 1.24 1.95 0.00073 0.003028 Hist1h2ab 3.6 1.24 3.05 0.000791 0.003245 Il33 4.5 1.24 3.09 0.000871 0.003531 Epha3 8.5 1.24 2.62 0.000892 0.003598 Hist1h2ae 10.9 1.24 2.06 0.000918 0.003688 Gm13031 8 1.24 2.51 0.000941 0.003764 Gm14569 11.7 1.24 3.38 0.000999 0.003964 Slamf7 804.9 1.23 1.27 0 0 Cxcr6 818 1.23 1.27 0 0 Cpox 574.5 1.23 1.28 0 8E−15 Adam19 5999.2 1.23 1.29 2E−15 5.2E−14 Ms4a4c 692.6 1.23 1.3 4.5E−14 1.22E−12 Penk 1018 1.23 1.3 2.51E−12 5.5E−11 Klrb1f 190 1.23 1.32 3.65E−10 5.66E−09 Gm6166 141.1 1.23 1.32 1.18E−09 1.67E−08 Fam184a 33.5 1.23 1.5 1.8E−05 0.000116 Meis1 68.8 1.23 1.55 8.54E−05 0.00046 Erg 37.2 1.23 1.55 0.000101 0.000531 Enpp6 21.8 1.23 1.82 0.00032 0.001474 Gm6982 3.3 1.23 4.32 0.000669 0.002804 Gm7456 10.4 1.23 2.12 0.000809 0.003311 Spon1 28.9 1.23 2.16 0.000894 0.003604 Unc80 11 1.23 2.08 0.001129 0.004421 Ran 2657.7 1.22 1.24 0 0 Zranb3 259.4 1.22 1.27 0 0 Cbx5 1657.3 1.22 1.27 0 1E−15 Ms4a6d 734.6 1.22 1.28 3E−15 1.07E−13 Fbxo5 492.7 1.22 1.28 1.3E−14 3.61E−13 Hsph1 3580.6 1.22 1.28 4.8E−14 1.29E−12 Pttg1 1600.8 1.22 1.28 1.21E−13 3.11E−12 Cysltr2 169.1 1.22 1.37 3.3E−07 3.06E−06 Phf11a 221.4 1.22 1.4 9.86E−07 8.28E−06 Rgs18 52.3 1.22 1.54 9.22E−05 0.000492 Wdr54 19.6 1.22 1.61 0.000186 0.000909 Clstn3 34.6 1.22 1.6 0.000219 0.001054 Aqp1 400.8 1.22 1.93 0.00081 0.003312 Il20ra 9.2 1.22 1.97 0.001035 0.00409 Hist1h2bk 8.4 1.22 2.66 0.001176 0.004581 Chaf1b 1135 1.21 1.23 0 0 Rnaseh2b 648.9 1.21 1.24 0 0 Tnfrsf9 1547.1 1.21 1.29 1.28E−10 2.17E−09 Smoc2 90.6 1.21 1.34 6.72E−08 7.07E−07 Fancf 96.5 1.21 1.34 9.78E−08 1E−06 Tex13c2 4.1 1.21 3.28 0.000884 0.003573 Mcpt1 510.2 1.21 3.19 0.001329 0.005105 Chit1 6.9 1.21 2.51 0.00139 0.005311 Psma1 2415.5 1.2 1.22 0 0 Zcchc18 377.7 1.2 1.23 0 0 Ppa1 1390.3 1.2 1.25 3E−15 9.8E−14 Alms1 195.5 1.2 1.33 1.17E−07 1.18E−06 Ms4a4a 77.2 1.2 1.36 2.06E−07 1.97E−06 Farp1 144.7 1.2 1.34 4.58E−07 4.13E−06 Lrrc49 50.8 1.2 1.38 1.78E−06 1.42E−05 Tfec 71.7 1.2 1.43 1.18E−05 7.88E−05 Gm15232 43.8 1.2 1.46 1.89E−05 0.00012 Fgd1 24 1.2 1.52 0.000114 0.00059 C78197 19.1 1.2 1.74 0.000569 0.002437 Slc18a2 46.4 1.2 1.9 0.000856 0.003474 Clgn 5.1 1.2 3.51 0.001392 0.005316 Calm3 5962.7 1.19 1.21 0 0 Dtl 1077.7 1.19 1.26 4.67E−11 8.43E−10 Ptpn13 1107.8 1.19 1.3 6.78E−09 8.4E−08 Mrpl34 516.5 1.19 1.33 2.57E−07 2.41E−06 Nphp4 99.7 1.19 1.33 3.18E−07 2.95E−06 Trim46 87.2 1.19 1.34 6.83E−07 5.91E−06 Fn1 453.7 1.19 1.54 0.000169 0.000836 I830127L07Rik 6.6 1.19 5.81 0.00103 0.004071 Reps2 11 1.19 2.16 0.001383 0.005292 Mcm7 3981.2 1.18 1.21 0 0 Trim37 677.9 1.18 1.21 0 0 BC055324 200.3 1.18 1.22 0 7E−15 Gm4737 198.1 1.18 1.25 3.91E−11 7.17E−10 Pycard 1522.9 1.18 1.25 8.74E−11 1.51E−09 Fam185a 192.8 1.18 1.28 2.12E−09 2.88E−08 Bag2 63 1.18 1.31 4.71E−07 4.24E−06 Ifitm1 214.1 1.18 1.44 6.52E−05 0.000362 Alox12 39.7 1.18 1.46 0.00013 0.000665 Cebpe 5.7 1.18 3.45 0.001328 0.005104 Ppp2r2c 6.5 1.18 4.48 0.00155 0.005841 Mcpt2 69.1 1.18 3.32 0.001613 0.006049 Fam46c 5669.2 1.17 1.2 0 0 Plscr1 472.1 1.17 1.22 7.7E−14 2.01E−12 Grb7 380.9 1.17 1.3 7.86E−07 6.72E−06 Phlda3 37.7 1.17 1.38 2.49E−05 0.000154 Rtkn 29.5 1.17 1.44 0.000126 0.000646 Cym 46.2 1.17 1.51 0.000165 0.000821 Cfap77 26 1.17 1.51 0.000167 0.000826 Gm10286 2.8 1.17 4.98 0.000868 0.00352 AC158990.2 7.6 1.17 2.88 0.001943 0.007104 Entpd1 1241.1 1.16 1.2 0 0 Dbi 1291.8 1.16 1.21 2.3E−14 6.44E−13 Hmga1-rs1 312.3 1.16 1.21 1.05E−12 2.43E−11 Tmem237 165.9 1.16 1.22 1.29E−12 2.96E−11 Raph1 355.4 1.16 1.22 5.71E−12 1.19E−10 Echdc1 172.2 1.16 1.23 3.63E−11 6.71E−10 Tuba1b 1989.9 1.16 1.26 1.8E−08 2.09E−07 Ifi214 383.7 1.16 1.31 9.86E−07 8.28E−06 Pvrig 126.3 1.16 1.31 1.56E−06 1.26E−05 Steap3 134.6 1.16 1.4 5.47E−05 0.00031 Fam89a 34.7 1.16 1.45 5.54E−05 0.000313 Gm8719 29.4 1.16 1.47 0.000149 0.000748 Epas1 1633 1.16 1.5 0.000353 0.001608 Adamts3 19.6 1.16 1.69 0.000885 0.003576 Opn3 13.4 1.16 1.74 0.000965 0.003851 Syngr4 9.5 1.16 2.04 0.001733 0.006439 Tmem98 10.9 1.16 1.94 0.002001 0.007282 Rfc5 1166.1 1.15 1.17 0 0 Pdk3 769.1 1.15 1.17 0 0 Samd3 769 1.15 1.2 5E−15 1.56E−13 Psmb9 7187.6 1.15 1.22 2.5E−11 4.73E−10 Slc9a5 265.3 1.15 1.22 7.94E−11 1.38E−09 Fbxl8 274.2 1.15 1.23 6.27E−10 9.33E−09 Myh10 131.2 1.15 1.37 3.82E−05 0.000226 Ighv1-81 14 1.15 3.56 0.00155 0.005841 Palm3 10.2 1.15 1.86 0.001827 0.006731 Ifit3b 107.9 1.15 2.04 0.002247 0.008038 Pla2g16 2185.4 1.14 1.15 0 0 Ptprcap 9906.9 1.14 1.18 0 1E−15 Zbp1 5544.8 1.14 1.22 1.03E−09 1.47E−08 Eif2ak2 397.5 1.14 1.23 5.43E−09 6.87E−08 Ifi209 837.9 1.14 1.24 2.48E−08 2.79E−07 Prkar2b 166.3 1.14 1.28 1.79E−06 1.43E−05 Gm5620 33.2 1.14 1.38 0.000109 0.00057 Tspo2 25.6 1.14 2.05 0.002092 0.007567 Gm12641 4.5 1.14 2.63 0.002216 0.007947 Gm5391 5.3 1.14 2.44 0.002442 0.008648 Chga 5.7 1.14 2.51 0.002652 0.00928 Bhlhe40 29564.9 1.13 1.15 0 0 Scd2 2011 1.13 1.16 0 0 Arl6ip1 6248 1.13 1.17 0 1E−15 Pycrl 578 1.13 1.17 1E−15 1.8E−14 Erg28 683.6 1.13 1.18 3E−15 8.3E−14 Pgk1 407 1.13 1.18 3.15E−13 7.63E−12 Rom1 500.9 1.13 1.2 4.67E−11 8.43E−10 Eef1akmt1 350.7 1.13 1.22 1.39E−08 1.64E−07 Cenpv 293.7 1.13 1.23 6.57E−08 6.93E−07 Xk 84.8 1.13 1.25 2.68E−07 2.51E−06 Clec7a 192.7 1.13 1.26 6.18E−07 5.4E−06 Nudt1 390.3 1.13 1.26 6.42E−07 5.59E−06 Ltbp1 63.3 1.13 1.33 3.43E−05 0.000205 9430037O13Rik 48.3 1.13 1.37 0.000118 0.000609 Dgkg 28.8 1.13 1.49 0.000398 0.001781 Bex4 6.5 1.13 2.52 0.002771 0.009627 Prf1 1704.5 1.12 1.14 0 0 Dpagt1 515.2 1.12 1.18 7.25E−12 1.49E−10 Enkd1 215 1.12 1.2 5.04E−09 6.42E−08 Klra3 69.3 1.12 1.33 3.42E−05 0.000204 G0s2 77.4 1.12 1.38 0.000194 0.000946 4930520O04Rik 19.9 1.12 1.53 0.00072 0.002993 Gm24507 10.1 1.12 1.9 0.002546 0.008969 Irx3 8.6 1.12 1.79 0.002652 0.00928 Zfp575 7.4 1.12 2.11 0.002982 0.010267 4930427A07Rik 1017.7 1.11 1.13 0 0 Fen1 1518.2 1.11 1.13 0 0 Gng2 1586.5 1.11 1.15 0 0 Polq 483.2 1.11 1.17 4.68E−11 8.45E−10 Aplf 178.2 1.11 1.19 2.84E−09 3.78E−08 Optn 199.7 1.11 1.22 3.7E−07 3.4E−06 Dhx58 1168.4 1.11 1.24 8.05E−07 6.86E−06 Nudt7 57.3 1.11 1.34 6.92E−05 0.000382 Prr18 25.2 1.11 1.42 0.000467 0.002048 Fam109b 49.4 1.11 1.49 0.000642 0.002708 Thbs1 150.8 1.11 1.48 0.00069 0.002882 2210011C24Rik 23 1.11 1.46 0.000846 0.003439 Rtp4 1189.3 1.11 1.5 0.000884 0.003572 Myom2 3.3 1.11 2.84 0.002323 0.00828 Ncr1 264.6 1.11 1.76 0.002392 0.008499 Adgrl4 27.6 1.11 1.74 0.002603 0.009132 Gm15941 4.3 1.11 2.54 0.003237 0.011024 Hoxa9 9 1.11 2.09 0.003272 0.011122 Myrf 11.2 1.11 2.56 0.00334 0.011303 Endod1 867.3 1.1 1.12 0 0 Ruvbl2 1746.2 1.1 1.14 0 2E−15 Mrps6 469.4 1.1 1.16 1.21E−11 2.4E−10 Naa38 642.5 1.1 1.18 1.39E−08 1.64E−07 Gcat 256.4 1.1 1.23 2.8E−06 2.16E−05 Tmem163 137 1.1 1.32 0.000126 0.000646 Ccdc80 29.4 1.1 1.48 0.000747 0.003085 Epdr1 29.9 1.1 1.56 0.001471 0.005584 Naaladl1 17.4 1.1 1.55 0.001554 0.005857 Gm5541 13.5 1.1 1.97 0.003169 0.010832 Cfb 9.7 1.1 2.3 0.003841 0.012715 Tipin 1045.9 1.09 1.13 1E−15 4.3E−14 Hikeshi 408 1.09 1.15 6.66E−12 1.38E−10 Epsti1 2970.1 1.09 1.14 2.87E−11 5.39E−10 Mfsd2b 366.8 1.09 1.19 1.24E−07 1.24E−06 Zan 929.3 1.09 1.19 2.42E−07 2.29E−06 1190007I07Rik 77.8 1.09 1.22 2.98E−06 2.28E−05 Kcnip3 48.9 1.09 1.29 3.51E−05 0.000209 Ryr1 67.2 1.09 1.33 0.000206 0.000995 Rsph1 29 1.09 1.35 0.000451 0.001985 Slfn4 78.7 1.09 1.51 0.000918 0.003688 Gm42517 3 1.09 4.44 0.00121 0.004704 Gm31597 30.9 1.09 1.54 0.001558 0.005869 Col8a2 11.9 1.09 2.08 0.003591 0.012023 Gm5787 4.5 1.09 2.84 0.003715 0.012368 Glp1r 11.2 1.09 2.1 0.004071 0.013338 Taf6 1182.3 1.08 1.1 0 0 Plp2 432.8 1.08 1.12 1E−15 2.3E−14 Atcay 258.4 1.08 1.12 3E−15 1.06E−13 Casp4 449.3 1.08 1.13 8.76E−12 1.79E−10 Sytl2 1359.2 1.08 1.14 6.48E−11 1.14E−09 Txn1 4856.9 1.08 1.14 1.86E−09 2.55E−08 Banf1 2759.2 1.08 1.17 1.7E−07 1.65E−06 Tubd1 123.6 1.08 1.19 5.64E−07 4.98E−06 Apol10b 57.6 1.08 1.37 0.000331 0.001516 9130604C24Rik 12.8 1.08 1.68 0.002537 0.008944 AC133083.4 8.9 1.08 2.13 0.003676 0.012261 Mcpt8 355.9 1.08 2.25 0.004527 0.01461 Bub3 2635.7 1.07 1.09 0 0 Sept11 2112.3 1.07 1.11 5.1E−14 1.36E−12 5830432E09Rik 221.9 1.07 1.12 1.77E−12 3.97E−11 Tbc1d31 347.8 1.07 1.11 2.85E−12 6.2E−11 Sema7a 543.5 1.07 1.12 7.39E−12 1.52E−10 PgP 482.7 1.07 1.12 9.9E−11 1.69E−09 Mrpl51 433.6 1.07 1.13 1.05E−09 1.5E−08 AC123720.1 301.8 1.07 1.14 5.56E−09 7.01E−08 Slc29a4 63.5 1.07 1.17 9.44E−07 7.95E−06 Dctd 147.9 1.07 1.19 2.49E−06 1.93E−05 Csrp2 91.9 1.07 1.19 3.25E−06 2.46E−05 Ptrh1 154.5 1.07 1.2 6.71E−06 4.72E−05 Unc5b 14.9 1.07 1.45 0.001958 0.00715 A430018G15Rik 17 1.07 1.55 0.001969 0.007187 Upk1b 3.1 1.07 3.96 0.003029 0.010405 Gm11223 13 1.07 1.72 0.003491 0.011736 Scrn1 9.5 1.07 1.96 0.004421 0.014317 G6b 5.8 1.07 2.42 0.004604 0.014825 Rangap1 5185.4 1.06 1.07 0 0 Cd8b1 8616.8 1.06 1.08 0 0 Mms22l 883 1.06 1.08 0 0 Cchcr1 724.1 1.06 1.09 0 0 Rnpep 2406 1.06 1.1 0 1E−15 Cntln 217.1 1.06 1.09 0 7E−15 Clic1 10203.8 1.06 1.09 1E−15 2.1E−14 Pkmyt1 1872.8 1.06 1.1 6E−15 1.73E−13 Phgdh 591.6 1.06 1.1 6.8E−14 1.79E−12 Lcp1 29534.7 1.06 1.1 9.5E−14 2.46E−12 Trbv3 327 1.06 1.1 1.27E−13 3.23E−12 Gm13394 2531.6 1.06 1.11 1.77E−11 3.42E−10 Gm5855 163.2 1.06 1.12 3.97E−10 6.11E−09 Rad51c 174.3 1.06 1.13 6.37E−09 7.94E−08 Fgl2 387.2 1.06 1.15 4.93E−07 4.42E−06 Fam69b 58.7 1.06 1.17 1.34E−06 1.1E−05 Ddah2 90 1.06 1.21 3.01E−05 0.000182 Mid2 43.1 1.06 1.37 0.000679 0.002842 C430042M11Rik 20.4 1.06 1.44 0.001415 0.00539 1700006J14Rik 34.9 1.06 1.52 0.002226 0.007977 Kifc5c-ps 3.2 1.06 5.01 0.002273 0.008113 Gm4316 14.1 1.06 1.62 0.002956 0.010189 Ighv1-77 5.6 1.06 2.91 0.004291 0.013953 Syngr3 14.2 1.06 1.89 0.004613 0.014847 Garem1 10.4 1.06 2.16 0.004725 0.015161 Gm5732 8.2 1.06 2.1 0.004985 0.01591 9230110C19Rik 6.9 1.06 2.22 0.005156 0.016393 Cdk4 5123.3 1.05 1.07 0 0 Psmb8 13142.6 1.05 1.09 5.3E−14 1.42E−12 Cdc25a 933.6 1.05 1.09 5.4E−14 1.43E−12 Pmf1 1789.9 1.05 1.09 1.87E−12 4.17E−11 Galm 344.1 1.05 1.1 1.09E−11 2.19E−10 Tpgs1 515.9 1.05 1.11 2.78E−09 3.71E−08 2610524H06Rik 134.2 1.05 1.12 3.58E−08 3.95E−07 St14 207.6 1.05 1.16 2.31E−06 1.8E−05 Ifi206 467.7 1.05 1.18 6.08E−06 4.32E−05 F2rl3 91.5 1.05 1.18 1.08E−05 7.26E−05 Ctnnbip1 164 1.05 1.18 1.81E−05 0.000116 Ccl12 4.4 1.05 3.63 0.003485 0.011718 Slc17a6 4.8 1.05 3.66 0.003716 0.012368 Gm867 11.8 1.05 1.74 0.00416 0.013584 Srd5a1 9.7 1.05 1.76 0.004432 0.014342 Bad 457.8 1.04 1.08 1.55E−11 3.03E−10 Pafah2 209.2 1.04 1.11 2.07E−08 2.37E−07 Dzip3 213.7 1.04 1.12 4.28E−08 4.63E−07 Casp1 695.8 1.04 1.13 1.06E−07 1.08E−06 Nrgn 587.4 1.04 1.2 5.55E−05 0.000314 Gm28942 25.8 1.04 1.35 0.000795 0.003259 Gm13361 26.6 1.04 1.39 0.00157 0.005905 AC151730.3 14.5 1.04 1.64 0.003469 0.011674 Cyp4f39 4 1.04 3.04 0.003903 0.012858 Ranbp17 12.9 1.04 1.93 0.005338 0.01689 Gm6419 7.9 1.04 2.1 0.006041 0.0188 Unc119b 2622.3 1.03 1.05 0 0 Ak3 1405.9 1.03 1.05 0 0 Brca2 378 1.03 1.06 0 0 Prelid2 433.7 1.03 1.06 0 1E−15 Hmbs 853.4 1.03 1.07 2.67E−12 5.82E−11 Cobll1 564 1.03 1.07 1.31E−11 2.6E−10 Ttf2 773.8 1.03 1.08 1.77E−10 2.94E−09 Ap1s2 357.9 1.03 1.09 6.21E−10 9.25E−09 Arhgap33 461.4 1.03 1.1 1.1E−07 1.11E−06 Cxcr5 1400.5 1.03 1.11 1.62E−07 1.58E−06 Zfp324 80.8 1.03 1.16 1.23E−05 8.15E−05 1700008J07Rik 46 1.03 1.2 8.13E−05 0.00044 Pla2g1b 3.1 1.03 5.68 0.000671 0.002812 Rasd2 26.4 1.03 1.31 0.001055 0.004161 Gm19412 24.7 1.03 1.45 0.002222 0.007968 Gm21850 5.8 1.03 5.15 0.003849 0.012735 Ninj2 22.5 1.03 1.57 0.003881 0.012815 Cacna1b 12.9 1.03 1.59 0.003981 0.013088 Hspd1 2211.8 1.02 1.03 0 0 Gins4 994.2 1.02 1.03 0 0 Hirip3 1284.6 1.02 1.04 0 1E−15 Dtx3l 2072.2 1.02 1.05 1E−15 3.7E−14 Atad5 649 1.02 1.05 4E−15 1.19E−13 Slc22a15 789 1.02 1.05 2.1E−13 5.2E−12 Nefh 428.6 1.02 1.08 2.24E−09 3.03E−08 Gemin8 131.1 1.02 1.14 1.99E−05 0.000126 Coa3 751.4 1.02 1.17 3.92E−05 0.000231 AL591582.1 67.5 1.02 1.2 0.000137 0.000694 Rabl2 66.4 1.02 1.21 0.000142 0.000719 BC147527 314.7 1.02 1.21 0.000232 0.001111 F5 26.3 1.02 1.32 0.001751 0.006497 Cysltr1 12.2 1.02 1.53 0.003789 0.012571 Ankrd29 17.2 1.02 1.59 0.003942 0.01298 Serpinb1b 5.6 1.02 3.25 0.00527 0.016699 Cxcl11 12.9 1.02 1.71 0.005596 0.017603 A730089K16Rik 8.9 1.02 3.51 0.006351 0.019658 Gm12669 5.9 1.02 2.72 0.006491 0.020036 Draxin 7.5 1.02 2.51 0.006903 0.021116 Lrrn4 10.2 1.02 2.39 0.00739 0.022374 Fbxw8 1446.7 1.01 1.03 0 0 Mis18a 835 1.01 1.03 0 0 Adprh 1898 1.01 1.03 0 1E−15 Gmds 345.1 1.01 1.05 2.03E−12 4.49E−11 Hat1 1129 1.01 1.06 7.79E−10 1.14E−08 Psmb10 4675.3 1.01 1.07 1.49E−09 2.07E−08 F730043M19Rik 151.6 1.01 1.1 5.92E−07 5.2E−06 Map1a 43.3 1.01 1.14 5.25E−05 0.000299 Gata1 221 1.01 1.18 0.000138 0.0007 4930524J08Rik 30.3 1.01 1.2 0.00043 0.001909 Ly6c2 4431.1 1.01 1.23 0.000513 0.002224 Gm30211 96.4 1.01 1.34 0.001432 0.005448 Slc30a2 29 1.01 1.33 0.002911 0.010056 Lpar3 17.1 1.01 1.53 0.003294 0.011174 Gm35037 11.6 1.01 1.65 0.005347 0.016913 Pcdh7 8.7 1.01 1.64 0.006542 0.020151 Ntf5 8.2 1.01 1.67 0.006819 0.020886 Olfr414 5.8 1.01 3.46 0.007252 0.022 AC153562.2 4.6 1.01 2.14 0.007428 0.022477 Cd248 7.6 1.01 2.32 0.007647 0.023068 Ccdc120 9.6 1.01 1.83 0.007745 0.023309 Ahsa1 2898.5 1 1.02 0 0 Cdca4 1330.7 1 1.03 0 0 Ebp 1270.8 1 1.03 8E−15 2.22E−13 Thop1 736 1 1.03 6.1E−14 1.6E−12 Jdp2 335.6 1 1.03 2.76E−13 6.73E−12 Rpa3 304.5 1 1.04 3E−10 4.76E−09 Ece2 225.8 1 1.06 1.04E−08 1.25E−07 Cttn 156.2 1 1.07 2.39E−08 2.7E−07 Ydjc 187.1 1 1.07 1.09E−07 1.1E−06 5033430I15Rik 174.1 1 1.07 4.67E−07 4.21E−06 Orc1 394.8 1 1.09 8.9E−07 7.52E−06 Cx3cr1 141.8 1 1.09 3.2E−06 2.43E−05 Ltbp3 64 1 1.12 2.83E−05 0.000173 Zfp239 60.8 1 1.15 5.9E−05 0.000332 Mansc1 76.8 1 1.17 0.000128 0.000654 Bahcc1 65.2 1 1.17 0.000156 0.00078 Rpl39-ps 163.8 1 1.2 0.000445 0.001964 Ccl2 77.5 1 1.39 0.002955 0.010188 Col5a1 37.5 1 1.48 0.004515 0.014573 Wisp1 171.4 1 1.46 0.004818 0.015407 Hist1h2bl 3.2 1 2.02 0.00672 0.020634 Gm11658 7.3 1 1.65 0.007621 0.023001 Gm44101 5.1 1 2.58 0.007779 0.02339 Atp6v1g3 12.9 1 1.89 0.007957 0.023852 Bbs2 593.4 −1 −1.02 0 0 Cdc42bpb 487.3 −1 −1.06 4.36E−09 5.61E−08 Dapk1 459.6 −1 −1.06 1.22E−08 1.45E−07 Lonrf1 133.9 −1 −1.06 2.72E−08 3.04E−07 Vps37b 99356.7 −1 −1.07 1.11E−07 1.12E−06 C130050O18Rik 95.9 −1 −1.14 1.81E−05 0.000116 Thrb 56.4 −1 −1.13 3.27E−05 0.000196 Gm45743 60.6 −1 −1.14 4.4E−05 0.000256 Gm42743 41.9 −1 −1.13 4.43E−05 0.000257 Nectin1 128.6 −1 −1.15 7.02E−05 0.000387 Proscos 49.9 −1 −1.15 0.000156 0.00078 Snx24 100.2 −1 −1.2 0.000273 0.00128 Gm43919 34.9 −1 −1.19 0.000325 0.001493 Fbxl12os 26.5 −1 −1.25 0.001077 0.004236 Robo4 55.1 −1 −1.28 0.001574 0.00592 Fam149a 48.8 −1 −1.32 0.001849 0.006801 Gm17021 42.4 −1 −1.35 0.00255 0.008981 Gm15918 28.4 −1 −1.36 0.003178 0.010856 Dcst2 12.5 −1 −1.43 0.004038 0.013242 Traj23 11.2 −1 −1.45 0.004281 0.013929 Cyp1a1 14.7 −1 −1.53 0.005398 0.017057 Siglecg 751.8 −1 −1.64 0.005784 0.018124 Gm5538 4.9 −1 −3.78 0.006528 0.020119 2310026I22Rik 9.2 −1 −1.66 0.006733 0.020671 Zfp536 9.7 −1 −1.65 0.006926 0.02116 Slc8a2 9.9 −1 −1.82 0.007393 0.022379 C130074G19Rik 7.9 −1 −1.78 0.008117 0.024268 Gm37078 5.3 −1 −2.53 0.008127 0.024294 Enthd1 11.5 −1 −1.83 0.008208 0.024502 Oprl1 7.9 −1 −1.99 0.008234 0.024563 Gm16069 513.8 −1.01 −1.03 0 1.4E−14 Slc12a7 12768.1 −1.01 −1.05 2.7E−14 7.4E−13 Gm1043 603.2 −1.01 −1.06 2.48E−10 4E−09 Gm16638 160.1 −1.01 −1.07 7.79E−10 1.14E−08 Skil 15256 −1.01 −1.08 3.99E−08 4.35E−07 Gm6085 80.3 −1.01 −1.16 0.000113 0.000586 Arhgap20 94.6 −1.01 −1.18 0.000163 0.00081 AC158605.3 38.2 −1.01 −1.27 0.000516 0.002237 She 55.5 −1.01 −1.25 0.000684 0.002858 Abca9 130.3 −1.01 −1.29 0.000993 0.003946 Chrna9 16 −1.01 −1.35 0.002576 0.009052 Cplx1 15.4 −1.01 −1.49 0.004189 0.013661 Gm2694 5.2 −1.01 −3.48 0.006165 0.019142 Fxyd1 9.9 −1.01 −1.64 0.006183 0.01919 Gm31479 6.5 −1.01 −2.85 0.007441 0.022507 Clec2h 5.3 −1.01 −2.58 0.007558 0.022832 Hba-a2 368.3 −1.01 −2.17 0.007639 0.023049 G730013B05Rik 7.5 −1.01 −1.88 0.00769 0.02318 A430072C10Rik 4.4 −1.01 −2.03 0.007723 0.023258 Slc6a19os 5.5 −1.01 −1.86 0.008023 0.024027 Sema3b 11.3 −1.01 −1.97 0.008087 0.024202 Ldhal6b 9.7 −1.01 −1.95 0.008111 0.024255 Dip2c 434.7 −1.02 −1.08 1.85E−09 2.54E−08 Trio 1619.6 −1.02 −1.08 2.11E−08 2.41E−07 Il13ra1 83.3 −1.02 −1.13 3.14E−06 2.39E−05 Gm45059 77.9 −1.02 −1.12 5.67E−06 4.06E−05 Lrrc25 483.1 −1.02 −1.15 9.03E−06 6.18E−05 Ptpro 88.1 −1.02 −1.16 1.63E−05 0.000106 Susd4 89.1 −1.02 −1.16 2.64E−05 0.000162 AC152827.1 55.1 −1.02 −1.19 0.000137 0.000695 Epb41l1 134.6 −1.02 −1.21 0.000176 0.000867 Cd177 45.2 −1.02 −1.33 0.001186 0.004619 AC104880.1 22.4 −1.02 −1.36 0.00212 0.007654 Gm16060 18 −1.02 −1.37 0.002489 0.008799 Pmepa1os 12.1 −1.02 −1.46 0.003899 0.012852 Hoga1 13.2 −1.02 −1.61 0.004419 0.014313 Gm37109 3.1 −1.02 −2.45 0.005212 0.016548 Plxna2 19.9 −1.02 −1.61 0.005262 0.016685 A430027C01Rik 13.4 −1.02 −1.85 0.006086 0.018924 Gm21984 9.4 −1.02 −1.85 0.006525 0.020112 Gm44860 11.3 −1.02 −2.21 0.006672 0.020505 Gramd2 8.5 −1.02 −2.62 0.006793 0.020823 Mcf2 7.3 −1.02 −3.16 0.006935 0.02118 Ablim3 13.3 −1.02 −2.32 0.006988 0.021312 4922502D21Rik 7.8 −1.02 −1.93 0.007227 0.021936 Cyp4f13 1429.7 −1.03 −1.04 0 0 Gm37494 567.7 −1.03 −1.07 1.06E−11 2.12E−10 Maff 11634.4 −1.03 −1.08 1.68E−11 3.25E−10 Tdrp 4170.6 −1.03 −1.08 1.84E−10 3.04E−09 Dennd2c 139.5 −1.03 −1.1 2.13E−08 2.43E−07 Pla2g7 1374.2 −1.03 −1.11 9.79E−08 1E−06 Apoe 8629.4 −1.03 −1.11 1.62E−07 1.58E−06 AC140264.2 106 −1.03 −1.13 1.08E−06 8.95E−06 Alpk1 263.7 −1.03 −1.12 1.08E−06 8.96E−06 Jmy 4073.6 −1.03 −1.13 2.17E−06 1.7E−05 Fdx1l 80.3 −1.03 −1.13 2.58E−06 1.99E−05 Pnck 68.8 −1.03 −1.15 9.22E−06 6.3E−05 Ttc12 74.5 −1.03 −1.25 0.000243 0.001157 Gm12966 32.5 −1.03 −1.23 0.000274 0.001283 AC117769.3 40.9 −1.03 −1.27 0.000618 0.002621 Foxq1 65.3 −1.03 −1.28 0.0007 0.002921 Gm12000 21.3 −1.03 −1.42 0.002794 0.009693 Mir7046 10.4 −1.03 −1.64 0.005264 0.016687 Gm31532 8.9 −1.03 −1.73 0.006325 0.019582 L3mbtl1 7.3 −1.03 −2.07 0.006502 0.020058 Bnip3l-ps 6.6 −1.03 −1.96 0.006735 0.020672 Sfmbt2 429.2 −1.04 −1.09 2.21E−11 4.22E−10 Cd86 1049.2 −1.04 −1.09 3.35E−10 5.26E−09 Cdc14b 1062 −1.04 −1.1 2.04E−09 2.79E−08 Gm42595 333.4 −1.04 −1.1 2.24E−09 3.02E−08 Tlr13 195.6 −1.04 −1.13 5.29E−08 5.62E−07 Egf 186.8 −1.04 −1.12 1.95E−07 1.87E−06 Fgfr1 240.7 −1.04 −1.13 6.63E−07 5.75E−06 Cap2 83.3 −1.04 −1.14 8.33E−07 7.09E−06 C1qb 6167.6 −1.04 −1.15 4.45E−06 3.26E−05 Fam167a 155 −1.04 −1.16 5.75E−06 4.11E−05 Cspg5 62.6 −1.04 −1.17 2.27E−05 0.000142 Tnnt2 65.1 −1.04 −1.2 2.53E−05 0.000156 Cxcl16 314.6 −1.04 −1.2 5.52E−05 0.000313 A430057M04Rik 48.4 −1.04 −1.27 0.000387 0.001739 Oscp1 44.4 −1.04 −1.29 0.000555 0.002385 H2-Ea-ps 7790.9 −1.04 −1.31 0.000565 0.002422 Il12b 54.2 −1.04 −1.45 0.001388 0.005304 Pde8b 30.7 −1.04 −1.64 0.003238 0.011026 Ptch2 15.2 −1.04 −1.56 0.003758 0.01249 Tmtc1 26.5 −1.04 −1.66 0.004404 0.01428 1810011O10Rik 24.2 −1.04 −1.65 0.004405 0.014281 Gm12167 10.2 −1.04 −1.7 0.005323 0.016848 Gm12089 3.8 −1.04 −2.79 0.005526 0.017413 Gm28035 6 −1.04 −2.57 0.006042 0.0188 C230037L18Rik 243.6 −1.05 −1.1 7.77E−13 1.82E−11 Dyx1c1 106 −1.05 −1.13 3.09E−07 2.87E−06 Hebp1 934.9 −1.05 −1.18 5.55E−06 3.99E−05 Tmem51 428.5 −1.05 −1.17 6E−06 4.27E−05 Naip5 181.7 −1.05 −1.19 1.01E−05 6.87E−05 Cd300c2 673.6 −1.05 −1.2 2.32E−05 0.000144 Card10 54.5 −1.05 −1.19 2.47E−05 0.000153 Coro6 40.8 −1.05 −1.22 8.79E−05 0.000471 Bhlhe41 99.6 −1.05 −1.24 9.66E−05 0.000512 Fhit 63.9 −1.05 −1.24 0.000136 0.000692 Gm18194 29.5 −1.05 −1.28 0.000246 0.001168 Lin7b 27.7 −1.05 −1.28 0.000301 0.001393 Gm6012 40.5 −1.05 −1.29 0.000404 0.001806 Sox5 27.1 −1.05 −1.31 0.000448 0.001973 P2ry2 61.4 −1.05 −1.36 0.000804 0.003293 Gm44214 21.7 −1.05 −1.35 0.000952 0.003805 Blnk 622 −1.05 −1.41 0.001157 0.004518 Acot4 15.6 −1.05 −1.67 0.003129 0.010702 AC160562.1 14.3 −1.05 −1.6 0.003251 0.011059 Myo15 15.2 −1.05 −1.66 0.003332 0.011284 Extl1 17.9 −1.05 −1.78 0.005054 0.0161 Gm15929 8.8 −1.05 −1.92 0.005178 0.016449 Gm43777 8.3 −1.05 −1.79 0.005291 0.016755 Gm2814 9.6 −1.05 −2.68 0.005673 0.017801 Rassf3 6479.1 −1.06 −1.09 0 8E−15 2810021J22Rik 1264.6 −1.06 −1.12 9.26E−11 1.59E−09 Ovgp1 326.4 −1.06 −1.12 1.35E−10 2.27E−09 Mapk12 152.1 −1.06 −1.15 5.43E−08 5.76E−07 AC125071.1 106 −1.06 −1.17 6.39E−07 5.57E−06 Bbs1 97.2 −1.06 −1.17 1.57E−06 1.27E−05 Gm10167 58.6 −1.06 −1.22 2.61E−05 0.00016 Rassf8 83.1 −1.06 −1.23 4.05E−05 0.000238 Mapk15 40.7 −1.06 −1.27 0.000162 0.000807 Ghrl 55 −1.06 −1.33 0.000426 0.001892 Slc4a11 40.7 −1.06 −1.33 0.000485 0.002114 Cybrd1 29.8 −1.06 −1.35 0.000586 0.002499 Gm8251 24.9 −1.06 −1.4 0.000924 0.003706 Tceal1 18.7 −1.06 −1.52 0.002435 0.00863 Pifo 13.3 −1.06 −1.59 0.003076 0.010546 Bicdl2 10.3 −1.06 −1.77 0.003577 0.011987 CT009757.4 3.8 −1.06 −3.2 0.004176 0.013625 Tmem30b 16 −1.06 −1.86 0.004968 0.015862 Gm826 7.6 −1.06 −2.41 0.0051 0.01623 Tmem236 8.3 −1.06 −1.94 0.005165 0.016415 Gm13201 8.2 −1.06 −2.49 0.00522 0.01657 Zbtb20 1429.4 −1.07 −1.1 0 1E−15 Dstyk 697.7 −1.07 −1.1 0 8E−15 1830077J02Rik 399 −1.07 −1.15 9.22E−09 1.11E−07 Stac3 119.4 −1.07 −1.15 1.12E−07 1.13E−06 Xkrx 235.4 −1.07 −1.18 5.59E−07 4.94E−06 Aph1c 92.6 −1.07 −1.18 1.71E−06 1.37E−05 Ly86 762.3 −1.07 −1.21 8.49E−06 5.85E−05 Stab2 1255.1 −1.07 −1.21 8.58E−06 5.91E−05 4921507P07Rik 57.2 −1.07 −1.21 8.97E−06 6.15E−05 Lst1 1097.1 −1.07 −1.21 1.14E−05 7.63E−05 Erbb2 135 −1.07 −1.26 4.73E−05 0.000273 Syde2 248.2 −1.07 −1.24 4.75E−05 0.000274 Hspg2 41.3 −1.07 −1.3 0.00025 0.001187 Cfap74 36.6 −1.07 −1.35 0.000347 0.001581 Rusc2 49.2 −1.07 −1.34 0.000354 0.001609 Cpe 36.2 −1.07 −1.35 0.000616 0.002616 1700061G19Rik 22.8 −1.07 −1.36 0.000645 0.002719 Rab30 116 −1.07 −1.57 0.001884 0.006917 Gm15537 21 −1.07 −1.58 0.002688 0.009387 Dlk1 20.9 −1.07 −1.54 0.002932 0.010115 Akp-ps1 12.6 −1.07 −1.63 0.003213 0.010955 Gm23346 11.3 −1.07 −2.42 0.003589 0.012019 Col2a1 13.8 −1.07 −1.69 0.003605 0.012063 Muc3 12.6 −1.07 −1.82 0.004403 0.014278 Rgsl1 4.5 −1.07 −2.66 0.004427 0.014331 Gm42655 7.7 −1.07 −2.37 0.004556 0.014693 Hbb-bs 1829.7 −1.07 −2.23 0.004758 0.015252 Crip3 8.6 −1.07 −2.83 0.004816 0.015403 4732440D04Rik 113 −1.08 −1.14 2.24E−10 3.65E−09 Mmp15 73.3 −1.08 −1.16 2.28E−08 2.6E−07 Rgl1 1317.4 −1.08 −1.18 1.34E−07 1.33E−06 Gm15706 118.9 −1.08 −1.18 1.66E−07 1.62E−06 Cdk14 85 −1.08 −1.28 5.71E−05 0.000322 Gm18310 30.9 −1.08 −1.37 0.000572 0.002447 4933433G15Rik 17.6 −1.08 −1.52 0.001341 0.005145 Blk 523.7 −1.08 −1.89 0.0037 0.012329 Hrh1 9.5 −1.08 −1.97 0.003762 0.012499 Dusp10 33817.9 −1.09 −1.12 0 1E−15 Gm42829 278.5 −1.09 −1.12 0 1E−15 Klf7 2672.7 −1.09 −1.12 0 1E−15 Gpr157 197.5 −1.09 −1.12 7E−15 2.04E−13 Sez6l2 335 −1.09 −1.13 1.4E−14 3.99E−13 1700109H08Rik 571.4 −1.09 −1.15 4.74E−11 8.5E−10 Arsg 171.4 −1.09 −1.17 4.69E−09 6E−08 Lypd6b 490.3 −1.09 −1.17 1.28E−08 1.51E−07 Gm14168 317.9 −1.09 −1.17 3.99E−08 4.35E−07 Rnd2 50.2 −1.09 −1.21 3.16E−06 2.4E−05 1700003F12Rik 31.2 −1.09 −1.35 0.000266 0.001254 Cd300c 47.9 −1.09 −1.42 0.000366 0.001658 1700028N14Rik 48.1 −1.09 −1.37 0.000451 0.001986 Gm11210 24.9 −1.09 −1.41 0.000578 0.002472 Stac2 76.6 −1.09 −1.44 0.000652 0.002746 Gm13199 23 −1.09 −1.44 0.000847 0.003442 Wfdc3 16.1 −1.09 −1.49 0.00138 0.005282 D630033O11Rik 38.5 −1.09 −1.71 0.002251 0.00805 Pcdhga12 13.8 −1.09 −1.85 0.003166 0.010824 Mcmdc2 8.5 −1.09 −2.47 0.004266 0.013892 AtG 5537.4 −1.1 −1.17 2.92E−10 4.66E−09 Cage1 267.2 −1.1 −1.17 4.95E−09 6.32E−08 Plce1 62.8 −1.1 −1.22 1.85E−06 1.47E−05 Wdfy3 451.6 −1.1 −1.27 1.85E−05 0.000118 Gm13054 37.4 −1.1 −1.34 0.000134 0.000681 Snord72 35.8 −1.1 −1.34 0.000207 0.000998 Tdrd9 21.8 −1.1 −1.44 0.00065 0.00274 Fam229a 25.2 −1.1 −1.44 0.000757 0.003124 Gm38192 22.6 −1.1 −1.57 0.001304 0.005024 A930038B10Rik 14.3 −1.1 −1.62 0.002057 0.007455 AL607131.1 38.2 −1.1 −1.7 0.002202 0.007906 Prox1 12.4 −1.1 −1.72 0.002422 0.008591 Alas2 140.4 −1.1 −1.81 0.002845 0.009851 Gm15696 19.1 −1.1 −1.81 0.00296 0.010201 Arhgap42 15.2 −1.1 −1.96 0.002998 0.010315 Fam13a 8.3 −1.1 −2.15 0.003567 0.011962 Rgcc 877.6 −1.11 −1.14 0 0 Thbs3 181.1 −1.11 −1.16 2.09E−12 4.62E−11 Tnfrsf12a 1193.9 −1.11 −1.18 2.33E−10 3.77E−09 Wnt5b 363.9 −1.11 −1.17 2.97E−10 4.72E−09 D7Bwg0826e 309.2 −1.11 −1.18 6.4E−10 9.5E−09 Cdo1 154.9 −1.11 −1.18 1.84E−09 2.52E−08 Ing4 286.6 −1.11 −1.2 1.16E−08 1.38E−07 Dock4 301.1 −1.11 −1.21 3.54E−08 3.91E−07 Sh2d4b 213.3 −1.11 −1.21 1.23E−07 1.23E−06 Nr4a3 16228.2 −1.11 −1.22 6.69E−07 5.8E−06 Fam213b 477.2 −1.11 −1.23 6.75E−07 5.85E−06 Gk5 113.2 −1.11 −1.23 8.68E−07 7.36E−06 Hey1 1015.7 −1.11 −1.23 1.04E−06 8.68E−06 Bach2it1 141.1 −1.11 −1.23 1.16E−06 9.58E−06 Sorcs2 70.7 −1.11 −1.26 5.81E−06 4.15E−05 Bmp2 169.3 −1.11 −1.27 7.01E−06 4.92E−05 Snta1 208.6 −1.11 −1.27 1.06E−05 7.16E−05 Gm13710 186.2 −1.11 −1.29 1.71E−05 0.00011 Cascl 50.4 −1.11 −1.3 2.08E−05 0.000131 Nr3c2 42.8 −1.11 −1.35 7.47E−05 0.000408 Myo5c 12.5 −1.11 −1.65 0.001671 0.006233 Gm45140 14.1 −1.11 −1.7 0.001727 0.006423 Scx 11.1 −1.11 −1.65 0.002003 0.007288 AC156952.1 12.6 −1.11 −1.89 0.002764 0.009612 D6Ertd474e 4.7 −1.11 −3.38 0.003004 0.010332 Gm9873 11.3 −1.11 −1.97 0.003018 0.010375 Smim6 7.7 −1.11 −2.44 0.003338 0.011301 Gm20513 6.4 −1.11 −2.77 0.003468 0.011673 Hap1 446.1 −1.12 −1.18 2.38E−10 3.85E−09 Epb4113 649.5 −1.12 −1.22 1.19E−07 1.19E−06 Gm9403 86.5 −1.12 −1.24 2.13E−07 2.03E−06 Ccpg1 685.5 −1.12 −1.24 7.55E−07 6.47E−06 Clec4a1 389.4 −1.12 −1.28 6.12E−06 4.35E−05 CAAA01194877.1 40.7 −1.12 −1.37 0.000103 0.000544 Padi1 28.6 −1.12 −1.39 0.000201 0.000973 Cd36 136.3 −1.12 −1.45 0.000339 0.001549 Bcar1 37.6 −1.12 −1.43 0.00035 0.001594 Snx22 65.3 −1.12 −1.61 0.001167 0.004552 Trim7 268.2 −1.12 −1.78 0.001673 0.006239 Actl7b 11.5 −1.12 −1.66 0.001764 0.006538 Cacna1f 12.7 −1.12 −1.62 0.001813 0.006692 Gm10425 5.3 −1.12 −3.54 0.002191 0.007874 Prph 18.6 −1.12 −1.79 0.002429 0.00861 Mfap2 4.7 −1.12 −2.58 0.00275 0.009577 Gm16083 11.2 −1.12 −2.24 0.002964 0.010212 Peg13 3375.2 −1.13 −1.17 0 0 Basp1 514.9 −1.13 −1.21 5.81E−10 8.69E−09 Gm42659 103.8 −1.13 −1.21 4.02E−09 5.22E−08 Tagln 142.5 −1.13 −1.21 1.06E−08 1.27E−07 Syk 3325.1 −1.13 −1.23 5.23E−08 5.56E−07 Gm28731 120.2 −1.13 −1.23 6.72E−08 7.06E−07 Trim36 327.4 −1.13 −1.23 7.28E−08 7.61E−07 Smagp 295.1 −1.13 −1.24 1.66E−07 1.62E−06 Wdfy4 2179.7 −1.13 −1.39 9.1E−05 0.000486 Tenm3 7.8 −1.13 −3.31 0.000878 0.003554 Srms 29.4 −1.13 −1.59 0.000938 0.003755 Ccr10 27.6 −1.13 −1.67 0.001242 0.00481 Scn3a 17.9 −1.13 −1.76 0.001259 0.00487 Six1 18.8 −1.13 −1.61 0.00127 0.004905 Mab21l3 31.1 −1.13 −1.89 0.001644 0.006154 Tcf21 11.3 −1.13 −1.75 0.002034 0.007381 Gm20506 6.3 −1.13 −3.45 0.00239 0.008493 Hbb-bt 232 −1.13 −2.38 0.002847 0.009853 Chka 3724.8 −1.14 −1.18 0 7E−15 Ttc28 2577.9 −1.14 −1.22 6.08E−10 9.07E−09 C330013E15Rik 164.4 −1.14 −1.25 2.81E−07 2.62E−06 E230029C05Rik 167.6 −1.14 −1.28 7.77E−07 6.65E−06 Gm22596 38.9 −1.14 −1.32 1.85E−05 0.000118 Gm37856 32.5 −1.14 −1.38 5.67E−05 0.00032 Acot1 60.2 −1.14 −1.39 6.79E−05 0.000375 Zfp811 50.1 −1.14 −1.41 0.000133 0.000678 Ctnnd2 131.9 −1.14 −1.44 0.000139 0.000703 5430402O13Rik 22.1 −1.14 −1.55 0.000666 0.002793 Btnl4 51.4 −1.14 −1.72 0.000896 0.00361 Tex26 22.2 −1.14 −1.65 0.000907 0.003649 Cecr2 73.9 −1.14 −1.95 0.001666 0.00622 Cd209c 9.8 −1.14 −2.49 0.002577 0.009055 Msi1 220.6 −1.15 −1.2 8.41E−13 1.97E−11 P2ry13 230.8 −1.15 −1.26 1.71E−08 1.99E−07 Sgip1 455.7 −1.15 −1.28 3.33E−07 3.08E−06 C1qc 6828 −1.15 −1.29 6.45E−07 5.61E−06 1700047K16Rik 77 −1.15 −1.31 6.01E−06 4.28E−05 Fam83e 25.7 −1.15 −1.41 8.3E−05 0.000448 Mxra7 39.3 −1.15 −1.43 0.00011 0.000574 Cspg4 3.3 −1.15 −5.62 0.000117 0.000603 Car3 34.9 −1.15 −1.84 0.001092 0.00429 Ephx3 23.3 −1.15 −1.75 0.001523 0.005749 Des 17.8 −1.15 −1.87 0.00184 0.006771 Neurl1a 7.4 −1.15 −2.41 0.002443 0.008651 Stox2 6.7 −1.15 −2.3 0.00249 0.008799 Lepr 5.9 −1.15 −2.45 0.002517 0.008882 Gm45212 5.8 −1.15 −2.56 0.002531 0.008927 Creg1 2831 −1.16 −1.22 4.72E−12 9.94E−11 Txnrd3 195.6 −1.16 −1.25 7.32E−10 1.08E−08 Cd163 1248.1 −1.16 −1.31 6.08E−07 5.33E−06 Rab34 100.4 −1.16 −1.31 1.51E−06 1.23E−05 Fgf17 23 −1.16 −1.55 0.000756 0.00312 Prlr 10.5 −1.16 −2.27 0.001924 0.007048 Il1bos 10.4 −1.16 −2.22 0.002031 0.007373 Gm38299 5.4 −1.16 −3.44 0.002059 0.007461 Gm35584 9 −1.16 −2.58 0.002101 0.007598 Rasl10b 6.3 −1.16 −2.53 0.002111 0.007625 Il22ra2 7.5 −1.16 −2.84 0.002262 0.008085 Tgfbr3 2708.7 −1.17 −1.2 0 0 Bach2 5671.9 −1.17 −1.21 0 6E−15 Gm43352 344.3 −1.17 −1.24 3.79E−11 6.97E−10 Tnfrsf21 641.6 −1.17 −1.25 8.28E−11 1.43E−09 Mpeg1 6302.5 −1.17 −1.25 7.72E−10 1.13E−08 Tbxas1 561.4 −1.17 −1.27 7.87E−09 9.61E−08 Thsd1 89.3 −1.17 −1.3 2.62E−07 2.46E−06 Il1b 670.8 −1.17 −1.31 7.38E−07 6.36E−06 Tbx2 144.3 −1.17 −1.34 3.67E−06 2.74E−05 March1 226 −1.17 −1.41 1.83E−05 0.000117 Serpine1 218.8 −1.17 −1.42 5.48E−05 0.00031 Gm37509 25.6 −1.17 −1.44 6.32E−05 0.000352 Ptgis 82.5 −1.17 −1.47 9.03E−05 0.000483 Crnde 21.9 −1.17 −1.47 0.000116 0.000599 Gm15448 29.6 −1.17 −1.71 0.000537 0.002315 Mir5107 156.7 −1.17 −1.83 0.001041 0.004111 1700001J03Rik 13.9 −1.17 −2.01 0.001786 0.006611 Gm17999 9.8 −1.17 −2.54 0.0018 0.006652 Gm37621 8.8 −1.17 −2.16 0.001873 0.006882 Myzap 9.4 −1.17 −2.33 0.001875 0.006886 Gm15156 8.3 −1.17 −2.23 0.001925 0.00705 4930455G09Rik 13.9 −1.17 −2.58 0.002094 0.007572 Mtss1 2502.5 −1.18 −1.19 0 0 1700056E22Rik 810.3 −1.18 −1.24 3E−14 8.31E−13 Plekha6 574.9 −1.18 −1.24 3.19E−13 7.72E−12 Gnal 314.2 −1.18 −1.26 4.93E−10 7.47E−09 Wnk4 72.2 −1.18 −1.29 1.22E−08 1.45E−07 Clec12a 552.3 −1.18 −1.35 2.93E−06 2.25E−05 9330102E08Rik 20.4 −1.18 −1.59 0.000312 0.001441 Adgrl3 33.2 −1.18 −1.74 0.00049 0.002135 AC152065.1 24.8 −1.18 −1.71 0.000632 0.002673 Gm26685 15.5 −1.18 −1.8 0.000915 0.003677 Gm5466 17.5 −1.18 −1.99 0.001304 0.005023 Reln 18.1 −1.18 −2.28 0.001614 0.006051 Gucy2c 7.2 −1.18 −2.88 0.001714 0.006382 Gm45572 4.9 −1.18 −3.42 0.001752 0.0065 Gm2058 5.4 −1.18 −2.64 0.001753 0.006503 Fcnaos 7.6 −1.18 −2.37 0.001762 0.006532 Gm13868 10 −1.18 −2.61 0.001817 0.006701 Ldlr 1329.5 −1.19 −1.23 0 1E−15 S1pr1 21169 −1.19 −1.24 3.9E−14 1.05E−12 Ksr2 333.8 −1.19 −1.27 7.47E−11 1.3E−09 Lrrc75b 342.7 −1.19 −1.3 5.18E−09 6.59E−08 Dnah17 303 −1.19 −1.3 4.01E−08 4.37E−07 Tmem141 255.2 −1.19 −1.37 1.75E−06 1.4E−05 Gpat3 224.7 −1.19 −1.35 1.96E−06 1.55E−05 Adhfe1 58 −1.19 −1.4 5.68E−06 4.06E−05 Poln 40.7 −1.19 −1.45 5.15E−05 0.000294 Klra17 46.4 −1.19 −1.57 0.000193 0.000938 Syce1l 12.2 −1.19 −1.87 0.000875 0.003544 Gm15523 17.3 −1.19 −1.93 0.001035 0.00409 0610040J01Rik 15.3 −1.19 −2.08 0.001054 0.004156 Gm11525 16.1 −1.19 −2.03 0.001213 0.004715 6330403L08Rik 20.6 −1.19 −2.07 0.001227 0.00476 Gm15848 16.2 −1.19 −3.07 0.001697 0.006322 Gm26799 792.8 −1.2 −1.26 7.8E−14 2.04E−12 Nr1d2 2875.9 −1.2 −1.26 3.15E−13 7.65E−12 Tcf4 708.9 −1.2 −1.3 6.96E−09 8.59E−08 Cd300a 1109.4 −1.2 −1.33 5.7E−08 6.03E−07 Ccnd1 258 −1.2 −1.35 1.29E−07 1.29E−06 Gm12474 77.6 −1.2 −1.34 2.3E−07 2.18E−06 Kcnj9 35.1 −1.2 −1.78 0.000455 0.002001 Baiap2l1 10.8 −1.2 −2.01 0.001135 0.00444 Slc6a1 17.6 −1.2 −2.23 0.001191 0.004634 Gpr152 13.5 −1.2 −2.12 0.001386 0.0053 Gm44735 8.1 −1.2 −2.18 0.001412 0.005383 Gm15675 565.2 −1.21 −1.28 2.06E−13 5.1E−12 Plxna1 900.2 −1.21 −1.3 3.45E−10 5.38E−09 Slc7a7 700.4 −1.21 −1.31 1.07E−09 1.52E−08 P4ha2 71.8 −1.21 −1.35 9.41E−08 9.65E−07 Dbndd2 61.2 −1.21 −1.35 1.45E−07 1.43E−06 Angptl7 118.5 −1.21 −1.38 5.17E−07 4.61E−06 Sirpb1a 105.6 −1.21 −1.39 5.82E−07 5.13E−06 Kcnk13 70 −1.21 −1.41 2.14E−06 1.68E−05 Gm2238 53.2 −1.21 −1.43 9.18E−06 6.28E−05 AC139941.2 39.3 −1.21 −1.54 8.74E−05 0.000469 Plekhg1 29 −1.21 −1.66 0.000292 0.001357 AC154548.2 22 −1.21 −1.72 0.000515 0.002231 Gm36937 12.9 −1.21 −2.31 0.001265 0.004889 Gm36159 8.5 −1.21 −2.36 0.001348 0.005169 Rgs7bp 8.5 −1.21 −2.61 0.001437 0.005464 Amigo2 1152.3 −1.22 −1.27 1E−15 3.2E−14 Pde5a 641 −1.22 −1.29 4E−14 1.08E−12 Myo9a 1226.4 −1.22 −1.29 1.92E−13 4.77E−12 Ptpdc1 185.8 −1.22 −1.3 3.71E−12 7.94E−11 Rab7b 324.8 −1.22 −1.32 6.47E−10 9.59E−09 Ptgs1 1227.5 −1.22 −1.31 6.72E−10 9.94E−09 Siglech 840.4 −1.22 −1.36 9.21E−08 9.46E−07 Gm13340 40.7 −1.22 −1.42 3.06E−06 2.34E−05 Slpi 1443.3 −1.22 −1.51 3.7E−05 0.00022 Crabp2 41.6 −1.22 −1.55 0.000115 0.000594 Cpne9 20.6 −1.22 −1.59 0.000175 0.000861 Wtip 28.7 −1.22 −1.67 0.00019 0.000927 Nox1 20 −1.22 −1.77 0.000288 0.00134 Kcnj2 25 −1.22 −2.13 0.000891 0.003595 Gm38160 15.5 −1.22 −2.33 0.001201 0.004671 Tulp1 4.4 −1.22 −2.59 0.001242 0.00481 Tbx4 5.5 −1.22 −2.3 0.001274 0.004917 Rapgef4 2629.2 −1.23 −1.28 0 1E−15 Zfyve28 1185 −1.23 −1.32 2.46E−11 4.68E−10 Tns3 884 −1.23 −1.34 1.44E−09 2.01E−08 Alpk3 97.8 −1.23 −1.35 3.57E−09 4.69E−08 Ucp3 43.4 −1.23 −1.42 1.96E−06 1.55E−05 Slc26a8 47 −1.23 −1.43 3.29E−06 2.48E−05 Slc16a7 76.5 −1.23 −1.46 6.11E−06 4.34E−05 Ssc5d 41.7 −1.23 −1.5 2.14E−05 0.000134 AC159649.1 24.5 −1.23 −1.54 6.02E−05 0.000337 Clec9a 155.9 −1.23 −1.61 8.74E−05 0.00047 Has3 31.1 −1.23 −1.68 0.000212 0.001023 Muc2 15.7 −1.23 −1.78 0.000371 0.001676 Lsamp 11.3 −1.23 −1.86 0.000524 0.002268 Gm44185 16.5 −1.23 −1.85 0.000526 0.002273 Gm12263 11.8 −1.23 −2.06 0.000838 0.003411 Adam11 386.6 −1.24 −1.3 0 1.4E−14 9230114K14Rik 64.2 −1.24 −1.43 1.77E−06 1.42E−05 AC158605.2 23.8 −1.24 −1.72 0.000182 0.000892 Ccser1 25.6 −1.24 −1.92 0.000376 0.001694 Kncn 8.8 −1.24 −1.98 0.000829 0.00338 5930403N24Rik 16 −1.24 −2.23 0.000843 0.003427 Sbsn 107.9 −1.25 −1.36 1.8E−09 2.47E−08 Adgrl2 148.4 −1.25 −1.38 1.1E−08 1.31E−07 Slc16a9 181.6 −1.25 −1.43 4.53E−07 4.09E−06 Gm17116 29.3 −1.25 −1.58 3.4E−05 0.000203 Cxcl2 1196 −1.25 −1.58 4.79E−05 0.000276 Tpm2 26.7 −1.25 −1.65 9.83E−05 0.00052 AC158622.3 22.2 −1.25 −1.68 0.00016 0.0008 Gm37755 11.4 −1.25 −2.1 0.000797 0.003266 Tmem132b 9.3 −1.25 −3.04 0.001003 0.003981 Gtf2ird1 693.3 −1.26 −1.37 1.66E−10 2.76E−09 Rhbdf1 115.9 −1.26 −1.4 2.97E−08 3.32E−07 Slc23a3 71.8 −1.26 −1.41 1.12E−07 1.13E−06 Spon2 49.3 −1.26 −1.42 1.54E−07 1.51E−06 Gm11342 46.6 −1.26 −1.46 9.11E−07 7.69E−06 Gm15728 46.1 −1.26 −1.49 4.42E−06 3.24E−05 Skor1 38.4 −1.26 −1.48 5.95E−06 4.25E−05 Olfr1033 26.2 −1.26 −1.71 0.000174 0.000858 Gm15327 25.1 −1.26 −1.81 0.000356 0.001619 Gm32999 14.5 −1.26 −2.13 0.000663 0.002785 4833411C07Rik 12.7 −1.26 −2.47 0.000791 0.003247 Gm12290 7.9 −1.26 −2.93 0.000865 0.003511 Slc28a1 7.4 −1.26 −2.34 0.000891 0.003595 Cd55 2669.5 −1.27 −1.32 0 0 Adra2a 136.7 −1.27 −1.34 4.7E−14 1.26E−12 Dnhd1 272.9 −1.27 −1.35 6.78E−13 1.6E−11 Pirb 1339.8 −1.27 −1.41 1.54E−08 1.8E−07 Cd300lf 581.8 −1.27 −1.41 1.64E−08 1.92E−07 Zfhx3 113.3 −1.27 −1.44 1.52E−07 1.49E−06 Amn 69.8 −1.27 −1.5 2.81E−06 2.16E−05 Gm44401 34.9 −1.27 −1.51 3.5E−06 2.62E−05 Cecr6 48.6 −1.27 −1.52 4.28E−06 3.15E−05 Sirpb1b 32.1 −1.27 −1.69 2.66E−05 0.000163 Zfp618 38 −1.27 −1.64 4.75E−05 0.000274 Apoc1 69.6 −1.27 −1.69 7.23E−05 0.000397 Ltbp2 21 −1.27 −1.83 0.000197 0.000955 Gm17455 30.9 −1.27 −1.88 0.000295 0.001371 St18 3.6 −1.27 −4.89 0.000421 0.001874 Gpbar1 9.8 −1.27 −2.27 0.000836 0.003403 Ptk2 617.3 −1.28 −1.32 0 0 Sbf2 450.1 −1.28 −1.33 0 0 AC135019.1 300.9 −1.28 −1.34 0 1E−15 Ctsf 383.8 −1.28 −1.37 4.71E−12 9.94E−11 Npm2 80.8 −1.28 −1.37 9.51E−11 1.63E−09 Rin1 193.4 −1.28 −1.38 5.16E−10 7.79E−09 Adgre1 1926.6 −1.28 −1.4 8.52E−10 1.24E−08 Hpgd 485.4 −1.28 −1.4 2.16E−09 2.93E−08 Gm18407 52.8 −1.28 −1.47 3.97E−07 3.62E−06 AC164573.1 54.6 −1.28 −1.47 7.45E−07 6.4E−06 Arg2 120.5 −1.28 −1.49 7.92E−07 6.76E−06 Flt3 441.7 −1.28 −1.5 8.85E−07 7.48E−06 Gm26615 44.6 −1.28 −1.65 2.71E−05 0.000166 A530064D06Rik 30 −1.28 −1.72 3.42E−05 0.000204 Gm33280 43.4 −1.28 −1.76 9.08E−05 0.000485 Gm15930 22 −1.28 −1.93 0.000219 0.001054 Hoxaas3 15.8 −1.28 −1.9 0.000251 0.001189 Gm11980 17.1 −1.28 −1.92 0.000307 0.001421 Gm43857 14.2 −1.28 −2.08 0.000361 0.001637 Gm37510 31.1 −1.28 −1.87 0.000376 0.001697 Gm12972 20.1 −1.28 −2.06 0.000381 0.001713 Cyp26b1 13.2 −1.28 −1.96 0.000381 0.001714 P4ha3 10.9 −1.28 −1.95 0.000471 0.002065 Prex2 8.7 −1.28 −2.59 0.000692 0.00289 Usp2 832.7 −1.29 −1.39 4.34E−11 7.86E−10 Tlr2 527.6 −1.29 −1.46 7.25E−08 7.59E−07 Matn2 73.1 −1.29 −1.57 2.24E−06 1.75E−05 AC159196.3 73.6 −1.29 −1.53 2.47E−06 1.92E−05 Fam135a 30.1 −1.29 −1.79 7.1E−05 0.000391 Gm4247 22.2 −1.29 −1.72 7.22E−05 0.000397 Fam83c 5.2 −1.29 −3.81 0.000414 0.001843 Otud1 1927.6 −1.3 −1.33 0 0 Fam209 161.5 −1.3 −1.41 5.91E−10 8.83E−09 Spred3 56.8 −1.3 −1.44 8.54E−09 1.04E−07 Lman1l 148.2 −1.3 −1.46 2.39E−08 2.7E−07 C1qa 7016.9 −1.3 −1.46 2.44E−08 2.75E−07 Msantd1 67.1 −1.3 −1.47 1.68E−07 1.64E−06 Nlgn3 46.3 −1.3 −1.5 3.68E−07 3.38E−06 Samd4 57.2 −1.3 −1.64 1.07E−05 7.19E−05 Cyp2d40 3.9 −1.3 −3.38 0.000438 0.001938 Usp28 3778 −1.31 −1.34 0 0 Ntn4 238.3 −1.31 −1.42 1.89E−10 3.13E−09 Gm19325 31.3 −1.31 −1.59 6.63E−06 4.67E−05 Ccdc148 86.4 −1.31 −1.62 6.67E−06 4.7E−05 Matn1 29.8 −1.31 −1.6 7.41E−06 5.18E−05 Art5 20.4 −1.31 −1.74 4.51E−05 0.000261 Slc6a7 16 −1.31 −1.9 0.000175 0.000862 Paqr6 11.7 −1.31 −2.35 0.000444 0.001958 6430548M08Rik 386.7 −1.32 −1.41 4.35E−13 1.04E−11 Jup 1184.5 −1.32 −1.41 4.36E−13 1.04E−11 Lima1 405.9 −1.32 −1.43 4.11E−11 7.48E−10 Tgm2 2908.8 −1.32 −1.44 1.38E−10 2.32E−09 Cfp 5197 −1.32 −1.44 4.73E−10 7.18E−09 Igf1 580.6 −1.32 −1.5 3.7E−08 4.07E−07 Gm44053 47.1 −1.32 −1.6 1.61E−06 1.3E−05 Gpr4 64.4 −1.32 −1.62 4.44E−06 3.25E−05 Mc1r 8.3 −1.32 −2.63 0.000507 0.002201 Ampd1 414.5 −1.33 −1.39 0 0 C6 1221.3 −1.33 −1.46 3.07E−10 4.85E−09 Gfra2 1060.6 −1.33 −1.46 5.81E−10 8.69E−09 Clec4n 902.8 −1.33 −1.49 4.25E−09 5.48E−08 Krt83 243.6 −1.33 −1.49 2.68E−08 3.01E−07 Clec4b1 78.8 −1.33 −1.72 1.43E−05 9.36E−05 Clec4a4 10.7 −1.33 −2.9 0.000393 0.001763 Nr2e3 6.8 −1.33 −4.34 0.000443 0.001955 Irs2 11401.3 −1.34 −1.4 0 1E−15 Fbxl22 362.3 −1.34 −1.41 6E−15 1.88E−13 Csf1r 9890.8 −1.34 −1.45 2.94E−12 6.38E−11 Zfp608 304 −1.34 −1.47 7.59E−10 1.11E−08 Gm42636 106.9 −1.34 −1.48 1.27E−09 1.79E−08 Fgd4 96.4 −1.34 −1.66 3.01E−06 2.3E−05 Gm9530 13.7 −1.34 −2.18 0.00018 0.000884 Gli1 13 −1.34 −2.06 0.00019 0.000928 Epha4 19.9 −1.34 −2.3 0.000222 0.001066 Tmem132c 5.6 −1.34 −3.55 0.000311 0.001435 Vipr1 6553.5 −1.35 −1.4 0 0 Adamdec1 659.5 −1.35 −1.47 7.08E−11 1.24E−09 Fmnl2 329.1 −1.35 −1.5 1.5E−09 2.08E−08 Guca2a 39.9 −1.35 −1.58 4.21E−07 3.82E−06 Tgm4 40.9 −1.35 −1.6 7.48E−07 6.42E−06 Gm12259 65.1 −1.35 −1.67 4.31E−06 3.17E−05 Trf 681.7 −1.35 −1.77 1.94E−05 0.000123 Podn 23.2 −1.35 −1.75 2.38E−05 0.000148 Aldh6a1 522.8 −1.36 −1.47 2.47E−11 4.68E−10 Adh1 149.8 −1.36 −1.49 4.27E−10 6.55E−09 Gm20544 121 −1.36 −1.51 9.16E−10 1.32E−08 Lpcat2 297.8 −1.36 −1.51 1.63E−09 2.25E−08 Rufy4 34.6 −1.36 −1.67 2.98E−06 2.28E−05 Syt1 3.7 −1.36 −5.79 0.000188 0.000918 Ankrd63 174.2 −1.37 −1.48 8.29E−12 1.7E−10 Slco2b1 818.9 −1.37 −1.49 9.09E−12 1.84E−10 Gm44907 211 −1.37 −1.48 2.4E−11 4.58E−10 Gm26888 163 −1.37 −1.5 8.25E−11 1.43E−09 Bcl2a1a 59.4 −1.37 −1.77 7.74E−06 5.39E−05 AC153955.5 18.5 −1.37 −2.1 9.26E−05 0.000494 Lrrc3 23.5 −1.37 −2.17 0.000121 0.000625 Armcx4 774.4 −1.37 −2.13 0.000162 0.000806 Gm12689 10.9 −1.37 −2.37 0.000236 0.001124 Slc40a1 4625.9 −1.38 −1.49 3.67E−12 7.88E−11 Tmem8b 139.4 −1.38 −1.5 8.99E−12 1.83E−10 Gm14027 93.7 −1.38 −1.5 3.48E−11 6.44E−10 Gm15503 167.6 −1.38 −1.51 8.32E−11 1.44E−09 Cd302 387 −1.38 −1.53 1.75E−10 2.9E−09 Mafb 1846.3 −1.38 −1.52 2.27E−10 3.69E−09 Gm15931 220.2 −1.38 −1.57 6.29E−09 7.84E−08 Apol9b 51.1 −1.38 −1.56 1.78E−08 2.06E−07 Pid1 185.8 −1.38 −1.68 8.53E−07 7.24E−06 Hes1 309.1 −1.38 −1.68 1.9E−06 1.51E−05 Jag1 135.9 −1.38 −1.7 4.46E−06 3.26E−05 A530099J19Rik 38 −1.38 −2.21 9.87E−05 0.000522 4930471C04Rik 10.8 −1.38 −2.24 0.000147 0.000741 Slc13a2 13.1 −1.38 −2.43 0.000153 0.000766 Gm15880 16.2 −1.38 −2.53 0.000207 0.000999 H2-Ob 1767 −1.39 −1.47 2E−15 6.2E−14 St8sia6 1584.6 −1.39 −1.47 4E−15 1.36E−13 Kcnip2 299.8 −1.39 −1.49 9.54E−13 2.22E−11 Agap1 495.9 −1.39 −1.54 3.02E−10 4.8E−09 Cyp27a1 464.9 −1.39 −1.57 5.08E−09 6.47E−08 Glis3 183.7 −1.39 −1.6 3.44E−08 3.81E−07 Ttc36 55 −1.39 −1.62 1.95E−07 1.88E−06 S1pr3 58.4 −1.39 −1.66 2.67E−07 2.5E−06 Shisa4 42.4 −1.39 −1.69 1.93E−06 1.53E−05 Notch4 137.5 −1.39 −1.8 8.56E−06 5.9E−05 Unc5a 20.3 −1.39 −2.82 0.000189 0.000922 Gm43364 7 −1.39 −2.54 0.000253 0.001196 Myo10 1090.4 −1.4 −1.49 8E−15 2.44E−13 Ifi207 440.3 −1.4 −1.55 2.58E−10 4.15E−09 Ppfibp2 358.3 −1.4 −1.57 9.23E−10 1.33E−08 Kcnh4 54 −1.4 −1.8 8.38E−06 5.79E−05 Ppp1r14a 48.4 −1.4 −1.89 1.95E−05 0.000124 AC160403.2 22.2 −1.4 −1.93 2.84E−05 0.000173 Gm37900 17.4 −1.4 −1.95 3.9E−05 0.00023 Tal2 7.8 −1.4 −3.32 0.000204 0.000985 Gper1 10.3 −1.4 −2.81 0.000226 0.001083 Gm45053 497.4 −1.41 −1.46 0 0 Erp27 298.4 −1.41 −1.48 0 0 Rims3 1029.1 −1.41 −1.5 2E−15 5.8E−14 Epha2 215.5 −1.41 −1.55 4.1E−11 7.48E−10 Dll4 78 −1.41 −1.6 4.69E−09 6E−08 Cacna1e 284.9 −1.41 −1.69 2.23E−07 2.12E−06 AC159502.1 24.7 −1.41 −1.84 1.34E−05 8.79E−05 Gm14221 27.8 −1.41 −2.18 5.98E−05 0.000335 Gm24371 8.6 −1.41 −2.69 0.000193 0.000938 Haglr 8.2 −1.41 −2.62 0.000212 0.001022 Tnfrsf10b 1091.3 −1.42 −1.48 0 0 Lhfpl3 194 −1.42 −1.5 0 1E−15 Ppp1r32 136.8 −1.42 −1.54 1E−12 2.32E−11 Cystm1 143.7 −1.42 −1.62 6.84E−09 8.46E−08 Bank1 715.4 −1.42 −1.65 3.75E−08 4.12E−07 Trim47 215.2 −1.42 −1.64 3.98E−08 4.35E−07 Gm14548 229.3 −1.42 −1.68 5.07E−08 5.42E−07 A930036K24Rik 102.7 −1.42 −1.69 4.41E−07 4E−06 Bmf 141.4 −1.42 −1.87 8.04E−06 5.59E−05 Tnnt3 267.5 −1.43 −1.49 0 0 Abcg3 1117.1 −1.43 −1.52 0 3E−15 Lilra6 252.1 −1.43 −1.59 5.27E−11 9.37E−10 Kirrel3 96.4 −1.43 −1.63 2.29E−09 3.09E−08 Nlrp3 1148.6 −1.43 −1.64 6.8E−09 8.42E−08 Tspan15 134 −1.43 −1.63 6.99E−09 8.63E−08 Pdzd2 59.3 −1.43 −1.68 4.54E−08 4.89E−07 Adap2 260.1 −1.43 −1.7 7.96E−08 8.26E−07 E230013L22Rik 56 −1.43 −1.81 1.9E−06 1.5E−05 Kcnj10 1374.3 −1.44 −1.55 1.4E−14 4.01E−13 Plbd1 1881.3 −1.44 −1.58 7.79E−12 1.6E−10 Nphp3 103.3 −1.44 −1.58 3.52E−11 6.5E−10 Trim72 99 −1.44 −1.79 3.19E−06 2.42E−05 9330179D12Rik 27.2 −1.44 −1.85 4E−06 2.96E−05 Gm44889 45.5 −1.44 −1.82 4.43E−06 3.25E−05 Mcc 21.2 −1.44 −2.36 4.81E−05 0.000277 Gm14137 13.8 −1.44 −3.59 0.000153 0.000766 Ifngr2 7439.3 −1.45 −1.52 0 0 Ripor3 228.4 −1.45 −1.53 0 0 Atp2a1 251.9 −1.45 −1.54 0 1.7E−14 Lrrc23 180.5 −1.45 −1.54 1E−15 2.6E−14 Map3k9 162.8 −1.45 −1.56 9E−15 2.57E−13 Ccr3 902.9 −1.45 −1.57 1.22E−12 2.78E−11 Gm13919 14.4 −1.45 −2.29 6.69E−05 0.00037 Gm43263 4.5 −1.45 −4.23 0.000109 0.00057 Gm16378 7.4 −1.45 −3.04 0.00012 0.000616 Hpgds 565.3 −1.46 −1.58 3.5E−14 9.57E−13 Grk3 1230.7 −1.46 −1.58 6.3E−14 1.66E−12 Itgb5 955.2 −1.46 −1.58 2.04E−13 5.07E−12 Slc45a3 1350.4 −1.46 −1.61 1.37E−11 2.69E−10 St6galnac2 280.3 −1.46 −1.66 1.57E−09 2.17E−08 B230398E01Rik 42.2 −1.46 −1.79 5.23E−07 4.65E−06 Tm4sf1 20.6 −1.46 −2.07 3.08E−05 0.000186 Elfn2 10.1 −1.46 −2.85 0.000117 0.000607 4930426D05Rik 77.3 −1.46 −3.31 0.000118 0.000608 Neurl3 9998.4 −1.47 −1.51 0 0 Gas6 210.8 −1.47 −1.69 7.28E−09 8.96E−08 Arhgap32 163.9 −1.47 −1.72 1.72E−08 2E−07 Slc8a1 117.6 −1.47 −1.87 8.73E−07 7.39E−06 Riiad1 6.9 −1.47 −3.36 0.000112 0.000581 Gm5150 271.8 −1.48 −1.61 1.69E−13 4.24E−12 Ctsk 47.3 −1.48 −1.67 1.41E−09 1.96E−08 Vwa3b 95.8 −1.48 −1.69 2.72E−09 3.64E−08 Gm42778 66.3 −1.48 −1.69 2.76E−09 3.68E−08 Apol9a 29.5 −1.48 −1.72 3.39E−08 3.76E−07 Capn9 80.5 −1.48 −1.77 3.53E−08 3.9E−07 Cd164l2 60 −1.48 −1.78 2.67E−07 2.5E−06 Jhy 47.7 −1.48 −2.71 6.28E−05 0.00035 Gm26583 155.4 −1.49 −1.61 1E−13 2.59E−12 Axl 7411.5 −1.5 −1.62 4.7E−14 1.27E−12 Cd209b 9.6 −1.5 −3.41 7.28E−05 0.0004 Mpzl1 469.8 −1.51 −1.65 1.12E−12 2.58E−11 Stra6l 77.8 −1.51 −1.78 3.26E−09 4.3E−08 Slc1a3 115.6 −1.51 −1.87 2.05E−07 1.96E−06 Plaur 2412.8 −1.53 −1.62 0 0 Tmem26 319.6 −1.53 −1.69 2.21E−12 4.88E−11 Islr2 51.9 −1.53 −1.85 1.27E−07 1.27E−06 Serinc4 39.2 −1.53 −1.89 2.14E−07 2.04E−06 Gm28496 23.9 −1.53 −1.91 7E−07 6.05E−06 Adam22 142.7 −1.53 −2.01 7.91E−07 6.76E−06 Gm39059 17 −1.53 −2.24 8.57E−06 5.9E−05 Rbm44 28.3 −1.53 −2.17 8.64E−06 5.94E−05 Gm45767 59.3 −1.54 −1.71 2.82E−11 5.29E−10 Rgl3 91.8 −1.54 −1.8 1.32E−09 1.86E−08 Rasal2 84.5 −1.54 −1.79 2.62E−09 3.51E−08 Gpc4 55.1 −1.54 −1.88 6.39E−08 6.74E−07 Mybpc3 45.4 −1.54 −1.95 3.3E−07 3.06E−06 Timm8a2 27.2 −1.54 −1.94 3.96E−07 3.61E−06 Cryaa 25.4 −1.54 −2.02 1.86E−06 1.48E−05 Gm32914 19 −1.54 −2.22 9.67E−06 6.58E−05 Cd207 65.2 −1.54 −3.46 4.96E−05 0.000285 Kcnj16 221.3 −1.55 −1.75 2.52E−11 4.76E−10 Sult6b2 52.2 −1.55 −1.74 3.35E−10 5.26E−09 9430038I01Rik 518.8 −1.55 −1.75 3.56E−10 5.54E−09 Dmpk 201.4 −1.55 −1.77 3.83E−10 5.9E−09 Ace 93.4 −1.55 −2.34 4.87E−06 3.54E−05 Maml3 448.5 −1.56 −1.64 0 0 Vcam1 9147.6 −1.56 −1.73 1.93E−12 4.28E−11 AC160405.2 68.7 −1.56 −1.74 2.56E−11 4.83E−10 Marcks 880 −1.56 −1.77 9.63E−11 1.65E−09 Gm16486 59.7 −1.56 −1.75 1.02E−10 1.74E−09 Myo18b 126.8 −1.56 −1.88 6.78E−09 8.4E−08 Adgrg6 43.3 −1.56 −2.1 9.01E−07 7.61E−06 Kif26a 36.7 −1.56 −2.4 9E−06 6.17E−05 Carns1 4046.3 −1.57 −1.6 0 0 Hcar2 808.2 −1.57 −1.79 2.26E−10 3.67E−09 Pyroxd2 242.8 −1.58 −1.75 1.52E−12 3.44E−11 Lhfp 173.9 −1.58 −1.82 4.67E−10 7.1E−09 Sned1 230.5 −1.58 −1.89 5.36E−09 6.79E−08 Adam30 27.5 −1.59 −2.32 5.57E−06 4E−05 Rasgef1b 1868 −1.61 −1.68 0 0 Shd 168 −1.61 −1.78 9.04E−13 2.11E−11 Ear2 200.6 −1.61 −1.83 1.1E−11 2.2E−10 Dgki 117.3 −1.61 −1.86 5.63E−11 9.99E−10 Mrc1 3441.3 −1.62 −1.79 4.62E−13 1.1E−11 Plpp3 349.2 −1.62 −1.82 3.16E−12 6.83E−11 Armcx1 41.6 −1.62 −2.1 4.7E−07 4.23E−06 AC152979.5 38.7 −1.62 −2.27 1.36E−06 1.11E−05 Cfap61 26 −1.62 −2.46 3.27E−06 2.48E−05 Gm44577 14.8 −1.62 −2.61 5.02E−06 3.64E−05 Gm17040 9.2 −1.62 −2.56 9.58E−06 6.53E−05 Paqr9 427.9 −1.63 −1.84 1.58E−12 3.57E−11 Gm20692 32.4 −1.63 −2.15 3.32E−07 3.07E−06 Treml4 1601.2 −1.64 −1.75 0 0 Pcolce2 67.5 −1.64 −2.02 1.22E−08 1.45E−07 Slc11a1 1813.6 −1.65 −1.79 0 1.3E−14 1700029H14Rik 34.9 −1.65 −2 1.69E−08 1.97E−07 Prrt3 12.9 −1.65 −2.43 3.28E−06 2.48E−05 Hepacam2 34.3 −1.65 −3 7.92E−06 5.51E−05 Ucp1 7.3 −1.65 −4.17 1.21E−05 8.04E−05 Lrp4 160.7 −1.66 −1.93 6.9E−11 1.2E−09 Etv1 13.7 −1.66 −2.72 2.68E−06 2.07E−05 Prig 9.9 −1.66 −2.49 5.13E−06 3.72E−05 Zbtb10 1450.8 −1.67 −1.75 0 0 Nr1d1 927.5 −1.67 −1.77 0 0 Prkcg 96.9 −1.67 −1.9 5.06E−12 1.06E−10 Gpr137b 186 −1.67 −1.92 8.97E−12 1.82E−10 Tnnc2 16.7 −1.67 −2.35 6.15E−07 5.38E−06 Fstl4 14.3 −1.68 −3.16 3.97E−06 2.95E−05 Hfe 584 −1.69 −1.89 1.61E−13 4.06E−12 Prkar1b 244.4 −1.7 −1.87 2E−15 6.5E−14 Scnn1a 79.5 −1.7 −2.03 3.02E−10 4.79E−09 Fndc7 27.5 −1.7 −2.39 2.09E−07 1.99E−06 Mfrp 55.6 −1.7 −2.23 2.88E−07 2.68E−06 Cd209d 96.9 −1.7 −2.46 7.68E−07 6.58E−06 Cd14 1110.8 −1.71 −1.92 9.3E−14 2.42E−12 Slc15a2 279.3 −1.71 −1.97 5.11E−12 1.07E−10 Gm43063 40.1 −1.71 −2.17 8.64E−09 1.05E−07 Gm26575 11.1 −1.71 −3.24 5.02E−06 3.64E−05 Gm8463 8.7 −1.71 −4.85 6.5E−06 4.6E−05 Gm20219 486.3 −1.72 −1.84 0 0 Aatk 130.6 −1.72 −1.94 9.9E−14 2.57E−12 Postn 510.9 −1.72 −1.93 1.24E−13 3.17E−12 Gm43786 17.6 −1.72 −2.36 5.5E−07 4.88E−06 Amz1 508.4 −1.73 −1.88 0 1E−15 Nuak1 190.3 −1.73 −1.88 0 1E−15 Pmel 62.3 −1.73 −4.31 1.27E−06 1.04E−05 Itga9 882.5 −1.74 −1.91 0 1.1E−14 Prr15 32.2 −1.74 −2.1 8.59E−10 1.25E−08 AC125351.1 47.4 −1.74 −2.21 3.88E−09 5.05E−08 Mmp19 385.3 −1.74 −2.31 5.08E−08 5.43E−07 Prdm14 18.6 −1.74 −2.51 1.15E−06 9.57E−06 Gm4258 54.5 −1.75 −1.99 2.33E−12 5.13E−11 Nav1 825.1 −1.76 −1.96 4E−15 1.36E−13 Nptxr 82 −1.76 −2.03 2.98E−12 6.45E−11 AC158622.5 86.8 −1.76 −2.1 2.83E−10 4.52E−09 Gsdmc4 19.2 −1.76 −2.22 1.78E−08 2.07E−07 AC153955.2 13.5 −1.76 −3.93 1.96E−06 1.55E−05 Ppp1r9a 128.9 −1.77 −2.16 2.22E−10 3.61E−09 Gm28050 11.2 −1.77 −2.76 8.49E−07 7.21E−06 Pilra 854.5 −1.78 −1.94 0 0 Trpm2 1260.6 −1.78 −1.96 0 6E−15 Lilra5 286.1 −1.78 −2.02 7.9E−14 2.05E−12 Ap3s1-ps2 15.1 −1.78 −2.77 7.4E−07 6.37E−06 Slc22a23 202.4 −1.79 −1.98 0 2E−15 4930438A08Rik 145.8 −1.79 −2.11 2.09E−10 3.43E−09 A930030B08Rik 34.4 −1.79 −2.41 3.65E−08 4.02E−07 Ptgds 5.4 −1.79 −5.45 1.85E−07 1.79E−06 Vstm4 221 −1.8 −2.08 3.94E−13 9.46E−12 Gm9889 639.6 −1.81 −1.87 0 0 Pira2 53.5 −1.81 −2.39 3.64E−09 4.77E−08 Six4 17.7 −1.81 −2.59 2.33E−07 2.2E−06 Gm7860 120.6 −1.82 −1.97 0 0 B230303O12Rik 93.4 −1.82 −1.99 0 0 Cadm1 1067.9 −1.82 −1.99 0 0 Mertk 1388.9 −1.82 −2.24 2.24E−10 3.64E−09 Mmp12 54 −1.82 −2.56 4.76E−08 5.11E−07 Npc1l1 18.3 −1.82 −2.72 2E−07 1.92E−06 Sema6a 113.4 −1.83 −2.2 1.34E−11 2.65E−10 Trpv4 50.5 −1.83 −2.26 1.61E−10 2.68E−09 Snx31 36.9 −1.85 −2.5 4.1E−09 5.31E−08 Plch2 20.7 −1.85 −2.61 3.52E−08 3.9E−07 Jag2 544.2 −1.86 −1.97 0 0 Fst 29.8 −1.86 −2.48 1.16E−08 1.38E−07 Apol8 1161.9 −1.87 −1.95 0 0 Siglece 886.5 −1.88 −2.03 0 0 Tbc1d9 512.6 −1.88 −2.05 0 0 Tcf712 320.1 −1.88 −2.17 7.7E−14 2.03E−12 Pygm 1170.9 −1.89 −2 0 0 Gm5608 44.9 −1.89 −2.41 1.16E−09 1.65E−08 Gm38405 61.2 −1.9 −2.33 5.15E−11 9.19E−10 Gm13830 33 −1.9 −2.36 3.07E−10 4.85E−09 Sash1 878.3 −1.91 −2.13 0 0 Dnah2 262.4 −1.91 −2.26 3.83E−13 9.2E−12 Gm6377 147.2 −1.91 −2.41 6.81E−11 1.19E−09 Cbln1 33.6 −1.92 −2.75 2.21E−09 3E−08 Zfp819 24.1 −1.93 −2.62 5.98E−09 7.49E−08 AC160028.2 11.6 −1.94 −3.91 2.08E−07 1.99E−06 Tenm4 307.5 −1.95 −2.18 0 1E−15 Dlc1 173.9 −1.95 −2.23 1E−15 4.2E−14 Cd209a 127.2 −1.95 −2.5 5.42E−11 9.63E−10 Pilrb1 346.4 −1.96 −2.22 0 3E−15 Aspa 38.6 −1.97 −2.81 9.1E−10 1.31E−08 Abcc3 2372 −1.98 −2.14 0 0 Tex45 736.4 −1.98 −2.15 0 0 Rnf150 123.1 −1.98 −2.22 0 0 Cd300e 272.8 −1.98 −2.43 1.21E−12 2.77E−11 2900052N01Rik 111.1 −2.01 −2.36 7E−15 1.96E−13 Lrp1 4560.8 −2.04 −2.28 0 0 Gpd1 933.9 −2.05 −2.29 0 0 Fam71a 57.8 −2.05 −2.6 1.94E−11 3.73E−10 Mybpc2 29.1 −2.06 −3.63 9.03E−09 1.09E−07 Itgad 5960.5 −2.07 −2.28 0 0 Cxcl1 159.6 −2.08 −2.59 1.52E−12 3.44E−11 Prss29 62.2 −2.09 −2.5 4E−15 1.24E−13 Pilrb2 349.2 −2.1 −2.38 0 0 Gm10605 75.3 −2.1 −2.44 1E−15 4.2E−14 Tecta 37.6 −2.1 −2.63 7.07E−12 1.46E−10 Adam23 301.5 −2.13 −2.37 0 0 Cbr2 76.5 −2.15 −3.07 5.98E−11 1.06E−09 Spic 2050.5 −2.16 −2.37 0 0 Sema6d 939.7 −2.17 −2.48 0 0 Hmox1 16492.8 −2.19 −2.65 4E−15 1.36E−13 Tgfb2 26.2 −2.19 −2.92 4.6E−12 9.71E−11 Fcna 5828.3 −2.21 −2.4 0 0 Col14a1 699.7 −2.37 −2.68 0 0 Wisp2 41.1 −2.37 −3.69 2.46E−12 5.41E−11 Ptprm 389.7 −2.42 −2.7 0 0 Hs3st2 297.9 −2.45 −2.9 0 0 Adgre4 851.8 −2.47 −2.72 0 0 AC166361.2 101 −2.48 −2.78 0 0 Akr1b7 148.5 −2.51 −2.99 0 0 Gdf15 168.7 −2.59 −3.42 0 5E−15 Nfasc 204.4 −2.61 −3.25 0 0 Il1a 348.3 −2.63 −3.24 0 0 Fjx1 45.8 −2.75 −4.7 7E−15 2.03E−13
TABLE-US-00042 TABLE 4 The SD expressed genes list for SV + α4-1BB vs. SV group by RNA-Seq (q < 0.05, Log2FC ≥ 1 and Log2FC ≤ −1). gene baseMean log2FC log2FCunshrunk pvalue padj Ret 794.7 3.23 4.01 0 0 Gzmk 1785.2 2.77 3.04 0 0 Ermn 17.7 2.73 4.67 1.64E−13 2.4E−11 Ccl8 29.5 2.55 3.64 1.07E−11 9.75E−10 Wdr95 226 2.44 2.58 0 0 Ociad2 184.7 2.4 2.5 0 0 Col6a5 17.7 2.39 5.83 3.12E−10 1.88E−08 Trp73 22 2.15 3.6 9.67E−09 4.02E−07 Ncald 297.2 2.11 2.28 0 0 Gzmb 4113.9 2.11 2.3 0 0 Wipf3 37.6 2.1 2.84 2.82E−11 2.25E−09 2900011O08Rik 14.8 2.04 2.95 8.03E−09 3.4E−07 Klrg1 746.6 2.03 2.13 0 0 Clip4 39.8 1.98 2.46 1.07E−10 7.2E−09 Cd70 12.5 1.98 3.01 2.87E−08 1.05E−06 Adgrg1 449.6 1.93 2.06 0 0 Ccl5 22142.8 1.91 2.08 0 0 Ccr5 1338.8 1.89 1.96 0 0 Faxc 12.4 1.88 3.08 3.97E−07 1.08E−05 Dpysl5 94.9 1.84 2.16 2.13E−11 1.76E−09 Gm6637 196.3 1.83 2.02 3E−15 7.75E−13 Mpl 45.7 1.8 2.67 8.7E−07 2.14E−05 Cdkn2a 59.4 1.79 2.09 6.97E−11 5.07E−09 1700011L03Rik 6.7 1.77 6.04 2.28E−06 4.92E−05 Treml1 31.4 1.75 2.44 6.78E−07 1.73E−05 Ccr2 1142.1 1.74 1.86 0 0 Saa3 14.8 1.71 5.22 3.99E−06 7.95E−05 Hist1h1b 56.5 1.7 1.96 2.2E−09 1.07E−07 Osr2 54.7 1.69 2.19 3.53E−07 9.87E−06 Col6a1 15.6 1.69 4.32 7.89E−06 0.000144 Tff1 8.6 1.69 3.25 8.36E−06 0.000151 Fam57b 23.3 1.68 5.02 4.51E−07 1.21E−05 Col3a1 82.1 1.68 3.39 9.31E−06 0.000166 Cldnd2 53.5 1.67 1.88 1.05E−11 9.69E−10 Col6a2 16.9 1.67 3.3 1.11E−05 0.000192 Insrr 64.7 1.62 1.77 7.83E−13 9.25E−11 Dixdc1 18.6 1.62 2.45 5.33E−06 0.000102 Gm33460 48.9 1.61 1.8 6.88E−11 5.04E−09 Csf2 72.9 1.61 1.86 3.27E−09 1.52E−07 Gcg 62.2 1.61 3.73 1.52E−05 0.000252 Nkg7 8456.1 1.57 1.62 0 0 Tmem40 47.5 1.57 1.98 8.68E−07 2.14E−05 Stk32c 341 1.55 1.64 0 1E−15 Serpine2 31.1 1.55 2.06 2.38E−06 5.09E−05 Wdr31 15.1 1.55 2.2 1.3E−05 0.00022 S100a4 1170.3 1.54 1.73 2.18E−10 1.37E−08 AA467197 30.3 1.54 1.86 3.68E−07 1.02E−05 Dcn 49 1.54 2.29 5.15E−06 9.93E−05 Gp1bb 21.6 1.54 2.35 3.11E−05 0.000458 Osbpl3 1358.5 1.52 1.57 0 0 Smpdl3b 185.8 1.52 1.62 6E−15 1.27E−12 Gldc 15.3 1.51 1.94 9.21E−06 0.000165 Arsb 1795.9 1.5 1.59 0 2E−15 Bspry 174.2 1.5 1.74 3.88E−08 1.38E−06 Gm15056 28.9 1.5 2.19 4.69E−05 0.000651 Esm1 680.1 1.49 1.62 2.19E−13 3.05E−11 Pif1 204 1.49 1.64 3.87E−11 2.98E−09 2310031A07Rik 64.6 1.49 1.87 1.65E−06 3.7E−05 Pglyrp1 1046.5 1.48 1.61 9.35E−13 1.08E−10 Slc35d3 110.5 1.46 1.56 3.8E−14 6.51E−12 Pbk 107.5 1.46 1.55 8.9E−14 1.4E−11 Gm2788 29.7 1.46 1.78 1.1E−06 2.61E−05 Slc16a11 9.1 1.46 2.52 9.04E−05 0.001144 Miat 31.2 1.45 1.67 5.48E−08 1.88E−06 Samd14 203.2 1.44 1.65 2.06E−08 8.04E−07 Tnfsf4 81.6 1.44 1.71 2.52E−07 7.28E−06 Gp5 24.7 1.44 1.94 1.94E−05 0.000307 Kcnj5 5.3 1.44 3.82 6.73E−05 0.000888 Vax2 12.7 1.43 2.3 0.00012 0.001443 Car5b 136 1.42 1.49 0 7.2E−14 Reg2 5.6 1.42 5.34 5.5E−06 0.000105 Tpbg 19.3 1.42 2.07 7.65E−05 0.00099 Pf4 162.2 1.42 2.19 0.000132 0.001566 Trpc6 7.4 1.42 2.85 0.000145 0.001696 Ppbp 30.6 1.41 1.97 6.29E−05 0.000839 Adap1 1257.2 1.4 1.48 1E−15 2.09E−13 Kif2c 341.3 1.4 1.48 4E−15 8.96E−13 Tff3 16.7 1.4 1.76 1.49E−05 0.000248 Muc13 227 1.39 1.53 8.75E−10 4.68E−08 Serpina3h 8.8 1.39 2.39 0.000211 0.002313 Rgs16 7742.7 1.38 1.44 0 0 Fhl2 217.6 1.38 1.45 0 2.7E−14 Serping1 49.6 1.38 1.61 2.11E−07 6.25E−06 Slc22a3 85.3 1.38 1.65 1.66E−06 3.71E−05 Nfe2 91.3 1.38 1.81 4.07E−05 0.000577 Igf2bp3 26.6 1.37 1.7 2.05E−05 0.000323 Ppp1r3g 7.3 1.37 2.61 0.000309 0.003167 Map6 151 1.36 1.45 4.41E−13 5.67E−11 Fkbp10 29.4 1.36 1.89 6.66E−05 0.00088 Tuba8 42.2 1.36 1.95 0.000162 0.00185 Mmrn1 13.3 1.36 1.98 0.000187 0.002084 Hist1h2ag 6.4 1.36 2.16 0.000327 0.003318 Rasgef1a 270.7 1.34 1.42 4E−15 8.29E−13 Fam81a 55.4 1.34 1.55 1.08E−06 2.55E−05 Col1a2 95 1.34 1.73 2.79E−05 0.000418 Fhl1 19.9 1.34 1.9 0.000148 0.001721 Fam19a3 168.7 1.33 1.48 2.06E−08 8.04E−07 Cdk1 1228.8 1.32 1.41 5.17E−13 6.5E−11 1700001O22Rik 140.3 1.32 1.42 7.29E−11 5.24E−09 Pimreg 230 1.32 1.42 1.77E−10 1.14E−08 F2rl2 42.8 1.32 1.52 1.19E−06 2.78E−05 Dach1 18.3 1.32 1.82 0.000178 0.002004 Cenpf 495.6 1.31 1.39 6.5E−14 1.05E−11 Tpx2 1113.7 1.31 1.39 1.56E−12 1.7E−10 Hmmr 311.7 1.31 1.42 2.97E−10 1.8E−08 Tubb1 17.5 1.31 1.94 0.000239 0.002557 Upk3b 15.3 1.31 2.92 0.000536 0.005053 Kif18b 606.6 1.3 1.37 1.37E−13 2.06E−11 Adgrg7 5.3 1.3 3.04 0.00033 0.003346 Cep55 503.9 1.29 1.36 1.3E−12 1.42E−10 Tpsab1 262.4 1.29 1.5 4E−06 7.97E−05 Unc5b 14.9 1.29 1.8 0.000177 0.001988 Sytl2 1359.2 1.28 1.34 1.2E−14 2.26E−12 Kif14 299.1 1.28 1.36 6.35E−11 4.68E−09 Tg 98.4 1.28 1.39 2.03E−09 9.93E−08 Ube2c 1391 1.28 1.4 6.71E−09 2.91E−07 Ifng 1413.7 1.28 1.45 2.03E−07 6.03E−06 Angpt1 63.2 1.28 1.48 3.02E−06 6.25E−05 Aunip 24.6 1.28 1.61 9.97E−05 0.00124 Birc5 1540.7 1.27 1.41 2.84E−08 1.05E−06 AC153938.2 40.5 1.27 1.51 9.04E−06 0.000162 Gng3 34.8 1.27 1.49 1.41E−05 0.000237 Robo3 27.3 1.27 1.51 2.28E−05 0.000357 Myct1 34.7 1.27 1.65 0.000137 0.001615 Kif22 1022.2 1.26 1.35 3.03E−11 2.39E−09 Rad51 401.4 1.26 1.34 5.95E−11 4.4E−09 Havcr2 486.2 1.26 1.36 1.36E−10 9.01E−09 S100a6 3227.2 1.26 1.37 1.24E−09 6.42E−08 Neurl1b 49.9 1.26 1.52 2.54E−05 0.000389 Irx3 8.6 1.26 2.06 0.000738 0.006563 Scrn1 9.5 1.26 2.43 0.000777 0.006836 Depdc1b 350.8 1.25 1.32 7.29E−12 6.94E−10 Prc1 830.9 1.25 1.36 9.49E−10 5E−08 Lxn 79 1.25 1.35 3.32E−09 1.53E−07 Ccnb1 160.8 1.25 1.37 1.44E−08 5.81E−07 Ccna2 1680.2 1.24 1.3 7E−15 1.41E−12 Anxa2 5777.8 1.24 1.34 3.39E−10 2.01E−08 Gzma 3261.2 1.24 1.86 0.000818 0.007121 Shcbp1 274.8 1.23 1.29 2.78E−13 3.78E−11 Cdca8 1251.5 1.23 1.3 2.54E−12 2.68E−10 2610318N02Rik 193.2 1.23 1.32 8.3E−10 4.48E−08 Bst1 74.2 1.23 1.33 7.18E−09 3.08E−07 Sgo2a 143.4 1.23 1.33 9.33E−09 3.88E−07 Lrr1 59 1.23 1.37 8.05E−07 1.99E−05 Epas1 1633 1.23 1.59 0.000164 0.001873 Plppr3 42.4 1.23 1.76 0.000686 0.006205 Dapk2 315.5 1.22 1.27 0 7.7E−14 Aurkb 806.6 1.22 1.28 4.93E−13 6.25E−11 Plk1 794.8 1.22 1.3 3.01E−11 2.38E−09 Heatr9 204.6 1.22 1.36 3.37E−07 9.5E−06 Npy 11.8 1.22 1.86 0.001046 0.008713 Myrf 11.2 1.22 2.86 0.001338 0.010572 Chsy1 2251.6 1.21 1.27 3E−15 6.66E−13 Mxd3 280.1 1.21 1.26 2.7E−14 4.71E−12 Sapcd2 275.5 1.21 1.3 1.06E−09 5.54E−08 Troap 236.4 1.21 1.31 6.8E−09 2.94E−07 Tigit 2942.9 1.21 1.33 3.76E−08 1.35E−06 Rtkn 29.5 1.21 1.48 5.85E−05 0.000791 Alox12 39.7 1.21 1.5 7.16E−05 0.000937 Il13 60.8 1.21 1.61 0.000618 0.005699 Hist1h3g 9.3 1.21 1.63 0.000849 0.007357 Cdca5 791.4 1.2 1.25 0 1.5E−14 Gimap7 2437.5 1.2 1.27 1.58E−11 1.35E−09 Ccnb2 1255.4 1.2 1.28 8.31E−11 5.8E−09 Fam78b 52.7 1.2 1.45 1.68E−05 0.000274 Gm9531 16 1.2 1.66 0.000496 0.004738 Tmem98 10.9 1.2 2.01 0.001307 0.010371 Eomes 4109.7 1.19 1.22 0 0 Penk 1018 1.19 1.26 1.11E−11 9.94E−10 Serpinb6b 1199 1.19 1.26 1.24E−11 1.08E−09 Prr11 288 1.19 1.32 2.76E−07 7.89E−06 Ica1 85.1 1.19 1.38 6.49E−06 0.000121 Gm4841 29.9 1.19 1.54 0.000218 0.002367 Fbxo41 15.3 1.19 1.51 0.00028 0.002912 Col6a6 6.3 1.19 3.11 0.001409 0.011028 Cst7 1893.9 1.18 1.22 0 1.5E−14 Top2a 4726.3 1.18 1.23 0 1.3E−13 Ncaph 822.4 1.18 1.24 3.2E−14 5.46E−12 Cdca2 444.5 1.18 1.24 1.09E−11 9.85E−10 Rrm2 1718.2 1.18 1.26 3.64E−10 2.15E−08 Rad54l 350.2 1.18 1.27 2.64E−09 1.27E−07 Ttk 211.5 1.18 1.27 4.53E−09 2.04E−07 BC030867 129.6 1.18 1.27 2.3E−08 8.82E−07 Cdc25c 143.9 1.18 1.3 5.8E−07 1.52E−05 Rai14 77.8 1.18 1.34 2.2E−06 4.79E−05 Hist1h3c 11.8 1.18 1.67 0.001203 0.009747 Gbp11 355.1 1.17 1.23 2.77E−11 2.23E−09 Foxd2os 95 1.17 1.24 8.95E−11 6.2E−09 Fignl1 145.7 1.17 1.23 1.17E−10 7.79E−09 Nek2 554.5 1.17 1.26 3.39E−09 1.56E−07 E2f8 535.1 1.17 1.27 3.38E−08 1.23E−06 C78197 19.1 1.17 1.65 0.00074 0.006571 Mki67 5899.1 1.16 1.24 4.42E−09 1.99E−07 E2f7 275.3 1.16 1.26 5.55E−08 1.9E−06 Spp1 51 1.16 1.36 4.36E−05 0.000612 Gp9 24.8 1.16 1.46 0.000374 0.003703 Vash1 14.6 1.16 1.66 0.001212 0.009798 Gm867 11.8 1.16 1.91 0.001595 0.012127 Nlrp6 5.5 1.16 3.11 0.002039 0.014755 Tyms 809.6 1.15 1.19 0 7.4E−14 Espl1 809.6 1.15 1.22 2.11E−11 1.75E−09 Ncapg 383.1 1.15 1.22 8.97E−10 4.77E−08 Ckap2l 455.4 1.15 1.24 2.19E−08 8.5E−07 Gm12250 177.3 1.15 1.28 5.22E−07 1.38E−05 Spns2 183.2 1.15 1.38 6.6E−05 0.000874 Il20ra 9.2 1.15 1.8 0.001826 0.01357 Nusap1 813.1 1.14 1.19 1.06E−12 1.21E−10 Serpinb9 1224.7 1.14 1.21 1.43E−11 1.24E−09 Spag5 1183.2 1.14 1.2 3.25E−11 2.54E−09 Cenpe 685.5 1.14 1.21 1.07E−10 7.2E−09 Bub1 362.3 1.14 1.22 3.72E−09 1.7E−07 Serpina3f 452 1.14 1.24 7.57E−08 2.52E−06 Ccl4 2257.9 1.14 1.43 0.000269 0.002817 Ckap2 394.5 1.13 1.17 9E−15 1.82E−12 Cdkn3 129.2 1.13 1.18 1.04E−10 7.09E−09 Sgo1 162.8 1.13 1.19 6.38E−10 3.57E−08 Serpina3g 2916.5 1.13 1.23 3.48E−08 1.25E−06 Ccl1 31 1.13 1.43 0.000689 0.006224 Prf1 1704.5 1.12 1.14 0 0 Spc24 506 1.12 1.16 1.96E−13 2.79E−11 Kif11 1109.9 1.12 1.17 2.93E−13 3.94E−11 Bub1b 1344.3 1.12 1.18 7.17E−11 5.17E−09 Lgals1 11014.9 1.12 1.18 2.68E−10 1.64E−08 Esco2 149.5 1.12 1.21 1.11E−07 3.55E−06 Tek 24.8 1.12 1.43 0.000437 0.004239 Msantd3 9.2 1.12 1.65 0.002189 0.015686 Acot7 2318.6 1.11 1.17 2.16E−11 1.77E−09 Ttn 292.1 1.11 1.21 8E−08 2.66E−06 Nuf2 279.6 1.11 1.21 5.67E−07 1.49E−05 Rgs18 52.3 1.11 1.38 0.00036 0.003592 Dio2 18.9 1.11 1.6 0.001465 0.011345 Pcdh7 8.7 1.11 1.82 0.002625 0.018256 Kif4 650.2 1.1 1.15 1.06E−11 9.7E−10 Clspn 637.1 1.1 1.17 1.4E−09 7.11E−08 Dyrk3 249.1 1.1 1.21 4.14E−07 1.12E−05 1700020L24Rik 90.2 1.1 1.23 4.95E−06 9.58E−05 Lmtk3 107.1 1.1 1.28 4.1E−05 0.00058 Ms4a3 31.1 1.1 1.55 0.002955 0.019997 Asf1b 1276.4 1.09 1.14 1.09E−12 1.23E−10 Pask 202.9 1.09 1.15 7.34E−10 4.02E−08 Cit 784.3 1.09 1.16 2.83E−09 1.35E−07 Pclaf 522.9 1.09 1.19 6.53E−07 1.68E−05 Klrc1 236.6 1.09 1.2 1.62E−06 3.64E−05 Rnase2a 5.3 1.09 1.76 0.003732 0.024243 6530402F18Rik 553.7 1.08 1.1 0 0 Cdc45 628.7 1.08 1.11 0 2E−15 Podnl1 2382.6 1.08 1.12 4.8E−14 7.96E−12 Lilr4b 1553.9 1.08 1.16 4.21E−08 1.49E−06 Perp 113.8 1.08 1.17 9.07E−08 2.95E−06 Aspm 319.4 1.08 1.17 2.91E−07 8.3E−06 Gzmc 56.6 1.08 1.32 0.000285 0.002956 Clstn3 34.6 1.08 1.39 0.000965 0.008168 Traj35 15.6 1.08 1.44 0.001132 0.009302 Pcp4l1 21 1.08 1.56 0.002232 0.015944 Serpina3n 16.7 1.08 1.62 0.002935 0.01989 Chil3 42.4 1.08 1.54 0.003165 0.021138 AC131739.1 7.2 1.08 1.94 0.003928 0.025182 Kif20a 898.5 1.07 1.13 3.27E−10 1.95E−08 Tjp2 411.7 1.07 1.14 2.03E−08 7.97E−07 Gm5391 5.3 1.07 2.14 0.004733 0.02915 Cdc20 1268.9 1.06 1.1 1.22E−13 1.87E−11 Kcnk5 399.5 1.06 1.1 6.1E−13 7.51E−11 Psrc1 122.1 1.06 1.12 2.48E−09 1.19E−07 Iqgap3 284.2 1.06 1.13 7.9E−09 3.37E−07 Cks1b 772.5 1.06 1.14 6.32E−08 2.16E−06 Grb10 61 1.06 1.32 0.000464 0.004477 Ptger3 20.8 1.06 1.62 0.004232 0.026687 Cdkn2c 421.3 1.05 1.08 8.39E−13 9.78E−11 Ndc80 345.5 1.05 1.1 1.74E−10 1.12E−08 S100a10 7676.1 1.05 1.1 5.19E−10 2.98E−08 Mcm10 477.4 1.05 1.11 1.26E−09 6.54E−08 Fut7 69.8 1.05 1.18 2.47E−05 0.000382 Tfr2 139.5 1.05 1.34 0.001188 0.009649 Hist1h2bm 8.5 1.05 1.8 0.005816 0.034129 Stmn1 257.1 1.04 1.1 2.99E−09 1.41E−07 Ska1 210.9 1.04 1.13 4.21E−06 8.29E−05 Klrc2 53.2 1.04 1.17 2.62E−05 0.000399 Cym 46.2 1.04 1.31 0.000743 0.006595 Hist1h2ai 9.8 1.04 1.51 0.004383 0.027452 Phlda3 37.7 1.03 1.2 0.000147 0.00171 Gm14148 21.4 1.03 1.25 0.000572 0.005313 Hist1h2bj 17.7 1.03 1.24 0.001234 0.009915 a 12.6 1.03 1.58 0.004957 0.030315 4930519L02Rik 9.9 1.03 1.87 0.006787 0.038499 Knstrn 855.1 1.02 1.05 5E−15 1.13E−12 Chst11 1091.1 1.02 1.05 1.6E−14 2.94E−12 Spdl1 204.5 1.02 1.07 3.91E−10 2.29E−08 Melk 329.8 1.02 1.07 7E−10 3.88E−08 Kifc1 310.5 1.02 1.09 8.1E−08 2.69E−06 Anln 217.2 1.02 1.1 1.27E−06 2.94E−05 Gm17745 84 1.02 1.11 1.34E−06 3.07E−05 Runx2os1 41.2 1.02 1.28 0.001157 0.009439 H1fx 65.9 1.02 1.27 0.001224 0.00986 Col1a1 89.2 1.02 1.37 0.002114 0.015218 Slc30a2 29 1.02 1.34 0.002562 0.017915 Mt3 18.3 1.02 1.35 0.003871 0.024928 Cxcr6 818 1.01 1.04 7.2E−14 1.15E−11 Kif15 595.3 1.01 1.07 1.32E−08 5.37E−07 Ect2 255.1 1.01 1.12 1.58E−05 0.00026 Tex15 58.4 1.01 1.12 4.2E−05 0.000591 Ddah2 90 1.01 1.15 6.54E−05 0.000868 G0s2 77.4 1.01 1.24 0.000666 0.006046 Hist1h3a 32.2 1.01 1.25 0.001415 0.011057 Pde10a 17 1.01 1.3 0.002501 0.017557 Morc1 8.4 1.01 2.01 0.007372 0.040918 Lmnb1 6788.3 1 1.03 5.3E−14 8.63E−12 Bard1 316.8 1 1.05 1.61E−10 1.06E−08 Ska3 252.1 1 1.05 4.68E−10 2.72E−08 Tk1 1004.9 1 1.05 5.56E−10 3.14E−08 Sytl3 850.3 1 1.09 2.44E−06 5.19E−05 Bag2 63 1 1.1 1.06E−05 0.000185 F10 33.6 1 1.38 0.004704 0.029055 C1s1 21.8 1 1.52 0.005149 0.031153 Usp50 16.7 1 1.55 0.006828 0.038667 Dlk2 11.4 1 1.71 0.0082 0.044224 Efna5 6.6 1 1.98 0.00842 0.045107 Ptk2 617.3 −1 −1.03 0 1.3E−13 Myo10 1090.4 −1 −1.06 3.72E−08 1.34E−06 Tmem8b 139.4 −1 −1.09 8.06E−07 1.99E−05 Tgm2 2908.8 −1 −1.09 1.15E−06 2.7E−05 Dysf 302 −1 −1.1 3.86E−06 7.73E−05 Mreg 104.8 −1 −1.11 7.36E−06 0.000136 Fam167a 155 −1 −1.11 1.28E−05 0.000218 Adam33 60.3 −1 −1.17 0.00027 0.002823 Eps8 43.8 −1 −1.19 0.000346 0.003473 Syt3 18.7 −1 −1.32 0.001772 0.013249 Rubcnl 142.1 −1 −1.34 0.001911 0.014015 Napb 20.4 −1 −1.57 0.004628 0.02868 Sat2 9 −1 −1.91 0.008166 0.044102 Tsix 8.2 −1 −2.12 0.008513 0.045495 Gm42870 22.1 −1 −2.22 0.008535 0.045552 Myo9a 1226.4 −1.01 −1.06 1.33E−09 6.81E−08 Tns3 884 −1.01 −1.1 6.53E−07 1.68E−05 Nat8l 123.4 −1.01 −1.11 2.77E−06 5.81E−05 Col17a1 97 −1.01 −1.13 1.15E−05 0.000198 Adrb1 207 −1.01 −1.15 3.23E−05 0.00047 Sh3tc1 174.9 −1.01 −1.16 6.02E−05 0.000809 Abca9 130.3 −1.01 −1.29 0.000973 0.008226 Igkv6-25 29.5 −1.01 −1.73 0.006776 0.038448 Gm36159 8.5 −1.01 −2.04 0.007309 0.040646 Gm8463 8.7 −1.01 −3.66 0.00768 0.042258 Ebf1 216.1 −1.01 −2.27 0.007802 0.042823 Tbc1d8 696.1 −1.02 −1.12 1.77E−06 3.92E−05 Adgrl2 148.4 −1.02 −1.13 3.22E−06 6.58E−05 Ppp1r14a 48.4 −1.02 −1.4 0.00191 0.014015 Padi4 34.4 −1.02 −1.28 0.002072 0.014949 Gm30292 19.5 −1.02 −1.37 0.00212 0.01525 Slc13a2 13.1 −1.02 −1.9 0.005131 0.031092 Epha4 19.9 −1.02 −1.81 0.005323 0.031904 Stfa3 14.7 −1.02 −1.71 0.005735 0.03378 Gm25776 9.5 −1.02 −1.77 0.00584 0.034194 Crisp3 7.4 −1.02 −4.01 0.00631 0.03631 Igha 3248.3 −1.02 −1.95 0.006417 0.036825 Igkv1-135 261.8 −1.02 −1.85 0.006595 0.037626 Pax5 1019.4 −1.02 −2.07 0.007319 0.040689 Plxna1 900.2 −1.03 −1.11 8.86E−08 2.89E−06 Cpq 349.9 −1.03 −1.12 6.17E−07 1.61E−05 Hck 1125 −1.03 −1.12 6.33E−07 1.64E−05 Pnck 68.8 −1.03 −1.16 6.44E−06 0.000121 Nectin4 97.5 −1.03 −1.18 5.48E−05 0.000746 Cd180 364.5 −1.03 −1.2 6.2E−05 0.000829 Btnl2 69.3 −1.03 −1.22 0.000154 0.001777 Zfyve9 64.7 −1.03 −1.3 0.000587 0.00543 Krt80 33 −1.03 −1.33 0.000948 0.00806 Cmtm8 27.8 −1.03 −1.34 0.000991 0.008347 Adgra2 49.3 −1.03 −1.44 0.001853 0.013683 Tnnc2 16.7 −1.03 −1.54 0.002356 0.016673 Klhl14 29.4 −1.03 −1.95 0.005716 0.033707 Rasgrp3 260.5 −1.03 −1.87 0.006222 0.035888 Tcn2 1368.6 −1.04 −1.08 1E−15 1.65E−13 Ppp1r32 136.8 −1.04 −1.13 2.11E−07 6.25E−06 Fcgrt 2555.6 −1.04 −1.13 5.87E−07 1.54E−05 Nphp3 103.3 −1.04 −1.16 1.69E−06 3.77E−05 Cd300lf 581.8 −1.04 −1.16 3.88E−06 7.77E−05 Ly86 762.3 −1.04 −1.17 1.71E−05 0.000278 Clec12a 552.3 −1.04 −1.2 3.22E−05 0.00047 Arhgap32 163.9 −1.04 −1.22 6.6E−05 0.000874 Eva1a 33 −1.04 −1.25 0.000199 0.002202 Wtip 28.7 −1.04 −1.44 0.00145 0.011259 B3gnt7 121.7 −1.04 −1.43 0.001841 0.013654 Npc1l1 18.3 −1.04 −1.68 0.003219 0.021411 Prex2 8.7 −1.04 −2.21 0.005599 0.03317 Cd209c 9.8 −1.04 −2.31 0.005938 0.034665 Zbtb10 1450.8 −1.05 −1.09 3.33E−12 3.42E−10 Pla2g7 1374.2 −1.05 −1.13 6.38E−08 2.18E−06 Fcgr1 319.2 −1.05 −1.15 3.57E−07 9.94E−06 Pla2g15 1269.3 −1.05 −1.15 5.99E−07 1.57E−05 B230303O12Rik 93.4 −1.05 −1.16 7.3E−07 1.84E−05 Nr3c2 42.8 −1.05 −1.28 0.000159 0.001828 Gpr4 64.4 −1.05 −1.29 0.00028 0.002912 Chn1 24 −1.05 −1.26 0.000645 0.005891 Bmf 141.4 −1.05 −1.4 0.000933 0.007945 Gm44860 11.3 −1.05 −2.25 0.005162 0.031194 Mcf2 7.3 −1.05 −3.2 0.005808 0.034089 Hebp1 934.9 −1.06 −1.19 4.49E−06 8.77E−05 Susd4 89.1 −1.06 −1.2 1.03E−05 0.000181 Tspan15 134 −1.06 −1.22 1.65E−05 0.00027 Fpr1 89.9 −1.06 −1.32 0.000293 0.003019 Ighv2-3 64.5 −1.06 −1.36 0.000905 0.007792 Alas2 140.4 −1.06 −1.75 0.004005 0.025599 Paqr6 11.7 −1.06 −1.97 0.004373 0.02741 Gm15929 8.8 −1.06 −1.92 0.004709 0.029072 Gm37829 7 −1.06 −2.2 0.004866 0.02984 Gm38160 15.5 −1.06 −2.07 0.004891 0.029962 Gm26575 11.1 −1.06 −2.25 0.004985 0.03041 Gm2814 9.6 −1.06 −2.68 0.005305 0.031827 Sort1 1028.3 −1.07 −1.19 9.44E−07 2.29E−05 Cdk14 85 −1.07 −1.26 6.08E−05 0.000815 Shank1 125.8 −1.07 −1.41 0.000743 0.006595 Ighv1-43 24.1 −1.07 −1.92 0.004221 0.026637 Ctsf 383.8 −1.08 −1.16 4.68E−09 2.1E−07 Tbxas1 561.4 −1.08 −1.17 1.11E−07 3.55E−06 Alpk1 263.7 −1.08 −1.18 2.53E−07 7.29E−06 Sccpdh 123.3 −1.08 −1.17 6.21E−07 1.61E−05 Lpl 1230.2 −1.08 −1.21 3.08E−06 6.34E−05 Stab2 1255.1 −1.08 −1.22 7.89E−06 0.000144 Apol9b 51.1 −1.08 −1.23 9.87E−06 0.000174 Gm4258 54.5 −1.08 −1.25 1.92E−05 0.000305 H2-Ea-ps 7790.9 −1.08 −1.36 0.000366 0.003633 Ciita 568.4 −1.08 −1.39 0.000641 0.005863 Igkv4-70 65.4 −1.08 −1.47 0.001124 0.009265 Ighv1-42 5.8 −1.08 −3.23 0.002259 0.016093 Igkv4-50 54.1 −1.08 −1.76 0.003011 0.020314 Cd86 1049.2 −1.09 −1.15 3.61E−11 2.81E−09 Fam43a 1414.6 −1.09 −1.18 3.94E−08 1.39E−06 Smagp 295.1 −1.09 −1.2 3.82E−07 1.05E−05 Zfhx3 113.3 −1.09 −1.24 6.09E−06 0.000115 Trim30b 52.4 −1.09 −1.36 0.000154 0.001778 Fst 29.8 −1.09 −1.52 0.000952 0.008075 Pigr 17.1 −1.09 −1.7 0.002701 0.018704 2010007H06Rik 20.7 −1.09 −1.99 0.003403 0.022397 Rgl1 1317.4 −1.1 −1.2 8.26E−08 2.73E−06 Clec4a2 262.2 −1.1 −1.26 1.09E−05 0.00019 Adhfe1 58 −1.1 −1.3 2.42E−05 0.000374 Iglv3 74.4 −1.1 −1.68 0.001978 0.014396 C130050O18Rik 95.9 −1.11 −1.26 1.45E−06 3.32E−05 Slpi 1443.3 −1.11 −1.38 0.00016 0.001838 Mybpc3 45.4 −1.11 −1.44 0.000231 0.002478 Adgrl3 33.2 −1.11 −1.64 0.001005 0.008438 Gm9530 13.7 −1.11 −1.85 0.001935 0.014156 Igkv17-127 57.8 −1.11 −2.86 0.003056 0.020527 4930426D05Rik 77.3 −1.11 −2.7 0.003313 0.021946 Fcer2a 783 −1.11 −2.3 0.003321 0.021992 Nfam1 713.9 −1.12 −1.19 1.76E−10 1.14E−08 Epb41l3 649.5 −1.12 −1.23 9.17E−08 2.97E−06 Naip5 181.7 −1.12 −1.27 2.06E−06 4.5E−05 Gas6 210.8 −1.12 −1.29 1.06E−05 0.000185 A530099J19Rik 38 −1.12 −1.84 0.001581 0.012052 0610040J01Rik 15.3 −1.12 −1.97 0.001998 0.014505 Gm17999 9.8 −1.12 −2.45 0.00274 0.018921 Gm14963 10.5 −1.12 −1.98 0.002748 0.018963 Tal2 7.8 −1.12 −2.87 0.002908 0.019726 Gm10605 75.3 −1.13 −1.35 2.32E−05 0.000361 Abcd2 85.6 −1.13 −1.35 3.96E−05 0.000563 Pcolce2 67.5 −1.13 −1.42 9.12E−05 0.001153 Pigz 58.4 −1.13 −1.4 0.000141 0.001652 Trf 681.7 −1.13 −1.49 0.000353 0.003532 A930030B08Rik 34.4 −1.13 −1.59 0.000525 0.004961 Mir5107 156.7 −1.13 −1.77 0.001511 0.011598 Kcnj2 25 −1.13 −2 0.001945 0.014221 Tlr7 305.4 −1.14 −1.22 3.03E−09 1.42E−07 Igsf6 661.8 −1.14 −1.24 3.88E−08 1.38E−06 Lrrc25 483.1 −1.14 −1.28 6.57E−07 1.69E−05 Ptpro 88.1 −1.14 −1.29 1.06E−06 2.52E−05 Tppp 109.8 −1.14 −1.29 1.47E−06 3.35E−05 Dll4 78 −1.14 −1.29 2.41E−06 5.14E−05 Snn 825.3 −1.14 −1.31 3.98E−06 7.95E−05 Pdzd2 59.3 −1.14 −1.35 1.39E−05 0.000234 Erbb2 135 −1.14 −1.33 1.55E−05 0.000255 Ctnnd2 131.9 −1.14 −1.44 0.000131 0.001557 Gm15930 22 −1.14 −1.73 0.001034 0.008627 Igkv8-30 318.2 −1.14 −1.89 0.002044 0.014786 Blk 523.7 −1.14 −1.98 0.002156 0.015487 Cyp4f37 6.6 −1.14 −2.97 0.002672 0.018535 Tcf4 708.9 −1.15 −1.26 2.31E−08 8.84E−07 C1qb 6167.6 −1.15 −1.28 3.36E−07 9.48E−06 Ccnd1 258 −1.15 −1.29 3.86E−07 1.05E−05 Cfap61 26 −1.15 −1.82 0.001029 0.008606 Hepacam2 34.3 −1.15 −2.23 0.00188 0.013838 Gm15880 16.2 −1.15 −2.16 0.002139 0.015378 Clec4a4 10.7 −1.15 −2.6 0.002248 0.01604 Fmnl2 329.1 −1.16 −1.29 1.74E−07 5.28E−06 Pdgfc 56.2 −1.16 −1.45 8.78E−05 0.001115 Pde8b 30.7 −1.16 −1.81 0.000914 0.007828 Gm5466 17.5 −1.16 −1.97 0.001427 0.011109 Lima1 405.9 −1.17 −1.27 4.02E−09 1.82E−07 Slc16a7 76.5 −1.17 −1.39 1.46E−05 0.000243 Snx24 100.2 −1.17 −1.4 1.79E−05 0.000288 Fcrl1 520.9 −1.17 −1.52 0.000191 0.002126 Plxnb3 46.1 −1.17 −1.66 0.000571 0.00531 Gm36937 12.9 −1.17 −2.24 0.001847 0.013668 Igkv5-39 123.1 −1.17 −2.24 0.00205 0.014817 Tnfrsf21 641.6 −1.18 −1.26 5.23E−11 3.91E−09 Syk 3325.1 −1.18 −1.29 1.05E−08 4.34E−07 Cmbl 316.4 −1.18 −1.31 3.55E−07 9.91E−06 AC166361.2 101 −1.18 −1.36 5.35E−07 1.42E−05 Stac2 76.6 −1.18 −1.55 0.000206 0.002258 Ighv2-6 141.1 −1.18 −1.53 0.000266 0.002791 Igkv4-63 73.9 −1.18 −1.74 0.000748 0.006628 Igkv9-124 50.6 −1.18 −2.27 0.001681 0.012661 Mpeg1 6302.5 −1.19 −1.28 3.51E−10 2.08E−08 Siglech 840.4 −1.19 −1.32 1.89E−07 5.64E−06 Ccdc148 86.4 −1.19 −1.48 4.04E−05 0.000573 Blnk 622 −1.19 −1.59 0.000221 0.002396 Ighv1-4 158 −1.19 −1.8 0.000906 0.007795 Siglecg 751.8 −1.19 −1.93 0.001034 0.008627 Slc6a1 17.6 −1.19 −2.21 0.001218 0.009819 Ighv9-2 13.7 −1.19 −2.05 0.001368 0.010761 Igkv4-58 47 −1.19 −2.02 0.001407 0.011025 Fam213b 477.2 −1.2 −1.33 6.6E−08 2.24E−06 Gm13710 186.2 −1.2 −1.39 3.19E−06 6.52E−05 S1pr3 58.4 −1.2 −1.43 8.88E−06 0.00016 Tecta 37.6 −1.2 −1.56 0.000104 0.001281 Fam135a 30.1 −1.2 −1.66 0.000222 0.002413 Gbgt1 24 −1.2 −1.71 0.000334 0.003374 AC153955.5 18.5 −1.2 −1.86 0.000622 0.005722 Trim7 268.2 −1.2 −1.88 0.000812 0.007083 Igkv6-23 42.9 −1.2 −1.99 0.001136 0.009317 Map3k9 162.8 −1.21 −1.3 9.73E−11 6.66E−09 Fndc7 27.5 −1.21 −1.78 0.00023 0.002473 Apoe 8629.4 −1.22 −1.32 4.19E−10 2.45E−08 Sirpa 4992.1 −1.22 −1.35 2.63E−08 9.78E−07 Cd300a 1109.4 −1.22 −1.35 3.42E−08 1.24E−06 Cystm1 143.7 −1.22 −1.4 5.65E−07 1.49E−05 Snta1 208.6 −1.22 −1.4 1.01E−06 2.43E−05 Trpv4 50.5 −1.22 −1.54 2.56E−05 0.000392 Lifr 153.4 −1.22 −1.49 2.67E−05 0.000404 Pcdhgb4 14.2 −1.22 −1.79 0.00053 0.005005 Sdc3 7230.4 −1.23 −1.34 1.71E−09 8.52E−08 Marcks 880 −1.23 −1.39 3.81E−07 1.04E−05 Flt3 441.7 −1.23 −1.43 2.6E−06 5.48E−05 Wdfy4 2179.7 −1.23 −1.51 1.94E−05 0.000307 Igkv5-45 19.6 −1.23 −2.23 0.001131 0.009302 H2-Ob 1767 −1.24 −1.32 1.21E−12 1.33E−10 Fgd2 1084.5 −1.24 −1.37 3.13E−08 1.14E−06 Dmpk 201.4 −1.24 −1.43 5.01E−07 1.34E−05 Ttc12 74.5 −1.24 −1.49 8.57E−06 0.000154 AC153955.2 13.5 −1.24 −3.15 0.000817 0.00712 Dennd5b 158.4 −1.24 −2.45 0.001058 0.008786 Ppfibp2 358.3 −1.25 −1.4 4.67E−08 1.62E−06 Gm15922 138.1 −1.25 −1.47 2E−06 4.38E−05 Slc1a3 115.6 −1.25 −1.56 1.64E−05 0.000269 Fam71a 57.8 −1.25 −1.63 5E−05 0.000691 Btnl4 51.4 −1.25 −1.87 0.000251 0.002666 Plxnb2 2017.4 −1.26 −1.36 2.1E−10 1.33E−08 Mafb 1846.3 −1.26 −1.39 6.8E−09 2.94E−07 Scamp5 313.9 −1.26 −1.38 8.04E−09 3.4E−07 Lpcat2 297.8 −1.26 −1.41 1.94E−08 7.66E−07 Prkcg 96.9 −1.26 −1.45 1.88E−07 5.63E−06 Cd300c2 673.6 −1.26 −1.44 3.62E−07 1E−05 Cecr6 48.6 −1.26 −1.51 3.93E−06 7.85E−05 Scn3a 17.9 −1.26 −1.92 0.000287 0.002968 A4galt 38.5 −1.26 −1.89 0.000339 0.003419 Unc5a 20.3 −1.26 −2.62 0.000665 0.006038 Dock4 301.1 −1.27 −1.39 2.01E−10 1.28E−08 C1qc 6828 −1.27 −1.42 4.33E−08 1.52E−06 Zfp366 189.3 −1.27 −1.44 6.67E−08 2.26E−06 Samd4 57.2 −1.27 −1.61 1.4E−05 0.000235 Cd209d 96.9 −1.27 −1.89 0.000206 0.002258 Ifi207 440.3 −1.28 −1.42 6.19E−09 2.71E−07 Glis3 183.7 −1.28 −1.48 3.46E−07 9.69E−06 Gpc4 55.1 −1.28 −1.58 6.38E−06 0.00012 Tgfb2 26.2 −1.28 −1.82 7.16E−05 0.000937 Ffar1 97.9 −1.28 −1.83 0.000194 0.002157 Epha2 215.5 −1.29 −1.42 1.19E−09 6.2E−08 Cd5l 2824.6 −1.29 −1.41 1.31E−09 6.73E−08 Nxpe5 131.7 −1.29 −1.49 3.09E−07 8.77E−06 Gm33280 43.4 −1.29 −1.78 7E−05 0.000918 Gm15448 29.6 −1.29 −1.86 0.000127 0.00152 Tlr13 195.6 −1.3 −1.4 5.26E−12 5.13E−10 Kcnk13 70 −1.3 −1.51 2.63E−07 7.54E−06 Rasal2 84.5 −1.3 −1.53 4.32E−07 1.17E−05 Cd300c 47.9 −1.3 −1.67 1.67E−05 0.000273 Gm14137 13.8 −1.3 −3.35 0.000624 0.005734 6430548M08Rik 386.7 −1.31 −1.4 5.27E−13 6.58E−11 C2 119.2 −1.31 −1.41 2.4E−11 1.95E−09 Fgd4 96.4 −1.31 −1.63 4.58E−06 8.9E−05 Gm14221 27.8 −1.31 −2.05 0.00018 0.002021 Gm28050 11.2 −1.31 −2.15 0.000277 0.002883 Il22ra2 7.5 −1.31 −3.06 0.000546 0.005125 Rims3 1029.1 −1.32 −1.41 7.3E−14 1.16E−11 I830077J02Rik 399 −1.32 −1.41 1.46E−12 1.59E−10 Cfp 5197 −1.32 −1.44 4.78E−10 2.76E−08 Sirpb1c 21.5 −1.32 −1.75 2.9E−05 0.000432 Adam11 386.6 −1.33 −1.39 0 1E−15 Hpgds 565.3 −1.33 −1.43 5.79E−12 5.61E−10 Hdac9 184.1 −1.33 −1.49 8.39E−09 3.53E−07 Clec4a1 389.4 −1.33 −1.52 6.73E−08 2.27E−06 Gm10552 10.1 −1.33 −2.86 0.000376 0.003714 Abcg3 1117.1 −1.34 −1.42 6E−15 1.18E−12 Slc7a7 700.4 −1.34 −1.45 1.16E−11 1.03E−09 Amz1 508.4 −1.34 −1.46 4.31E−11 3.29E−09 Pirb 1339.8 −1.34 −1.49 2.08E−09 1.01E−07 Cd14 1110.8 −1.34 −1.51 5.3E−09 2.36E−07 Cyp27a1 464.9 −1.34 −1.52 1.71E−08 6.82E−07 Clec4b1 78.8 −1.34 −1.73 1.22E−05 0.000208 Rasgef1b 1868 −1.35 −1.41 0 1E−15 Jup 1184.5 −1.35 −1.44 1.31E−13 1.98E−11 Grk3 1230.7 −1.35 −1.46 3.6E−12 3.63E−10 C1qa 7016.9 −1.35 −1.51 8.15E−09 3.43E−07 Dgki 117.3 −1.35 −1.56 3.91E−08 1.38E−06 Agap1 495.9 −1.36 −1.51 6.16E−10 3.46E−08 Timd4 240.3 −1.36 −1.53 7.81E−09 3.33E−07 Ighv1-7 114.3 −1.36 −1.76 1.71E−05 0.000278 Tlr8 86.3 −1.37 −1.62 2.21E−07 6.48E−06 Zfp608 304 −1.38 −1.52 1.86E−10 1.19E−08 Kif26a 36.7 −1.38 −2.16 8.08E−05 0.001037 Reln 18.1 −1.38 −2.59 0.000204 0.002246 Dhtkd1 7 −1.38 −3.09 0.000253 0.002684 Gm15848 16.2 −1.38 −3.38 0.00027 0.002823 Prkar1b 244.4 −1.39 −1.54 8.05E−11 5.67E−09 Slc16a9 181.6 −1.39 −1.59 1.74E−08 6.93E−07 Gfra4 95 −1.39 −1.61 2.35E−07 6.87E−06 Pid1 185.8 −1.39 −1.68 7.4E−07 1.86E−05 Apoc1 69.6 −1.39 −1.83 1.3E−05 0.00022 Scn4a 77.9 −1.39 −2.02 7.44E−05 0.000968 Ptgs1 1227.5 −1.4 −1.51 1.12E−12 1.26E−10 AC125351.1 47.4 −1.4 −1.8 2.46E−06 5.24E−05 Fstl4 14.3 −1.4 −2.76 0.000124 0.001486 Plbd1 1881.3 −1.41 −1.54 2.06E−11 1.72E−09 Gm15931 220.2 −1.41 −1.6 2.87E−09 1.36E−07 Tcf7l2 320.1 −1.41 −1.64 2.26E−08 8.71E−07 Capn9 80.5 −1.41 −1.69 1.32E−07 4.12E−06 March1 226 −1.41 −1.68 2.64E−07 7.58E−06 Mcc 21.2 −1.41 −2.32 6.53E−05 0.000866 Etv1 13.7 −1.41 −2.38 6.82E−05 0.000895 AC160028.2 11.6 −1.41 −3.13 0.000179 0.002013 Nav1 825.1 −1.42 −1.59 2.42E−10 1.5E−08 Igf1 580.6 −1.42 −1.61 3.17E−09 1.47E−07 Cpne8 29 −1.42 −1.91 1.06E−05 0.000185 Csf1r 9890.8 −1.43 −1.54 1.16E−13 1.79E−11 Hpgd 485.4 −1.43 −1.57 1.74E−11 1.47E−09 Tmem26 319.6 −1.43 −1.58 5.08E−11 3.83E−09 Prss29 62.2 −1.43 −1.75 1.22E−07 3.86E−06 Ighv5-2 17.8 −1.43 −3.08 0.000154 0.001777 Cd209b 9.6 −1.43 −3.28 0.00016 0.001835 Axl 7411.5 −1.44 −1.56 4.08E−13 5.33E−11 Tbc1d9 512.6 −1.44 −1.57 1.2E−12 1.33E−10 Plpp3 349.2 −1.44 −1.62 4.78E−10 2.76E−08 Clec4a3 317.3 −1.44 −1.61 4.9E−10 2.82E−08 Scnn1a 79.5 −1.44 −1.72 1.08E−07 3.49E−06 Jhy 47.7 −1.44 −2.65 9.59E−05 0.001207 Nr1d1 927.5 −1.45 −1.54 0 1.35E−13 Itga9 882.5 −1.45 −1.6 8.13E−12 7.66E−10 Slc45a3 1350.4 −1.45 −1.59 2.01E−11 1.68E−09 Clec4n 902.8 −1.45 −1.62 1.39E−10 9.13E−09 Lrp4 160.7 −1.45 −1.7 9.85E−09 4.07E−07 Cacna1e 284.9 −1.45 −1.73 1.14E−07 3.62E−06 Mmp12 54 −1.45 −2.08 1.42E−05 0.000237 P2ry13 230.8 −1.46 −1.59 5.57E−13 6.92E−11 Nuak1 190.3 −1.46 −1.6 6.64E−13 7.9E−11 Adap2 260.1 −1.46 −1.72 4.52E−08 1.58E−06 Adgrg6 43.3 −1.46 −1.97 4.05E−06 8.05E−05 Kcnj10 1374.3 −1.47 −1.58 4E−15 8.36E−13 Ppp1r9a 128.9 −1.47 −1.8 1.43E−07 4.44E−06 Rab30 116 −1.47 −2.11 1.86E−05 0.000297 Gfra2 1060.6 −1.48 −1.62 4.86E−12 4.82E−10 St6galnac2 280.3 −1.48 −1.68 7.6E−10 4.15E−08 2900052N01Rik 111.1 −1.48 −1.76 1.26E−08 5.15E−07 Slc8a1 117.6 −1.48 −1.88 7.25E−07 1.83E−05 Ighv1-39 28.6 −1.48 −2.7 9.84E−05 0.001231 Gpr137b 186 −1.49 −1.71 1.37E−09 7.01E−08 Trpm2 1260.6 −1.5 −1.66 3.19E−12 3.31E−10 Aatk 130.6 −1.5 −1.7 7.89E−11 5.6E−09 A530064D06Rik 30 −1.5 −1.98 7.1E−07 1.8E−05 Pyroxd2 242.8 −1.51 −1.68 9.76E−12 9.04E−10 Hcar2 808.2 −1.51 −1.74 8.34E−10 4.5E−08 Catsperg2 14.8 −1.51 −2.17 9.58E−06 0.00017 Slc40a1 4625.9 −1.53 −1.66 1E−14 1.89E−12 Mmp19 385.3 −1.53 −2.04 1.82E−06 4.01E−05 Mpzl1 469.8 −1.55 −1.7 2.45E−13 3.38E−11 Dnah2 262.4 −1.55 −1.85 3.81E−09 1.74E−07 Igkv6-15 223 −1.55 −2.65 3.22E−05 0.00047 Cadm1 1067.9 −1.56 −1.72 1.47E−13 2.19E−11 Ear2 200.6 −1.56 −1.76 4.64E−11 3.53E−09 Cd302 387 −1.57 −1.73 3.57E−13 4.7E−11 Lilra6 252.1 −1.58 −1.75 2.95E−13 3.94E−11 Cd163 1248.1 −1.58 −1.77 1.19E−11 1.05E−09 Lilra5 286.1 −1.58 −1.8 2.95E−11 2.34E−09 Treml4 1601.2 −1.59 −1.7 0 2E−15 Slc11a1 1813.6 −1.59 −1.72 4E−15 8.92E−13 Itgb5 955.2 −1.6 −1.73 1E−15 2.17E−13 Adgre1 1926.6 −1.6 −1.75 1.8E−14 3.26E−12 Rgl3 91.8 −1.6 −1.86 2.53E−10 1.57E−08 Ccr3 902.9 −1.61 −1.75 2E−15 5.62E−13 Siglec1 622.7 −1.61 −1.78 1.01E−12 1.15E−10 Slco2b1 818.9 −1.62 −1.75 1E−15 1.75E−13 Apod 9.3 −1.62 −3.32 2E−05 0.000315 C6 1221.3 −1.63 −1.78 1.5E−14 2.85E−12 Sirpb1b 32.1 −1.64 −2.12 2.61E−08 9.73E−07 Sirpb1a 105.6 −1.65 −1.88 3.33E−12 3.42E−10 Lhfp 173.9 −1.66 −1.92 3.96E−11 3.03E−09 Hmox1 16492.8 −1.66 −2.02 3.06E−09 1.43E−07 Gm2762 38.5 −1.66 −1.94 2.82E−08 1.04E−06 Pilra 854.5 −1.67 −1.82 1E−15 1.75E−13 Angptl7 118.5 −1.67 −1.89 2.22E−12 2.38E−10 Matn2 73.1 −1.67 −2 5.51E−10 3.12E−08 Mertk 1388.9 −1.67 −2.06 6.31E−09 2.76E−07 Cxcl1 159.6 −1.67 −2.1 1.42E−08 5.76E−07 Adamdec1 659.5 −1.68 −1.83 0 1.2E−13 Tenm4 307.5 −1.68 −1.89 1.99E−13 2.82E−11 Bank1 715.4 −1.68 −1.96 5.8E−11 4.31E−09 Gm5150 271.8 −1.69 −1.83 0 9E−15 Igkv3-7 151.3 −1.69 −3.52 8.26E−06 0.000149 Aspa 38.6 −1.7 −2.48 1.27E−07 3.99E−06 Gdf15 168.7 −1.71 −2.33 5.3E−08 1.82E−06 Adam22 142.7 −1.72 −2.24 2.59E−08 9.71E−07 Vcam1 9147.6 −1.73 −1.91 6E−15 1.2E−12 Fjx1 45.8 −1.73 −3.32 1.23E−06 2.86E−05 Paqr9 427.9 −1.74 −1.96 4E−14 6.63E−12 Slc22a23 202.4 −1.75 −1.94 0 7.9E−14 Dlc1 173.9 −1.75 −2.01 6.48E−13 7.83E−11 Sema6a 113.4 −1.75 −2.11 8.35E−11 5.81E−09 Snx31 36.9 −1.75 −2.37 2.42E−08 9.17E−07 Mrc1 3441.3 −1.76 −1.96 3E−15 6.66E−13 Pira2 53.5 −1.76 −2.34 7.75E−09 3.32E−07 Siglece 886.5 −1.77 −1.91 0 0 Il1a 348.3 −1.77 −2.22 7.34E−10 4.02E−08 Cecr2 73.9 −1.77 −2.86 9.93E−07 2.39E−05 Pilrb1 346.4 −1.78 −2.02 4E−14 6.68E−12 Stra6l 77.8 −1.78 −2.07 1.68E−12 1.8E−10 Sash1 878.3 −1.8 −2.01 1E−15 1.46E−13 Hfe 584 −1.81 −2.02 2E−15 5.33E−13 Kirrel3 96.4 −1.82 −2.06 1E−14 1.9E−12 Gm14548 229.3 −1.82 −2.13 2.57E−12 2.7E−10 Gpd1 933.9 −1.84 −2.05 1E−15 1.85E−13 Ace 93.4 −1.84 −2.73 5.03E−08 1.75E−06 Pilrb2 349.2 −1.85 −2.1 4E−15 9.43E−13 Spic 2050.5 −1.86 −2.04 0 1E−15 Lrp1 4560.8 −1.86 −2.08 0 6.6E−14 Slc15a2 279.3 −1.89 −2.18 1.7E−14 3.03E−12 Vstm4 221 −1.89 −2.18 2E−14 3.63E−12 Abcc3 2372 −1.9 −2.04 0 0 Cd209a 127.2 −1.9 −2.44 1.68E−10 1.09E−08 Cd300e 272.8 −1.91 −2.34 7.55E−12 7.15E−10 Sned1 230.5 −1.92 −2.29 9.22E−13 1.07E−10 Myo18b 126.8 −1.96 −2.34 1.63E−13 2.4E−11 Ptprm 389.7 −1.98 −2.21 0 0 Kcnj16 221.3 −1.98 −2.22 0 4E−15 Gm6377 147.2 −1.99 −2.51 8.92E−12 8.32E−10 Mybpc2 29.1 −1.99 −3.53 2.54E−08 9.54E−07 Sema6d 939.7 −2.01 −2.3 0 2.2E−14 Cbr2 76.5 −2.01 −2.9 8.13E−10 4.42E−08 Itgad 5960.5 −2.04 −2.25 0 0 Adam23 301.5 −2.04 −2.27 0 0 Postn 510.9 −2.04 −2.28 0 1E−15 Cbln1 33.6 −2.04 −2.89 1.25E−10 8.28E−09 Rnf150 123.1 −2.07 −2.32 0 0 Hs3st2 297.9 −2.13 −2.53 0 1.3E−13 Fcna 5828.3 −2.2 −2.39 0 0 Col14a1 699.7 −2.25 −2.55 0 0 Akr1b7 148.5 −2.26 −2.71 0 9E−15 Wisp2 41.1 −2.27 −3.56 1.66E−11 1.41E−09 Adgre4 851.8 −2.37 −2.61 0 0 Nfasc 204.4 −2.38 −2.98 0 1.5E−14
[0459] Next, NIH DAVID analysis using the upregulated gene list was run. In both comparisons, cell cycle genes upregulation is the highest enrichment cluster [although SV+α4-1BB mAb vs. SV has a lower enrichment score compared with SV plus α4-1BB mAb vs. untreated samples (
[0460] CD69 is the earliest marker of immune system activation. SV plus α4-1BB mAb treatment synergistically upregulated CD69 on day 2 (
[0461] SV Plus α4-1BB mAb Stimulated Cytotoxic T Cell Function
[0462] To investigate the antitumor cytotoxicity of SV/α4-1BB treated splenocytes, f-Luc A20 lymphoma cells were co-cultured with splenocytes on day 7. The ratios explored between splenocytes and tumor cell were 40:1, 20:1, 10:1. SV plus α4-1BB treated splenocytes demonstrated the highest cytotoxicity among all groups, as calculated by the reduction of f-Luc activity (
[0463] SV Plus α4-1BB mAb Induced IFNγ Production from T Cells
[0464] Other upregulated genes in the SV plus α4-1BB mAb combined treatment include STAT4 (
[0465] Next, to identify whether CD4 or CD8 T cells produce IFNγ, flow cytometric analysis was performed for cytokine analysis. Among splenocytes, 2-2.5% SV plus α4-1BB mAb treated CD4 T cells produced IFNγ, which is significantly higher than other groups. Very low percentages of CD8 T cells produced IFNγ in all groups (
[0466] SV and α4-1BB mAb Stimulated Chemotaxis, Adhesion and Enhanced T Cell Infiltration and Activation in Tumor
[0467] Through RNA-Seq, a series of chemokines and chemokine receptors have been identified to be upregulated in SV plus α4-1BB mAb (
[0468] TIL play a critical anti-tumor role and is an important marker for prognosis. Compared with untreated, the percentage of CD3 and CD8 T cells were increased about 2 fold after combination treatment (
[0469] SV and α4-1BB mAb Synergistically Enhanced Oxidative Phosphorylation
[0470] T cell activation requires a quick consumption of energy through both enhanced glycolysis and oxidative phosphorylation [Wahl D R et al., Immunol Rev., 2012]. Metabolic switch is a major feature of T cell activation and memory T cell development [van der Windt G J et al., Immunol Rev., 2012]. GSEA KEGG analysis identified that the glycolysis gene set is upregulated in SV plus α4-1BB vs. untreated samples (
[0471] Both oxygen consumption rate (OCR, represents oxidative phosphorylation) and extracellular acidification rate (ECAR, represents glycolysis) of all groups (
[0472] SV Plus Low Dose α4-1BB mAb Cured A20 Tumor Bearing Mice
[0473] To reduce the potential risk of cytotoxicity and expense of treatment with SV vectors plus α4-1BB, the study disclosed herein explored whether low doses of α4-1BB mAb and fewer injections would be as effective in curing tumor bearing mice as the higher doses and frequencies used in our initial studies. As demonstrated (
[0474] All Tumor Cured Mice Acquired Long Lasting Antitumor Immunity
[0475] To investigate the memory response to A20 lymphoma, naive and tumor cured mice were inoculated with 3×10.sup.6 A20 tumor cells. Only mice that had survived more than 4 months after 1st time of tumor challenge were chosen. In all tumor cured mice, we found that A20 lymphoma was completely rejected whereas naive mice were susceptible to A20 inoculation (
[0476] To confirm anti-tumor specificity has been elicited, IFNγ production of purified T cells in the presence or absence of tumor cells was measured by Elispot assay. T cells were isolated from naive and cured mice under SV plus α4-1BB treatment (4 months after treatment finished). Isolated T cells were co-cultured with A20 and CT26 tumor cells respectively. Co-culturing with A20 cells dramatically enhanced IFNγ production, whereas co-culturing with CT26 cells only slightly enhanced IFNγ production (
[0477] Next, cytotoxicity to both naive and cured mice under SV plus α4-1BB treatment (the same method as
[0478] To better understand differences between this memory T cell response and the initial treatment responses as observed on day 7, RNA-Seq was performed by using purified splenic T cells from all re-challenged groups. In T cells of these re-challenged mice we found only a few differentially expressed genes among the three treated groups (Table 5), indicating that tumor cured mice develop a very similar T cell gene expression profile regardless of treatment method. Compared with untreated, KEGG analysis indicates that TCR signaling is the highest upregulated pathway in SV plus α4-1BB group (
TABLE-US-00043 TABLE 5 The SD expressed gene lists among all tumor cured mice groups. gene baseMean log2FC log2FCunshrunk pvalue padj SV + α4-1BB recha vs SV rechal Arl5c 1644.9 −0.7 −0.71 4.57E−07 0.014007 SV + α4-1BB rechal vs α4-1BB rechal Prdm16 86.7 −1.85 −2.48 4.63E−07 0.001563 Scamp5 106.1 −1.59 −1.99 3.98E−06 0.010743 Klri1 117.3 −1.57 −1.98 5.79E−06 0.013016 Ighv2-2 457.3 −1.52 −1.94 1.05E−05 0.020265 Kcnj10 439.7 −1.45 −1.76 1.24E−05 0.020949 Slc40a1 1111.8 −1.41 −1.69 1.53E−05 0.022994 Trbv29 826.4 −1.3 −1.36 6.35E−12 8.57E−08 Tmcc3 416.3 −1.23 −1.35 1.28E−07 0.000575 Abcc3 1020.9 −1.2 −1.36 2.12E−05 0.02863 Arl5c 1644.9 −0.76 −0.77 2.43E−08 0.000164 SV rechal vs. α4-1BB rechal Gzmk 1000.8 −1.78 −2.44 1.81E−06 0.033784 Penk 2127.9 −1.35 −1.6 6.37E−06 0.038894 Smoc2 154.2 −1.85 −2.98 8.65E−06 0.038894 Spag6 6.7 −1.59 −7.14 8.74E−06 0.038894 Ighv3-5 85.6 −1.86 −3.04 1.08E−05 0.038894 Wipf3 150.6 −1.84 −5.01 1.25E−05 0.038894
[0479] The conventional view of oncolytic virus therapy against tumors is that it requires selective infection of cancer cells resulting in the induction of cancer cell lysis and apoptosis. TAAs, released from dead tumor cells, attract and further stimulate an antitumor immune response. The study described herein found that encoding a TAA is not necessary for SV vectors plus α4-1BB mAb therapy to be fully successful. SV vectors lacking an A20 lymphoma TAA were able to treat A20 lymphoma and, in combination with α4-1BB mAb, eradicated the growing tumors. This is particularly important when effective immune reactive TAAs are unknown. It is possible that the immunotherapeutic response of SV vectors plus α4-1BB mAb is independent of whether a tumor is “cold” (i.e., having few TAAs or mutation-specific neoantigens capable of promoting robust T cell activation) or “hot.”
[0480] The study describe herein showed that both NKG2D (KLRK1) and granzyme B are highly expressed under combination treatment. This massive nonspecific activation is critical for controlling tumor growth at an early time point (day 7). This step is also important for inducing anti-tumor specificity that is mediated by TAAs released from dead tumor cells due to nonspecific killing. After tumor regression, T cells from treated animals were able maintain the ability to produce IFNγ and acquired immunological memory to rapidly reject A20 lymphoma rechallenges. IFNγ production from purified T cells of cured mice was significantly enhanced after encountering A20 tumor cells. This demonstrates that anti-tumor specificity is fully established in cured mice. Upregulated molecular pathways of responsive T cells induced by SV vectors and a 4-1 in mAbs alone and in combination were identified and compared in the study described herein. The combination of SV and α4-1BB mAb has a synergistic effect and represents a potent and robust therapeutic treatment able to cure B lymphomas and provide long term protection in a preclinical model.
[0481] In conclusion, SV vectors in combination with α4-1BB mAb completely eradicated a B-cell lymphoma in a preclinical mouse model, a result that could not be achieved with either treatment alone. Tumor elimination involves a synergistic effect of the combination that significantly boosts T cell cytotoxicity, IFN-γ production, migration, tumor infiltration and oxidative phosphorylation. In addition, all mice that survived after treatment developed long lasting antitumor immunity. The studies disclosed herein provides a novel, alternative method for B cell lymphoma treatment and describes a rationale to help translate SV vectors plus agonistic mAbs into clinical applications.
Example 4: Sindbis Viral Vector Expressed NY-ESO-1 and IL-12 Enhances Survival of Subjects with Established Tumors
[0482] The study described herein investigates the effect of administering a tumor associated antigen and an immunostimulatory molecule, as expressed by a Sindbis viral vector on anti-tumor response and survival in a subject with an established tumor. Previous studies, demonstrated vectors encoding TAAs, such as NY-ESO-I, could cure CT26-NY-ESO-1 tumors [Galon J, et al., Nature reviews Drug discovery 2019; Gupta S, et al., Frontiers in oncology 2017]. However, while this approach has been effective in enhancing the immune response to and clearance of established tumors of colon and prostate cancers, the efficacy in curing other cancers, e.g. ovarian cancer has been limited. Therefore, an approach of administering a combination of a SV expressed immunostimulatory molecule, IL-12 along with the SV-NY-ESO-1, to a subject with an established tumor was tested.
[0483] Combination of NY-ESO-1 and IL-12 Expressed by Separate Sindbis Viral Vectors Enhances Survival of Subjects with Established Tumors
[0484] The study described herein investigates the effect of administering IL-12 and NY-ESO-1, both expressed by separate Sindbis viral vectors, on established tumors. C57/B16 albino (female) mice re-injected with Alm5-2Fluc-17 ovarian cancer cells to establish a tumor (
[0485] A Sindbis replicon expressing NYESO-1 cDNA (SV-NYESO1) was made by PCR amplification of the NYESO-1 gene from the pReceiver-M02 plasmid. Expression of the NYESO-1 gene was confirmed by western blot. NYESO-1 was detected by western blot following standard protocol, using as a primary antibody the anti-NYESO-1 clone E978 (Upstate) at a dilution 1/5,000 in Tris-buffered saline-Tween (TBS-T) with 5% non-fat milk. SV.IL12 plasmid used in this study has been published in 2002 [Tseng J C et al., J Natl Cancer Inst. 2002]. To construct a Sindbis viral vector containing genes for interleukin 12 (IL-12), the Sindbis viral vector SinRep/2PSG was first constructed, which contains a secondary subgenomic promoter that is responsive to the Sindbis replicase. Two DNA oligonucleotide primers (sequence 5′ CGCGTAAAGCATCTCTACGGTGGTCCTAATAGTGCATG-3′; SEQ ID NO: 29) and its complementary strand 5′CACTATTAGGACCACCGTCGAGATGCTTTA-3′; SEQ ID NO: 30) containing the subgenomic promoter sequence were annealed and ligated into the MluI and SphI sites of the SinRep plasmid. The murine IL-12 α subunit gene (mp35; ATCC 87596) and the IL-12 β subunit gene (mp40; ATCC 87595) were subcloned into the MluI and the StuI sites of SinRep/2PSG, respectively, to produce the Sin-Rep/IL12 plasmid.
[0486] As expected the SV-IL-12 treatment group showed a better percentage survival of mice with tumor over the SVNYESO treatment group and the untreated (control) group. However, a synergistically higher showed enhanced percentage survival rate was observed in the SV-NYESO_SV-IL12 in comparison to the SV-IL-12 treatment group (
[0487] Combination of NY-ESO-1 and IL-12 Expressed by the Same Sindbis Viral Vectors Enhances Survival of Subjects with Established Tumors
[0488] The study described herein investigates the effect of administering IL-12 and NY-ESO-1, both expressed by the same Sindbis viral vector, on established tumors. C57/B16 albino (female) mice re-injected with Alm5-2Fluc-17 ovarian cancer cells to establish a tumor (
[0489] The study described herein, provides plasmid constructs for expressing NY-ESO-1, IL-12 and anti-OX40 in a SV vector. The study described herein, provides plasmid constructs encoding IL-12 α and b subunits (
[0490] In summary, the results of the study described herein clearly show the possibility of using a SV vectors expressing both IL-12 and NY-ESO-1, for treatment of cancers that may be resistant to treatment with a SV expressing a tumor associated antigen.