GRIMONTIA-HOLLISAE-DERIVED RECOMBINANT COLLAGENASE AND ENZYME AGENT FOR CELL SEPARATION
20170218352 · 2017-08-03
Inventors
- Naoko Teramura (Tokyo, JP)
- Katsumasa Iijima (Tokyo, JP)
- Osamu Hayashida (Tokyo, JP)
- Keisuke Tanaka (Tokyo, JP)
- Shunji Hattori (Tokyo, JP)
- Teru Okitsu (Tokyo, JP)
- Shoji Takeuchi (Tokyo, JP)
Cpc classification
C12Y304/24007
CHEMISTRY; METALLURGY
International classification
Abstract
Recombinant collagenases with a stable specific activity and enzyme agents for cell and tissue dissociation such a recombinant are provided. The recombinant collagenase is derived from Grimontia hollisae-derived collagenase is characterized by having, from the N terminus to the C terminus, a collagenase catalytic domain, a linker region sequence, and a prepeptidase C terminal domain, which Grimontia hollisae-derived recombinant collagenase does not comprise at least the prepeptidase C terminal domain. The obtained recombinant collagenase has a high and stable specific activity.
Claims
1. A recombinant collagenase that is derived from Grimontia hollisae-derived collagenase comprising, from N terminal to C terminal, a collagenase catalytic domain, a linker region sequence, and a prepeptidase C terminal domain, which Grimontia hollisae-derived recombinant collagenase does not comprise at least the prepeptidase C terminal domain.
2. The Grimontia hollisae-derived recombinant collagenase according to claim 1, wherein the linker region of the recombinant collagenase is a linker fragment that is cleaved at any of amide bonds in the linker region of the Grimontia-hollisae-derived collagenase.
3. The Grimontia hollisae-derived recombinant collagenase according to claim 2, wherein the linker fragment has a glycine as a third amino acid residue from the C terminal.
4. The Grimontia hollisae-derived recombinant collagenase according to claim 2, wherein the linker fragment is a linker fragment obtained by cleavage between Y.sub.1 and G.sub.2 in an amino acid sequence represented by -G.sub.1-X.sub.1-Y.sub.1-G.sub.2-X.sub.2-Y.sub.2- (wherein G.sub.1 and G.sub.2 represent glycine; and X.sub.1, Y.sub.1, X.sub.2, and Y.sub.2 may be same or different and represent an amino acid residue), which amino acid sequence is contained in the linker region.
5. The Grimontia hollisae-derived recombinant collagenase according to claim 2 that is a recombinant collagenase with the C terminal of the linker fragment being any of -Gly-Asp-Ser, -Gly-Asn-Glu, -Gly-Glu-Ser, or -Gly-Asn-Thr.
6. An enzyme agent for cell and tissue dissociation comprising the recombinant collagenase according to claim 1.
7. The enzyme agent for cell and tissue dissociation according to claim 6 that is used for separation of one or more cells selected from the group consisting of: pancreatic islets, a liver, a heart, lungs, kidneys, a spleen, adrenal glands, muscles, thyroid glands, salivary glands, parotid gland acini, mammary tissues, bones, cartilages, endothelial cells, epithelial cells, adipose tissues and fibroblasts.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
DESCRIPTION OF EMBODIMENTS
[0036] A first of the present disclosure is a recombinant collagenase that is derived from a Grimontia-hollisae-derived collagenase comprising from N terminal to C terminal, a collagenase catalytic domain, a linker region sequence, and a prepeptidase C terminal domain, which recombinant collagenase is characterized by not containing at least the prepeptidase C terminal domain. The present disclosure will now be described in detail below.
(1) Grimontia hollisae
[0037] Clostridium (Clostridium sp.), Vibrio (Vibrio sp.), Bacillus (Bacillus sp.), Streptomyces (Streptomyces sp.), and the like are known as microorganisms that can produce a collagenase, and the collagenase used in the present disclosure is derived from Grimontia (Grimontia sp.). It is to be noted that Grimontia hollisae is available as, for example, ATCC No. 33564 and ATCC No. 33565.
(2) Grimontia-Hollisae-Derived Collagenase
[0038] The domain structure of the amino acid sequence of Grimontia-hollisae-derived collagenase is shown in
(3) Grimontia-Hollisae-Derived Recombinant Collagenase
[0039] The Grimontia-hollisae-derived recombinant collagenase of the present disclosure is derived from Grimontia hollisae. It may have any domain structure as long as PPC is not contained at least. For example, a recombinant collagenase composed of a prepro region, CD, and a linker region from the N terminal to the C terminal, which is obtained by lacking an amino acid sequence at the 688th position and later from the domain structure shown in the above 84 kDa collagenase in
[0040] The linker region of the Grimontia-hollisae-derived recombinant collagenase of the present disclosure may also be a linker fragment in which a part of its amino acid sequence is deleted. The term “linker fragment” in the present disclosure refers to one obtained by cleaving at any of the amide bonds in the linker region. For example, in the domain structure shown in the 84 kDa collagenase in
[0041] The above linker fragment preferably has a glycine as the third amino acid residue from the C terminal. As shown in the example described later, the recombinant collagenase with a glycine as the third amino acid residue from the C terminal exhibits a collagenase activity with excellent stability. The above linker region contains, as shown in SEQ ID NO: 1, the amino acid sequence represented by -G.sub.1-X.sub.1-Y.sub.1-G.sub.2-X.sub.2-Y.sub.2- (wherein G.sub.1 and G.sub.2 represent glycine; and X.sub.1, Y.sub.1, X.sub.2, and Y.sub.2 may be same or different and represent an amino acid residue). The cleavage of the linker region between Y.sub.1 and G.sub.2 in the above amino acid sequence results in the third amino acid from the C terminal being glycine.
[0042] For the sake of convenience,
[0043] “60 kDa” represents the C terminal of the recombinant 60 kDa collagenase” and “62 kDa” represents the C terminal of “recombinant 62 kDa collagenase. The C terminal of the recombinant 60 kDa collagenase is obtained by cleaving between S and G in the sequence represented by -GDSGAG- of the linker region; and the recombinant 62 kDa collagenase is obtained by cleaving between T and G in the sequence represented by -GNTGLP-. As a result, both come to have a glycine as the third amino acid residue from the C terminal. It is to be noted that the cleavage of the -G.sub.1X.sub.1Y.sub.1G.sub.2X.sub.2Y.sub.2- in the linker region may, as shown in
[0044] The C terminal of the recombinant collagenase of the present disclosure is preferably a linker fragment obtained by cleaving between Y.sub.1 and G.sub.2 in the amino acid sequence represented by the -G.sub.1-X.sub.1-Y.sub.1-G.sub.2-X.sub.2-Y.sub.2- (wherein G.sub.1 and G.sub.2 represent glycine; and X.sub.1, Y.sub.1, X.sub.2, and Y.sub.2 may be same or different and represent an amino acid residue). Because the specific activity of the recombinant collagenase having a linker fragment obtained by the cleavage between Y.sub.1 and G.sub.2 is stable over a long period of time. Therefore, the C terminal is preferably any of, for example, -GDS, -GNE, -GES, and -GNT. In the sequence shown in
[0045] SEQ ID NO: 3 represents the amino acid sequence of the recombinant 60 kDa collagenase composed of an amino acid sequence numbered 88 to 624, and SEQ ID NO: 4 represents the amino acid sequence of the recombinant 62 kDa collagenase composed of an amino acid sequence numbered 88 to 646, both of which lack prepro region and PPC and has the prescribed linker fragment. In addition, SEQ ID NO: 5 represents the amino acid sequence numbered 88 to 767 as 74 kDa collagenase, which is obtained by deleting the prepro region from the 84 kDa collagenase.
[0046] It has not completely understood why the recombinant collagenase of the present disclosure exhibits an excellent storage stability. There is possibility that PPC per se has a collagen binding ability and auxiliarily contributes to CD's collagenase activity, because when the specific activity and stability of the 74 kDa collagenase having PPC and the recombinant collagenase not having PPC are evaluated, the 74 kDa collagenase is found to have a higher specific activity. It is presumed that the recombinant collagenase of the present disclosure has a stable collagenase activity and increased property of separating from tissues at washing by lacking PPC, because the PPC auxiliarily contributes to the collagenase activity. Incidentally, the recombinant collagenase of the present disclosure may also lack the linker region as long as it lacks PPC.
(4) Method of Producing the Recombinant Collagenase.
[0047] A DNA for transformation used for preparation of the recombinant collagenase of the present disclosure is one encoding at least the amino acid sequence of CD, and more preferably one encoding the amino acid sequence of CD and a part of linker region. One further having the amino acid sequence of the prepro region at the N terminal side may also be used. As for the C terminal of the linker region, one obtained by cleaving between Y.sub.1 and G.sub.2 in the sequence represented by -G.sub.1X.sub.1Y.sub.1G.sub.2X.sub.2Y.sub.2- contained in the linker region sequence is suitably used. As a DNA for preparing a recombinant collagenase which does not contain PPC and has a glycine at the third position from the C terminal, one encoding the amino acid sequence represented by (I) shown below can be used.
TABLE-US-00001 Formula (I): AVEQCDLSQFQTTSSNQLMAAIRQQGASCVNALFSADTGVQEAAFSSNHM YNVAQYTRTLAQQYAGGGSDELEALYLYLRAGYYAEFYNSNITFLSWVTP AVKGAVDAFVQNAHFYDNGDAHGKVLNEVIITMDSAGLQHAYLDVVTQWL TRWNAQYAEHWYMRNAVNGVFTLLFGGQWNNQYTSLIGEQTALVTALQAF ALDRTKVNSPTEFMAANAARELGRLARYTDATIAPKVTEGLTAIFGQYPS YGDGDAIWLGAADTASYYADCSQFNICGFEDALRDAALNQTFICSDTIKI RSQDMSQAQHLAACDKMAYEESFFHTTLETGNQPVADDHNTQLQVNIFNS DTDYGKYAGPIFGIDTNNGGMYLEGNPANVGNIPNFIAYEASYANPDHFV WNLEHEYVHYLDGRFNMYGDFGTPTELVVWWSEGVAEYVSRVNDNPQAIA TIQDGSTYTLAQVFDTTYDGFDVDRIYRWGYLAVRFMFERHPDEVQRMLS ATRQGRWAEYKAIISGWANQYQSEFAQW-X
[0048] wherein X is a polypeptide represented by TEALAKGDSGAGNGEGTGSGNEGGG ESGGNT or TEALAKGDS. SEQ ID NO: 3 is the amino acid sequence when X represents TEALAKGDS; and SEQ ID NO: 4 is the amino acid sequence when X represents TEALAKGD SGAGNGEGTGSGNEGGGESGGNT. It is to be noted that alphabetical symbols used in the formula denote the following amino acids. A: alanine, C: cysteine, D: aspartic acid, E: glutamic acid, F: phenyl alanine, G: glycine, H: histidine, I: isoleucine, K: lysine, L: leucine, M: methionine, N: asparagine, P: proline, Q: glutamine, R: arginine, S: serine, T: threonine, V: valine, W: tryptophan, and Y: tyrosine.
[0049] To prepare the recombinant collagenase of the present disclosure, it is simply required a preparation of a recombinant vector containing a DNA encoding the above amino acid sequence, preparation of host cells with collagenase activity by transforming the host cells with the recombinant vector, and culture of the host cells to generate a gene product with the collagenase activity. Such a method of producing a recombinant protein can be carried out by employing techniques in genetic engineering. For example, a clone containing a Grimontia hollisae-derived collagenase gene is selected from a genome library of Grimontia hollisae; amplification is carried out using Expand High Fidelity PCR System (Roche) with the clone as a template to add an Nco I site on the 5′ side and a Hind III site on the 3′ side of a DNA fragment encoding the SEQ ID NO: 3 or SEQ ID NO: 4 respectively; the amplified fragment is treated with Nco I and Hind III to obtain the DNA fragment; the recovered DNA fragment is inserted into a plasmid vector to prepare a recombinant plasmid; the recombinant plasmid is used to transform, for example, a Brevibacillus choshinensis HPD31-SP3 strain or the like, thereby preparing a Brevibacillus choshinensis recombinant. Alternatively, a DNA fragment may be prepared and amplified as a clone containing the Grimontia-hollisae-derived collagenase gene as a template, which DNA fragment is a DNA fragment encoding the SEQ ID NO: 3 or SEQ ID NO: 4 with 15 bp-sequences homologous to both termini of linear expression vector to be inserted being added to both the termini: and this amplified DNA fragment and the linear expression vector may be mixed and introduced to a Brevibacillus choshinensis HPD31-SP3 strain or the like by New Tris-PEG method, thereby preparing a recombinant plasmid and a recombinant. Culturing the thus obtained Brevibacillus choshinensis recombinant enables a Grimontia hollisae-derived collagenase gene product to be generated in a culture supernatant.
[0050] A method of collecting and purifying a recombinant collagenase from the culture medium can be carried out in accordance with known means of collecting and purifying an enzyme. Examples thereof include a method comprising subjecting the culture to centrifugation, filtration, or the like to separate bacterial cells; and purifying the enzyme from the culture filtrate using a usual separation means such as, for example, organic solvent precipitation, salting out, concentration by ultrafiltration membrane via column chromatography or the like.
[0051] It is to be noted that, as for the Grimontia-hollisae-derived recombinant collagenase of the present disclosure, the recombinant collagenase may be produced from host cells transformed with DNA not originally containing the prepro region; or the recombinant collagenase may be produced from host cells transformed with DNA containing the prepro region, followed by release of the prepro region in the course of or after the translation.
(5) Enzyme Agent for Cell and Tissue Dissociation
[0052] The recombinant collagenase obtained by the production method of the present disclosure can be used in the same manner as conventional collagenases, and can, for example, be used as an enzyme agent for cell and tissue dissociation. Examples of isolated organs for separating cells include, pancreatic islet, liver, heart, lung, kidney, spleen, adrenal gland, muscles, as well as glandular tissues such as thyroid gland, salivary gland, parotid gland acinus, and mammary tissues; bone tissues such as bones and cartilages; endothelial cells; epithelial cells; adipose tissues and fibroblasts. The use of the enzyme agent is not limited to the isolated organ and is suitable for separation of cultured cells from a collagen gel. Because the recombinant collagenase obtained in the present disclosure, in particular, has a stable specific activity, it is suitably used as an enzyme agent for cell and tissue dissociation to separate pancreatic islets from an isolated pancreas. As shown in the example described later, it has a lower collagenase activity for washed tissues and causes less cell damage.
[0053] The enzyme agent for cell and tissue dissociation used in the present disclosure can further contain other components including metalloproteases, serine proteases, cysteine proteases and other components. Examples of metalloproteases include thermolysin, Dispase, and a neutral protease derived from Clostridium histolyticum. Examples of serine proteases include trypsin and elastase; and examples of cysteine proteases include chymopapain.
(6) Method of Separating Cells
[0054] The enzyme agent for cell and tissue dissociation of the present disclosure are added to isolated organs or animal tissues and incubated for a prescribed period. When an isolated organ is incubated in culture medium with the enzyme agent for cell and tissue dissociation or further added other components, it is possible to degrade extracellular matrices or cell junction in the isolated organ to dissociated cells from the organ. In cases where the cells dissociated from the tissue float in the culture medium, it is simply required to collect the separated cell from the culture medium via filtration or centrifugation.
[0055] In the present disclosure, the pancreatic islets can be separated when the pancreas is used as an isolated organ. The incubating isolated pancreas with the collagenase enables the pancreatic islets to be freed from the rest, because the pancreatic islets are associated with the rest via collagens. For example, the enzyme agent for cell and tissue dissociation of the present disclosure is infused from the pancreatic duct of the isolated pancreas and incubated for a prescribed period. The period time for the incubating may be selected according to conditions of the tissue used, the amount of recombinant collagenase contained in the enzyme agent for cell and tissue dissociation, and the like. Because the pancreatic islets are lighter than the rest tissue in the pancreas, they can be purified after the incubation by a density gradient centrifugation method or the like. It is to be noted that the cell separation method is not limited to the pancreatic islets, and can be suitably used for any of the cell separation for liver, heart, lung, kidney, spleen, adrenal gland, and muscles as well as glandular tissues such as thyroid gland, salivary gland, parotid gland acinus, and mammary tissues; bone tissues such as bones and cartilages; endothelial cells; epithelial cells; adipose tissues and fibroblasts.
EXAMPLES
[0056] By way of the examples, the present disclosure will now be specifically described; but the present disclosure is by no means limited by those examples.
Example 1
[0057] With a bacmid pCC1BAC-2 (Accession number; NITE BP-00739: Date of deposit: (original deposit); Apr. 28, 2009: Name of depository; Incorporated Administrative Agency National Institute of Technology and Evaluation Patent Microorganisms Depositary (NPMD): Address of depository; 2-5-8, Kazusakamatari, Kisarazu-shi, Chiba 2920818, Japan) containing the gene of the entire coding region of Grimontia-hollisae-derived collagenase as a template, amplification was carried out by Expand High Fidelity PCR System (Roche) to add an Nco I site and a Hind III site, respectively, on the 5′ side and the 3′ side of partial sequence (2040 bp in length) of the collagenase gene, which sequence was induced from the peptide sequence of SEQ ID NO: 5. The following primer set was used for the PCR reaction. In the primer sequence, restriction enzyme sites are underlined.
TABLE-US-00002 Fwd: (SEQ ID NO: 6) AAACCATGGCTTTCGCTGCGGTTGAACAGTGTGATCT Rvs: (SEQ ID NO: 7) AAAAAGCTTTTACTGACGACACTGGTTAC
[0058] The amplified fragment was treated with Nco I and Hind III; and the resulting DNA fragment was recovered and inserted into a cloning site of a plasmid vector pNY326 to prepare pNY326-Col.74. A Brevibacillus choshinensis HPD31-SP3 strain was transformed with this recombinant plasmid to prepare a recombinant.
[0059] In addition, a partial sequence (1611 bp in length) of the collagenase gene induced from the peptide sequence of SEQ ID NO: 3 was isolated with the following primer set using a PCR reaction with a bacmid pCC1BAC-2 (NITE BP-00739) containing a gene of the entire coding region of a Grimontia-hollisae-derived collagenase as a template. In the primer sequence, sequences homologous to the sequence of both termini of the linear vector are underlined.
Primers:
[0060]
TABLE-US-00003 Fwd: (SEQ ID NO: 8) CCCATGGCTTTCGCTGCGGTTGAACAGTGTGATCT Rvs: (SEQ ID NO: 9) CATCCTGTTAAGCTTACTGTCGCCCTTCGCCAGC
[0061] In addition, a linear expression vector pNY326 was prepared by using a PCR reaction with the below primer set. In the primer sequence, sequences homologous to the sequence of both termini of the DNA fragment to be inserted are underlined.
Primers:
[0062]
TABLE-US-00004 Fwd: (SEQ ID NO: 10) AAGCTTAACAGGATGCGGGG Rvs: (SEQ ID NO: 11) AGCGAAAGCCATGGGAGCAA
[0063] The DNA fragment (1611 bp) encoding the recombinant 60 kDa collagenase of SEQ ID NO: 3 was mixed with the linear expression vector pNY326 at a molar ratio of 2:1; and the mixture was introduced into competent cells by New Tris-PEG method and at the same time transformed into a Brevibacillus choshinensis HPD31-SP3 strain, thereby preparing a plasmid pNY326-Col.60 and a recombinant.
[0064] Similarly, a partial sequence (1677 bp in length) of the collagenase gene that is induced from the above peptide sequence of SEQ ID NO: 4 was isolated by using a PCR reaction using the following primer set. In the primer sequence, sequences homologous to the sequence of both termini of the linear vector are underlined.
Primers:
[0065]
TABLE-US-00005 Fwd: (SEQ ID NO: 12) CCCATGGCTTTCGCTGCGGTTGAACAGTGTGATCT Rvs: (SEQ ID NO: 13) CATCCTGTTAAGCTTAGGTATTACCACCAGATTCA
[0066] Subsequently, the linear expression vector pNY326 was prepared in the same manner as described above; and a plasmid pNY326-Col.62 and a recombinant that contained a DNA fragment (1677 bp) encoding the recombinant 62 kDa collagenase of SEQ ID NO: 4 were prepared. From the above, three kinds of Brevibacillus choshinensis recombinants were prepared.
[0067] Each of three kinds of the Brevibacillus choshinensis recombinants was cultured in 100 ml of 2SYN medium (20 g/L glucose, 40 g/L Bacto Soytone, 5 g/L Bacto Yeast Extract, 0.15 g/L CaCl.sub.2.2H.sub.2O, 50 μg/mL neomycin) at 30° C. for 48 hours. A culture medium containing a product of the Grimontia-hollisae-derived collagenase gene was centrifuged; and the obtained supernatant was subjected to filter sterilization with a 0.2 μm filter. Subsequently, the supernatant was purified and fractionated by an HPLC system. The HPLC system was performed by anion exchange column chromatography using DEAE-Sepharose. Each culture supernatant was subjected to the column to allow the collagenase to be adsorbed; and thereafter the collagenase was separated and eluted by flowing a 50 mM Bis-Tris HCl buffer (pH 7) while the concentration of NaCl was continuously increased from 0.2 to 1 M. Elutant liquid was, in the order eluted, collected and fractionated into 4-ml aliquots. Subsequently, elutants with 30 kDa or below in size were removed by ultrafiltration and the resultant was dialyzed with a 50 mM Tris HCl buffer containing 0.2 M NaCl and 5 mM CaCl.sub.2 at 4° C. to obtain purified 74 kDa collagenase, recombinant 62 kDa collagenase, and recombinant 60 kDa collagenase.
[0068]
Example 2
[0069] A change with time in the specific activity of the 74 kDa collagenase, the recombinant 62 kDa collagenase, and the recombinant 60 kDa collagenase obtained in Example 1 was measured by a method described below. The measurement results are shown in
[0070] Measurement of the specific activity of collagenase: 0.5 μg of collagenase was mixed in 50 mM Tris HCl (pH 7.5) that contained 0.05% fluorescently labeled type I collagen (FITC-collagen), 5 mM CaCl.sub.2, and 200 mM NaCl and heated to 30° C. After 30 minutes, EDTA was added to the mixture to stop the enzymatic reaction. To the reaction solution, 50 mM Tris HCl (pH 9.5) containing an equal amount of 70% ethanol was added to extract breakdown products; and the fluorescence intensity was measured by a fluorescence spectrophotometer. In the figure, 1 unit (U) refers to an activity at which 1 μg of collagen is broken down at 30° C. for 1 minute.
Example 3
[0071] The recombinant 62 kDa collagenase obtained in Example 1 was stored at a temperature of 4° C. and a change with time in the specific activity was evaluated.
Example 4
[0072] An ability evaluation to dissociate murine pancreas was carried out with the recombinant 62 kDa collagenase obtained in Example 1. The pancreas was isolated from a mouse, infused with an enzyme liquid containing 0.00625 to 0.20 mg of the recombinant 62 kDa collagenase in 1 ml of HBSS buffer and 0.012 mg of thermolysin (manufactured by Roche Applied Science, a product bundled with trade name “Liberase C/T”) via a pancreatic duct, and incubated at 37° C. for 15 minutes. Thereafter, the amount of proteins in fractions (dissociated tissues) that passed through a mesh with an opening of 1 mm and fractions (undissociated tissues) that left on the mesh was measured. Depending on the concentration of the recombinant 62 kDa collagenase contained in the enzyme liquid, the amount of the dissociated tissue increased and, in associated with that, the amount of the undissociated tissue decreased. The results were shown in
Example 5
[0073] The ability evaluation to isolate functional islets was carried out with the recombinant 62 kDa collagenase obtained in Example 1 in the same manner as described in Example 4, the number of the obtained pancreatic islets was measured and IEQ (Islet Equivalent: an international unit that represents the volume of the pancreatic islets with the pancreatic islets having a diameter of 150 μm being defined as 1) was evaluated.
Comparative Example 1
[0074] The same procedures as described in Example 5 were carried out except that a collagenase derived from Clostridium histolyticum (manufactured by Roche Applied Science, trade name “Liberase C/T”) was used instead of the recombinant 62 kDa collagenase obtained in Example 1, and the number and IEQ of the pancreatic islets were evaluated. The results are shown in
Example 6
[0075] The pancreatic islets obtained in Example 5 were transplanted under the renal capsule of an STZ-induced diabetic mouse and the blood glucose level was measured with time. While a control group in which the pancreatic islets were not transplanted (n=3: STZ-1, STZ-2, and STZ-3) exhibited a high blood glucose level, the blood glucose level in the pancreatic islet transplantation group (n=5: STZ/islet-1 to STZ/islet-5) decreased to a normal level immediately after the transplant. When the kidney that had been transplanted with the pancreatic islets was removed 39 days after the transplantation, the blood glucose level again increased. The result is shown in
Example 7
[0076] An ability evaluation to isolate liver cells was carried out with the recombinant 62 kDa collagenase obtained in Example 1. The blood was removed from the liver of an anesthetized rat under perfusion with HBSS buffer to remove calcium; and then the recombinant 62 kDa collagenase at 0.05 mg/ml and thermolysin at 0.01 mg/ml were perfused into the liver over 10 minutes to add calcium and subsequently the liver was removed. The extracted liver was cooled with ice, cut into fine strips with a scalpel, and filtered with gauze and a strainer. After dead cells were removed, liver cells were centrifuged and recovered.
Example 8
[0077] The ability of the recombinant 62 kDa collagenase obtained in Example 1 to bind to collagen fibers and the activity of collagenase left in the collagen fibers after washing were evaluated.
[0078] To a spin column with a built-in filter, 5 mg of pig skin collagen fibers and a Tris HCl buffer (pH 7.5) containing 400 μl of 0.2 M NaCl and 5 mM CaCl.sub.2 were placed; and centrifuged it for two-minute at 10,000 rpm to wash the collagen fiber with the above buffer, such centrifugation was carried out five times in total.
[0079] The washing liquid was discarded and 100 μl of enzyme mixture liquid (a Tris HCl buffer (pH 7.5) containing the recombinant 62 kDa collagenase at 0.2 mg/ml, ovalbumin at 0.2 mg/ml, ortho-phenanthroline at 4 mM, NaCl at 0.2 M, and CaCl.sub.2 at 5 mM) was added to the collagen fiber on the filter of the spin column and left to stand at 4° C. for 30 min to allow the collagen fiber to bind to the recombinant 62 kDa collagenase.
[0080] Subsequently, centrifugation was carried out at 10,000 rpm for two minutes to separate the collagen fiber on the above filter from a mixture liquid that passed through the filter. Part of this mixture liquid was analyzed by SDS-PAGE. Note that, for the sake of comparison, the same treatment as described above except that no pig skin collagen fibers were added was carried out and the thus obtained mixture was analyzed by SDS-PAGE as well. The result was shown in
[0081] Subsequently, the collagenase-bound collagen fiber in the spin column was collected to a 2 ml tube and added with a Tris HCl buffer (pH 7.5) containing 0.2 M NaCl, 5 mM CaCl.sub.2, 0.1 mg/ml collagen peptide, and 4 mM ortho-phenanthroline. The mixture was left to stand at 4° C. for 10 minutes and centrifuged at 10,000 rpm for two minutes; and the precipitate was washed with a buffer containing the above collagen peptide. The centrifugation was carried out five times in total. The supernatant from each of five washings was analyzed by SDS-PAGE. The result was shown in
[0082] Further, 500 μl of Tris HCl buffer containing 0.2 M NaCl, 5 mM CaCl.sub.2, 2 μg/ml ZnSO.sub.4.7H.sub.2O was added to the collagenase-bound collagen fiber obtained by centrifugation and the resulting mixture was left to stand at 37° C. Observation was visually made at the beginning of the standing, and 1 hour, 3 hours, 5 hours, 7 hours, 17 hours, and 20 hours after the standing.
Comparative Example 2
[0083] The same procedures as described in Example 8 were carried out except that an equal amount of a collagenase derived from Clostridium (manufactured by Roche Applied Science, trade name “Liberase C/T”) was used instead of the recombinant 62 kDa collagenase. The results are shown in
[0084] As shown in
[0085] On the other hand, a difference in the enzymatic activity of the collagenase left in the collagen fiber was observed between the recombinant 62 kDa collagenase and the liberase, as shown in
Example 9
[0086] The recombinant 62 kDa collagenase obtained in Example 1 and a collagenase derived from Clostridium histolyticum (manufactured by Roche Applied Science, trade name “Liberase C/T”) were evaluated for the activity of digesting a fluorescently labeled type I collagen (hereinafter, referred to as FITC-collagen) and a synthetic substrate N-(3[2-furyl]acryloyl)-Leu-Gly-Pro-Ala (hereinafter, referred to as FALGPA).
[0087] A 50 mM Tris-HCl (pH 7.5, 30° C.) buffer containing 0.2 M NaCl and 5 mM CaCl.sub.2 was used for the FITC-collagen and a 50 mM tricine (pH 7.5, 30° C.) containing 0.4 M NaCl and 40 mM CaCl.sub.2 was for FALGPA. When the FITC-collagen was used as a substrate, 0.5 μg of the above collagenases was added; and when FALGPA was used as a substrate, 1.0 μg of the recombinant 62 kDa collagenase or 2.5 μg of Liberase C/T was added. FALGPA was detected and quantified by a microplate reader to evaluate the activity of breaking down FALGPA. An activity by which 1 mg of enzyme digested 1 μmole of the above peptide in 1 ml of a reaction system for 1 minute was calculated as a specific activity of 1 U/mg. The obtained specific activity is shown in Table 1. Not only is the recombinant 62 kDa collagenase capable of digesting the collagen but also has an excellent activity of digesting the synthetic substrate FALGPA; and it has therefore been implied that the collagenase has an excellent property of digesting gelatin as well as collagen.
TABLE-US-00006 TABLE 1 Parameters of collagenase activity Specific Michaelis Maximum Molecular activity constant rate activity Substrate Collagenase (U/mg) (mM) (mM/s) (s.sup.−1) FITC- Recombinant 5,490 (1.1 ± 0.35) × 10.sup.−3 (4.1 ± 0.84) × 10.sup.−4 25.1 ± 5.2 collagen 62 kDa Liberase C/T 1,766 (1.9 ± 0.42) × 10.sup.−3 (1.6 ± 0.39) × 10.sup.−4 18.7 ± 4.5 FALGPA Recombinant 9.39 2.28 ± 0.23 0.6 ± 0.13 37.5 ± 8.0 62 kDa Liberase C/T 2.60 2.03 ± 0.48 0.2 ± 0.03 22.2 ± 2.9
Example 10
[0088] Using the recombinant 62 kDa collagenase obtained in Example 1, the activity to type I, type II, type III, type IV, type V, and type VI collagens were evaluated. To 0.5 mg/ml the above collagen, collagenase dissolved at 1 μg/ml in a 50 mM Tris-HCl buffer (pH 7.5) containing 0.2 M NaCl and 5 mM CaCl.sub.2. The mixture was incubated at 30° C. and sampled at the beginning of incubation and 1 hour, 3 hours, and 5 hours after the incubation; and the sample was analyzed by electrophoresis. For the sake of comparison, the same procedures as described above were carried out using a collagenase derived from Clostridium histolyticum (manufactured by Roche Applied Science, trade name “Liberase C/T”) instead. The result is shown in
[0089] With regard to the type I collagen, judging from the extent of disappearance of the bands of α1(I) and α2(I) 3 hours and 5 hours after the incubation, the recombinant 62 kDa collagenase seems to more rapidly digest the type I collagen than liberase. This tendency was also similarly observed for the type II, type III, type IV, type V, and type VI collagens. In particular, with regard to the type IV and type V collagens, the band become weaker when the recombinant 62 kDa collagenase is used to react for three hours or five hours whereas the bands do not disappear when the liberase is used. With regard to the type VI collagen, the band become weaker when the recombinant 62 kDa collagenase is used to react for 72 hours whereas the band does not disappear when the liberase is used. It has been implied that the recombinant 62 kDa collagenase is possibly capable of digesting the collagens that are not readily digested by the liberase.
[0090] The foregoing describes some example embodiments for explanatory purposes. Although the foregoing discussion has presented specific embodiments, persons skilled in the art will recognize that changes may be made in form and detail without departing from the broader spirit and scope of the invention. Accordingly, the specification and drawings are to be regarded in an illustrative rather than a restrictive sense. This detailed description, therefore, is not to be taken in a limiting sense, and the scope of the invention is defined only by the included claims, along with the full range of equivalents to which such claims are entitled.
[0091] The present disclosure is based on Japanese Patent Application No. 2014-044205 filed in Mar. 6, 2014. The specification, claims, and drawings of Japanese Patent Application No. 2014-044205 are incorporated in the present specification by reference in their entirety.
INDUSTRIAL APPLICABILITY
[0092] According to the present disclosure, recombinant collagenases with a stable specific activity and enzyme agents for cell and tissue dissociation that contains such a recombinant collagenase are provide and useful.
Accession Numbers
[0093] NITE BP-00739