COMPOSITIONS AND METHODS FOR TRANSIENT IMMUNE RESPONSE MODULATION DURING VACCINATION
20170216426 · 2017-08-03
Inventors
- Barton F. Haynes (Durham, NC)
- Garnett Kelsoe (Durham, NC)
- Masayuki Kuraoka (Durham, NC)
- M. Anthony Moody (Durham, NC)
- Hua-Xin Liao (Durham, NC)
- Laurent Verkoczy (Durham, NC)
Cpc classification
A61K31/4706
HUMAN NECESSITIES
C07K16/2866
CHEMISTRY; METALLURGY
A61K38/177
HUMAN NECESSITIES
A61K39/21
HUMAN NECESSITIES
C12N2740/16134
CHEMISTRY; METALLURGY
A61K2039/55555
HUMAN NECESSITIES
A61K2039/55572
HUMAN NECESSITIES
International classification
A61K39/21
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
Abstract
In certain aspects the invention provides a selection of HIV-1 envelopes suitable for use as immunogens, and methods of using these immunogens to induce neutralizing antibodies. In certain embodiments, the immunogens are designed to trimerize. In other embodiments, the immunogenic compositions and methods comprise at least one agent for transient immune response modulation during vaccination.
Claims
1. A method of inducing an immune response in a subject in need thereof comprising administering a composition comprising an HIV-1 immunogen, or a combination of several HIV-1 immunogens, and a first immunomodulatory agent in an amount sufficient to induce an immune response.
2. The method of claim 1, wherein the first immunomodulatory agent is administered in at time and in an amount sufficient for transient modulation of the subject's immune response so as to induce an immune response which comprises broad neutralizing antibodies against HIV-1 envelope
3. The method of claim 1, wherein the HIV-1 immunogen is HIV-1 envelope, a fragment thereof, or a peptide derived from HIV-1 envelope.
4. The method of claim 1, wherein the immune response is a humoral immune response.
5. The method of claim 2, wherein the modulation includes PD-1 blockade; T regulatory cell depletion; CD40L hyperstimulation; soluble antigen administration, or a combination thereof.
6. The method of claim 4, wherein the humoral immune response comprises the induction of a CD4bs bNAb, a V3 bNAb, V1V2 bNAb, gp41 bNAb, or a combination of antibodies.
7. The method of claim 1, wherein the agent is chloroquine (CQ), PTP1B Inhibitor—CAS 765317-72-4, MSI 1436, clodronate or any other bisphosphonate, a Foxo1 inhibitor, Gleevac, anti-CD25 antibody, anti-CCR4 Ab, an agent which binds to a B cell receptor for a dominant HIV-1 envelope epitope, or any combination thereof.
8. The method of claim 1, further comprising administering a second immunomodulatory agent, wherein the second and first immunomodulatory agents are different.
9. The method of claim 8, wherein the first agent is administered before immunization with the HIV-1 immunogen.
10. The method of claim 1, wherein the HIV-1 immunogen is comprised in a composition which is administered as a nucleic acid, a protein or any combination thereof.
11. The method of claim 10, wherein the nucleic acid encoding the HIV-1 immunogen is operably linked to a promoter inserted in an expression vector.
12. The method of claim 10, wherein the protein is recombinant.
13. The method of claim 10, wherein the HIV-1 immunogen is comprised in a composition which is administered as a prime, a boost, or both.
14. The method of claim 10, wherein the HIV-1 immunogen is comprised in a composition which is administered as a multiple boosts.
15. The method of claim 10, wherein the HIV-1 immunogen is comprised in a composition with an adjuvant.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0029] To conform to the requirements for PCT patent applications, many of the figures presented herein are black and white representations of images originally created in color. In the below descriptions and the examples, the colored images are described in terms of its appearance in black and white.
[0030]
[0031]
[0032]
[0033]
[0034]
[0035] MPER656.oriNEQELLELDKWASLWNWFNITNWLWYIK (SEQ ID NO.: 1) original
[0036] MPER656.1 NEQDLLALDKWASLWNWFDISNWLWYIK (SEQ ID NO.: 2)
[0037] MPER656.2 NEKDLLALDSWKNLWNWFSITKWLWYIK (SEQ ID NO.: 3)
[0038] MPER656.3 NEQELLALDKWNNLWSWFDITNWLWYIR (SEQ ID NO.: 4)
[0039] MPER656.ori-anchor NEQELLELDKWASLWNWFNITNWLWYIK-GTH1 (SEQ ID NO.: 5) original
[0040] MPER656.1-anchor NEQDLLALDKWASLWNWFDISNWLWYIK-GTH1 (SEQ ID NO.: 6)
[0041] MPER656.2-anchor NEKDLLALDSWKNLWNWFSITKWLWYIK-GTH1 (SEQ ID NO.: 7)
[0042] MPER656.3-anchor NEQELLALDKWNNLWSWFDITNWLWYIR-GTH1 (SEQ ID NO.: 8)
[0043] GTH1 sequence is YKRWIILGLNKIVRMYS (SEQ ID NO.: 9).
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
DETAILED DESCRIPTION
[0071] The development of a safe, highly efficacious prophylactic HIV-1 vaccine is of paramount importance for the control and prevention of HIV-1 infection. A major goal of HIV-1 vaccine development is the induction of broadly neutralizing antibodies (bnAbs) (Immunol. Rev. 254: 225-244, 2013). BnAbs are protective in rhesus macaques against SHIV challenge, but as yet, are not induced by current vaccines.
[0072] For the past 25 years, the HIV vaccine development field has used single or prime boost heterologous Envs as immunogens, but to date has not found a regimen to induce high levels of bnAbs.
[0073] About 50% of chronically infected individuals have plasma antibodies that neutralize ˜50% of tier 2 HIV strains (Hraber, P, Montefiori D et al. AIDS 28: 163, 2014). The question then is why when animals or humans are immunized with antigenic Envs, none of them make bnAbs—i.e. so far 0% of uninfected subjects make bnAbs following antigenic Env vaccination.
[0074] It appears that the HIV must be affecting the host to allow bnAbs to emerge. HIV induces autoimmune phenomena/disease syndromes. For example, about 50% of untreated HIV infected individuals will have either plasma autoantibodies (anti-CL, ANA, anti-DNA etc.) or have a frank autoimmune disease. Other diseases associated with HIV infection are SLE, Myasthenia gravis, Immune thrombocytopenia, Vasculitis. HIV infection—˜50% complicated with autoimmune syndromes and serologies (Brit. Journal. Haematol. 65: 495, 1987; Clin. Immunol. Immunopathol. 58: 163, 1991).
[0075] Of those chronically infected with HIV, it was investigated whether those who make bnAbs are more likely to have autoantibodies than those individual who do not. In one study of HIV infected individual there were 50 bnAbs and 51 no-Nabs individuals. Nine autoantibody tests were done: clinical assay AtheNA® luminex bead assay (RNP, SSA, SSB, SCL-70, Smith [Sm], double stranded DNA, histones, Jo-1, centromere B), and Cardiolipin ELISA. In this study 80% of 51 BnAbs individuals versus 38% of 50 non-BnAbs individuals had one or more autoantibody tests positive (Chi-square=18.8; p<0.0001).
[0076] There are various hypotheses why bnAbs are not routinely made. Studies on BnAb Biology and Host Control of BnAbs have shown that all bnAbs are unusual, BnAb traits predispose them to be deleted, edited, anergized or affinity reverted/redeemed away from autoreactivity. The result is that the pool of bnAb precursors is smaller than for the pool of non-bnAb precursors, i.e. bnAbs are subdominant. Subdominance could be due to smaller pool size and active host tolerance controls. Other studies have shown that bnAbs can be induced in both 2F5 and 4E10 knock-in mice by MPER-peptide liposome immunogens. While some BnAb B cells may be present these in lower numbers (due to tolerance deletion) with remaining cells in decreased activation state (anergy) (2F5, 4E10).
[0077] The implication of the above observations is that immunization with Env immunogens alone may not induce bnAbs to become dominant. The hypothesis is that bnAbs can be induced when there is transient modification to the host to break tolerance in the setting of vaccination. Transient modification of host tolerance mechanisms may be required to recreate the immunological milieu (
[0078] T reg depletion before cancer vaccine immunization induces long-lived anti-tumor T cell response (J. Immunol. 171: 5931-5939, 2003; Cancer Gene Therapy 14: 201-210, 2007). T reg depletion induces durable T cell responses to a malaria subdominant epitope (J. Immunol. 175: 7264-7273, 2005). It is possible to use Ab to IL-2Ra—anti-CD25 antibody to transiently modulate immune response in vaccination.
[0079] HIV envelope Gp120 induces T regs when administered without adjuvant and protects from graft vs. host disease in mice (Blood 114: 1263, 2009). CD4 ligation has proved immunosuppressive and tolerance induction in mice and NHPs. Clinical trials planned with anti-CD4 abs (Frontiers in Immunology 3: Jun. 18, 2012).
[0080] CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on T follicular helper cells to CD40 activates antigen presenting cells and drives B cell activation. Excess CD40L (CD40L transgenic mice) rescued anti-Sm/RNP producing marginal zone B cells from apoptosis and led to plasma autoantibodies (PNAS 109: 7811-7816, 2012). In some embodiments the invention provides immunogen-liposome complexes with CD40Ligand (
[0081] In certain aspects the invention provides a strategy for induction of bnAbs which is to select and develop immunogens designed to recreate the antigenic evolution of Envs that occur when bnAbs do develop in the context of infection.
[0082] That broadly neutralizing antibodies (bnAbs) occur in nearly all sera from chronically infected HIV-1 subjects suggests anyone can develop some bnAb response if exposed to immunogens via vaccination. Working back from mature bnAbs through intermediates enabled understanding their development from the unmutated ancestor, and showed that antigenic diversity preceded the development of population breadth. See Liao et al. (2013) Nature 496, 469-476. In this study, an individual “CH505” was followed from HIV-1 transmission to development of broadly neutralizing antibodies. This individual developed antibodies targeted to CD4 binding site on gp120. In this individual the virus was sequenced over time, and broadly neutralizing antibody clonal lineage (“CH103”) was isolated by antigen-specific B cell sorts, memory B cell culture, and amplified by VH/VL next generation pyrosequencing. See Liao et al. (2013) Nature 496, 469-476.
[0083] Further analysis of envelopes and antibodies from the CH505 individual indicated that a non-CH103 Lineage participates in driving CH103-BnAb induction. For example V1 loop, V5 loop and CD4 binding site loop mutations escape from CH103 and are driven by CH103 lineage. Loop D mutations enhanced neutralization by CH103 lineage and are driven by another lineage. Transmitted/founder Env, or another early envelope for example W004.03, and/or W004.26, triggers naïve B cell with CH103 Unmutated Common Ancestor (UCA) which develop in to intermediate antibodies. Transmitted/founder Env, or another early envelope for example W004.03, and/or W004.26, also triggers non-CH103 autologous neutralizing Abs that drive loop D mutations in Env that have enhanced binding to intermediate and mature CH103 antibodies and drive remainder of the lineage (See Gao F et al. Cell 158: 481-91, 2014).
[0084] Recently, a new paradigm for design of strategies for induction of broadly neutralizing antibodies was introduced, that of B cell lineage immunogen design (Nature Biotech. 30: 423, 2012) in which the induction of bnAb lineages is recreated. It was recently demonstrated the power of mapping the co-evolution of bnAbs and founder virus for elucidating the Env evolution pathways that lead to bnAb induction (Nature 496: 469, 2013). From this type of work has come the hypothesis that bnAb induction will require a selection of antigens to recreate the “swarms” of sequentially evolved viruses that occur in the setting of bnAb generation in vivo in HIV infection (Nature 496: 469, 2013).
[0085] A critical question is why the CH505 immunogens are better than other immunogens. This rationale comes from three recent observations. First, a series of immunizations of single putatively “optimized” or “native” trimers when used as an immunogen have not induced bnAbs as single immunogens. Second, in all the chronically infected individuals who do develop bnAbs, they develop bnAbs in plasma after ˜2 years. When these individuals have been studied at the time soon after transmission, they do not make bnAbs immediately. Third, now that individual's virus and bnAb co-evolution has been mapped from the time of transmission to the development of bnAbs, the identification of the specific Envs that lead to bnAb development have been identified-thus taking the guess work out of env choice.
[0086] Two other considerations are important. The first is that for the CH103 bnAb CD4 binding site lineage, the VH4-59 and Vλ3-1 genes are common as are the VDJ, VJ recombinations of the lineage (Liao, Nature 496: 469, 2013). In addition, the bnAb sites are so unusual, the same VH and VL usage is recurring in multiple individuals. Thus, it can be expected that the CH505 Envs induce CD4 binding site antibodies in many different individuals.
[0087] Regarding the choice of gp120 vs. gp160, for the genetic immunization gp160 would normally not even be considered for use. However, in acute infection, gp41 non-neutralizing antibodies are dominant and overwhelm gp120 responses (Tomaras, G et al. J. Virol. 82: 12449, 2008; Liao, H X et al. JEM 208: 2237, 2011). Recently it was found that the HVTN 505 DNA prime, rAd5 vaccine trial that utilized gp140 as an immunogen, also had the dominant response of non-neutralizing gp41 antibodies. Thus, the use of gp160 vs gp120 for gp41 dominance will be evaluated early on.
[0088] The invention provides various methods to choose a subset of viral variants, including but not limited to envelopes, to investigate the role of antigenic diversity in serial samples. In other aspects, the invention provides compositions comprising viral variants, for example but not limited to envelopes, selected based on various criteria as described herein to be used as immunogens.
[0089] In other aspects, the invention provides immunization strategies using the selections of immunogens to induce cross-reactive neutralizing antibodies. In certain aspects, the immunization strategies as described herein are referred to as “swarm” immunizations to reflect that multiple envelopes are used to induce immune responses. The multiple envelopes in a swarm could be combined in various immunization protocols of priming and boosting.
[0090] Sequences/Clones
[0091] Described herein are nucleic and amino acids sequences of HIV-1 envelopes. In certain embodiments, the described HIV-1 envelope sequences are gp160s. In certain embodiments, the described HIV-1 envelope sequences are gp120s. Other sequences, for example but not limited to gp140s, both cleaved and uncleaved, gp140 Envs with the deletion of the cleavage (C) site, fusion (F) and immunodominant (I) region in gp4—named as gp140ΔCFI, gp140 Envs with the deletion of only the cleavage (C) site and fusion (F) domain—named as gp140ΔCF, gp140 Envs with the deletion of only the cleavage (C)—named gp140AC (See e.g. Liao et al. Virology 2006, 353, 268-282), gp145s, gp150s, gp41s, which are readily derived from the nucleic acid and amino acid gp160 sequences. In certain embodiments the nucleic acid sequences are codon optimized for optimal expression in a host cell, for example a mammalian cell, a rBCG cell or any other suitable expression system.
[0092] In certain embodiments, the envelope design in accordance with the present invention involves deletion of residues (e.g., 5-11, 5, 6, 7, 8, 9, 10, or 11 amino acids) at the N-terminus. For delta N-terminal design, amino acid residues ranging from 4 residues or even fewer to 14 residues or even more are deleted. These residues are between the maturation (signal peptide, usually ending with CX, X can be any amino acid) and “VPVXXXX . . . ”. In case of CH505 T/F Env as an example, 8 amino acids (italicized and underlined in the below sequence) were deleted: ((SEQ ID NO: 8)
TABLE-US-00001 MRVMGIQRNYPQWWIWSMLGFWMLMICNGMWVTVYYGVPVWKEAKTTLFC ASDAKAYEKEVHNVWATHACVPTDPNPQE
(rest of envelope sequence is indicated as “ . . . ”). In other embodiments, the delta N-design described for CH505 T/F envelope can be used to make delta N-designs of other CH505 envelopes. CH505 Envelopes with delta N-terminal design are referred to as D8 or ΔN8 or deltaN8. In certain embodiments, the invention relates generally to an immunogen, gp160, gp120 or gp140, without an N-terminal Herpes Simplex gD tag substituted for amino acids of the N-terminus of gp120, with an HIV leader sequence (or other leader sequence), and without the original about 4 to about 25, for example 11, amino acids of the N-terminus of the envelope (e.g. gp120). See WO2013/006688, e.g. at pages 10-12, the contents of which publication is hereby incorporated by reference in its entirety.
[0093] The general strategy of deletion of N-terminal amino acids of envelopes results in proteins, for example gp120s, expressed in mammalian cells that are primarily monomeric, as opposed to dimeric, and, therefore, solves the production and scalability problem of commercial gp120 Env vaccine production. In other embodiments, the amino acid deletions at the N-terminus result in increased immunogenicity of the envelopes.
[0094] In certain embodiments, the invention provides envelope sequences, amino acid sequences and the corresponding nucleic acids, and in which the V3 loop is substituted with the following V3 loop sequence TRPNNNTRKSIRIGPGQTFY ATGDIIGNIRQAH (SEQ ID NO: 9). This substitution of the V3 loop reduced product cleavage and improves protein yield during recombinant protein production in CHO cells.
[0095] In certain embodiments, the CH505 envelopes will have added certain amino acids to enhance binding of various broad neutralizing antibodies. Such modifications could include but not limited to, mutations at W680G or modification of glycan sites for enhanced neutralization.
[0096] In certain aspects, the invention provides composition and methods which use a selection of sequential CH505 Envs, as gp120s, gp 140s cleaved and uncleaved and gp160s, as proteins, DNAs, RNAs, or any combination thereof, administered as primes and boosts to elicit immune response. Sequential CH505 Envs as proteins would be co-administered with nucleic acid vectors containing Envs to amplify antibody induction.
[0097] In certain embodiments the invention provides immunogens and compositions which include immunogens as trimers. In certain embodiments, the immunogens include a trimerization domain which is not derived from the HIV-1 envelope. In certain embodiments, the trimerization domain is GCN4 (See
[0098] HIV-1 gp120 Trimer Vaccine Immunogens
[0099] HIV-1 Env Gp120 GCN4 Trimer
[0100] HIV-1 Env gp120 GCN4 trimer is designed as a fusion protein to be expressed as soluble recombinant trimeric HIV-1 gp120 protein. HIV-1 Env gp120 is mutated from residue R to E at the cleavage site of HIV-1 gp120 at the residue positions R503 and R511 (or any mutations at this region) to destroyed the cleavage site, a 6-residue linker (GSGSGS) (the linker can be variations of 3-20 residues in length) is added to the C-terminal end of HIV-1 gp120 followed by addition of 33 amino acid residues of GCN4 sequence (RMKQIEDKIEEILSKIYHIENEIARIKKLIGER (SEQ ID NO: 10)). For additional linkers see U.S. Pat. No. 8,597,658 incorporated by reference.
[0101] HIV-1 Env Gp120 GCN4 CD40L Trimer:
[0102] In certain embodiments the trimer design includes an immune co-stimulator
[0103] HIV-1 Env gp120 GCN4 CD40L trimer is designed as a fusion protein to be expressed as soluble recombinant trimeric HIV-1 gp120 protein co-expressed with functional CD40L as immune co-stimulator. HIV-1 Env gp120 is mutated from residue R to E at the cleavage site of HIV-1 gp120 at the residue positions R503 and R511 (or any mutations at this region) to destroyed the cleavage site, a 6-residue linker (GSGSGS (SEQ ID NO: 11)) (the linker can be variations of 3-20 residues in length) is added to the C-terminal end of HIV-1 gp120, 33 amino acid residues of GCN4 sequence (RMKQIEDKIEEILSKIYHIENEIARIKKLIGER (SEQ ID NO: 10)) is added to the C terminal end of the 6-residue linker, then a 11-residue liner (GGSGGSGGSGG (SEQ ID NO: 12)) (the linker can be variations of 3-20, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 residues in length) is added to the C terminal end of the GCN4 domain, followed by addition of the sequence of the functional extracellular domain of the human CD40 ligand (L) E113-L261.
[0104] HIV-1 Env Gp120 GCN4 CD40L Trimer with his Tag:
[0105] HIV-1 Env gp120 GCN4 CD40L trimer with His tag is designed as a fusion protein to be expressed as soluble recombinant trimeric HIV-1 gp120 protein co-expressed with functional CD40L as immune co-stimulator. HIV-1 Env gp120 is mutated from residue R to E at the cleavage site of HIV-1 gp120 at the residue positions R503 and R511 (or any mutations at this region) to destroyed the cleavage site, a 6-residue linker (GSGSGS) (the linker can be variations of 3-20 residues in length) is added to the C-terminal end of HIV-1 gp120, 33 amino acid residues of GCN4 sequence (RMKQIEDKIEEILSKIYHIENEIARIKKLIGER (SEQ ID NO: 10)) is added to the C terminal end of the 6-residue linker, a 11-residue liner (GGSGGSGGSGG (SEQ ID NO: 12)) (the linker can be variations of 3-20 residues in length) is added to the C terminal end of the GCN4 domain, then the sequence of the functional extracellular domain of the human CD40 ligand (L) E113-L261 is then added followed by addition of 10 histidine residues as tag (the His tag can be more or less of 10 residues). His-tag is added to anchor the HIV-1 gp120GCN4 CD40L into liposome through nickel.
[0106] Using the instant disclosure of envelope timers, any HIV-1 envelope can be designed as a trimer. In certain embodiments the trimer designs can include any suitable linker, for example but not limited to linkers described in U.S. Pat. No. 8,597,658.
[0107] In certain embodiments the HIV-1 immunogen contemplated for use in the invention is any immunogen capable of inducing bnAbs against HIV-1 envelopes and epitopes therein. In non-limiting embodiments the immunogen is any one of the HIV-1 envelopes or selection of envelopes in Application WO2014042669 (PCT/US PCT/US2013/000210), U.S. Application Ser. No. 61/955,402 (“Swarm Immunization with Envelopes form CH505” Examples 2-4, FIGS. 14-19); U.S. Application Ser. Nos. 61/972,531 and 62/027,427 (Examples 2-3, FIGS. 18-24) the contents of which applications are herein incorporated by reference in their entirety.
[0108] In non-limiting embodiments the immunogen is selected from the following:
[0109] CH505 Envs to induce CD4 bs Abs. See WO2014042669; U.S. Application Ser. No. 61/955,402 (“Swarm Immunization with Envelopes form CH505” Examples 2-4, FIGS. 14-19); US Application Ser. Nos. 61/972,531 and 62/027,427.
[0110] CH848 Envs to induce V3 glycan Abs. See U.S. Application Ser. No. 61/972,649.
[0111] VRC26 Envs to induce V1V2 glycan Abs. Doria-rose N A et al. Nature 509: 55-62, 2014
[0112] CH01-CH04 bnAb heterologous Envs-V1V2 glycan Liao H X et al. Immunity 38: 176, 2013; Bonsignori M et al J. Virol 85: 9998, 2011
[0113] CH1754 Envs to induce CD4 bs Abs. See U.S. Application Ser. No. 61/884,014.
[0114] Group M B cell Mosaic Envs. See U.S. Patent Application Ser. No. 61/884,696
[0115] Series of CAP206 Envs to induce MPER Abs.
[0116] MPER peptide liposomes to induce MPER Abs. Non-limiting examples of MPER peptides are MPER656 of sequence NEQELLELDKWASLWNWFNITNWLWYIK (SEQ ID NO: 1); MPER656.1 of sequence NEQDLLALDKWASLWNWFDISNWLWYIK (SEQ ID NO: 2); MPER656.2 of sequence NEKDLLALDSWKNLWNWFSITKWLWYIK (SEQ ID NO: 3); MPER656.3 of sequence NEQELLALDKWNNLWSWFDITNWLWYIR (SEQ ID NO: 4); CAP206_0moB5_MPER656 of sequence NEKDLLALDSWKNLWNWFDITKWLWYIK (SEQ ID NO: 13). In certain embodiments, these peptide include an anchor/linker at the C-terminal end. The linker could be GTH1 (YKRWIILGLNKIVRMYS (SEQ ID NO: 9)). See US Pub 20110159037; U.S. Serial Application No. 61/883,306. See Verkoczy L et al. J. Immunol 191: 2538, 2013; Dennison S M et al. PLOS One 6: e27824, 2011).
[0117] Membrane-bound trimers—CH505, JRFL. See U.S. Application Ser. No. 61/941,902, and U.S. Application Ser. No. 61/973,414.
[0118] A244 gp120 to induce glycan and V1V2 bnAbs. See Alam S M J. viriology 87: 1554, 2013.
[0119] V1V2 Peptide-Glycans to induce V1V2 glycan bnAbs. See WO2014066889; Alam S M et al PNAS USA 110: 18214, 2013.
[0120] V1V2 tags recombinant protein-V1V2 glycan bnAbs. See
[0121] V3 Peptide-Glycans to induce V3 glycan bnAbs. See
[0122] Any other founder Envs that are antigenic for bnAb epitopes. Liao H X et al J. Virology 87: 4185, 2013
[0123] In certain embodiments, the compositions and methods include any immunogenic HIV-1 sequences to give the best coverage for T cell help and cytotoxic T cell induction. In certain embodiments, the compositions and methods include mosaic and/or consensus HIV-1 genes to give the best coverage for T cell help and cytotoxic T cell induction. In certain embodiments, the compositions and methods include mosaic group M and/or consensus genes to give the best coverage for T cell help and cytotoxic T cell induction. In some embodiments, the mosaic genes are any suitable gene from the HIV-1 genome. In some embodiments, the mosaic genes are Env genes, Gag genes, Pol genes, Nef genes, or any combination thereof. See e.g. U.S. Pat. No. 7,951,377. In some embodiments the mosaic genes are bivalent mosaics. In some embodiments the mosaic genes are trivalent. In some embodiments, the mosaic genes are administered in a suitable vector with each immunization with Env gene inserts in a suitable vector and/or as a protein. In some embodiments, the mosaic genes, for example as bivalent mosaic Gag group M consensus genes, are administered in a suitable vector, for example but not limited to HSV2, would be administered with each immunization with Env gene inserts in a suitable vector, for example but not limited to HSV-2.
[0124] In certain aspects the invention provides compositions and methods of Env genetic immunization either alone or with Env proteins to recreate the swarms of evolved viruses that have led to bnAb induction. Nucleotide-based vaccines offer a flexible vector format to immunize against virtually any protein antigen. Currently, two types of genetic vaccination are available for testing—DNAs and mRNAs.
[0125] In certain aspects the invention contemplates using immunogenic compositions wherein immunogens are delivered as DNA. See Graham B S, Enama M E, Nason M C, Gordon I J, Peel S A, et al. (2013) DNA Vaccine Delivered by a Needle-Free Injection Device Improves Potency of Priming for Antibody and CD8+ T-Cell Responses after rAd5 Boost in a Randomized Clinical Trial. PLoS ONE 8(4): e59340, page 9. Various technologies for delivery of nucleic acids, as DNA and/or RNA, so as to elicit immune response, both T-cell and humoral responses, are known in the art and are under developments. In certain embodiments, DNA can be delivered as naked DNA. In certain embodiments, DNA is formulated for delivery by a gene gun. In certain embodiments, DNA is administered by electroporation, or by a needle-free injection technologies, for example but not limited to Biojector® device. In certain embodiments, the DNA is inserted in vectors. The DNA is delivered using a suitable vector for expression in mammalian cells. In certain embodiments the nucleic acids encoding the envelopes are optimized for expression. In certain embodiments DNA is optimized, e.g. codon optimized, for expression. In certain embodiments the nucleic acids are optimized for expression in vectors and/or in mammalian cells. In non-limiting embodiments these are bacterially derived vectors, adenovirus based vectors, rAdenovirus (Barouch D H, et al. Nature Med. 16: 319-23, 2010), recombinant mycobacteria (i.e., rBCG or M smegmatis) (Yu, J S et al. Clinical Vaccine Immunol. 14: 886-093, 2007; ibid 13: 1204-11, 2006), and recombinant vaccinia type of vectors (Santa S. Nature Med. 16: 324-8, 2010), for example but not limited to ALVAC, replicating (Kibler K V et al., PLoS One 6: e25674, 2011 nov 9.) and non-replicating (Perreau M et al. J. virology 85: 9854-62, 2011) NYVAC, modified vaccinia Ankara (MVA)), adeno-associated virus, Venezuelan equine encephalitis (VEE) replicons, Herpes Simplex Virus vectors, and other suitable vectors.
[0126] In certain aspects the invention contemplates using immunogenic compositions wherein immunogens are delivered as DNA or RNA in suitable formulations. Various technologies which contemplate using DNA or RNA, or may use complexes of nucleic acid molecules and other entities to be used in immunization. In certain embodiments, DNA or RNA is administered as nanoparticles consisting of low dose antigen-encoding DNA formulated with a block copolymer (amphiphilic block copolymer 704). See Cany et al., Journal of Hepatology 2011 vol. 54 j 115-121; Arnaoty et al., Chapter 17 in Yves Bigot (ed.), Mobile Genetic Elements: Protocols and Genomic Applications, Methods in Molecular Biology, vol. 859, pp 293-305 (2012); Arnaoty et al. (2013) Mol Genet Genomics. 2013 August; 288(7-8):347-63. Nanocarrier technologies called Nanotaxi® for immunogenic macromolecules (DNA, RNA, Protein) delivery are under development. See www.incellart.com/en/research-and-development/technologies.html.
[0127] In certain aspects the invention contemplates using immunogenic compositions wherein immunogens are delivered as recombinant proteins. Various methods for production and purification of recombinant proteins suitable for use in immunization are known in the art.
[0128] The immunogenic envelopes can also be administered as a protein boost in combination with a variety of nucleic acid envelope primes (e.g., HIV −1 Envs delivered as DNA expressed in viral or bacterial vectors).
[0129] Dosing of proteins and nucleic acids can be readily determined by a skilled artisan. A single dose of nucleic acid can range from a few nanograms (ng) to a few micrograms (μg) or milligram of a single immunogenic nucleic acid. Recombinant protein dose can range from a few μg micrograms to a few hundred micrograms, or milligrams of a single immunogenic polypeptide.
[0130] Administration: The compositions can be formulated with appropriate carriers using known techniques to yield compositions suitable for various routes of administration. In certain embodiments the compositions are delivered via intramascular (IM), via subcutaneous, via intravenous, via nasal, via mucosal routes.
[0131] The compositions can be formulated with appropriate carriers and adjuvants using techniques to yield compositions suitable for immunization. The compositions can include an adjuvant, such as, for example but not limited to, alum, poly IC, MF-59 or other squalene-based adjuvant, ASOIB, or other liposomal based adjuvant suitable for protein or nucleic acid immunization. In certain embodiments, TLR agonists are used as adjuvants. In some embodiments, the TLR agonist is a TLR4 agonist, such as but not limited to GLA/SE. In other embodiment, adjuvants which break immune tolerance are included in the immunogenic compositions. In some embodiments the adjuvant is TLR7 or a TLR7/8 agonist, or a TLR-9 agonist, or a combination thereof. See PCT/US2013/029164.
[0132] Host Mechanisms Control bNAbs and Transient Immunomodulation During Vaccination
[0133] There are various host mechanisms that control bNAbs. For example highly somatically mutated antibodies become autoreactive and/or less fit (Immunity 8: 751, 1998; PloS Comp. Biol. 6 e1000800, 2010; J. Thoret. Biol. 164:37, 1993); Polyreactive/autoreactive naïve B cell receptors (unmutated common ancestors of clonal lineages) can lead to deletion of Ab precursors (Nature 373: 252, 1995; PNAS 107: 181, 2010; J. Immunol. 187: 3785, 2011); Abs with long HCDR3 can be limited by tolerance deletion (JI 162: 6060, 1999; JCI 108: 879, 2001). BnAb knock-in mouse models are providing insights into the various mechanisms of tolerance control of MPER BnAb induction (deletion, anergy, receptor editing). See J Immunol 187:3785, 2011; J Immunol 191:1260, 2013; J Immunol 191:3186, 2013. Other variations of tolerance control likely will be operative in limiting BnAbs with long HCDR3s, high levels of somatic hypermutations. 2F5 and 4E10 BnAbs were induced in mature antibody knock-in mouse models with MPER peptide-liposome-TLR immunogens. See J Immunol 191:2538, 2013; AIDS Res Hum Retrov 29:OA02.06, 2013.
[0134] All of the bnAbs identified so far have unusual characteristics and many are autoreactive. These bnAb traits predispose them to be deleted, edited, anergized or affinity reverted which likely prevents the induction of such bnAbs in vaccination settings.
[0135] In certain aspects the invention provides that to induce bnAbs by vaccination, there is a need to transiently modify the host to break tolerance mechanism—transient immunomodulation during vaccination. Breaking tolerance would overcome host controls and lead to induction and expansion of B cell clones of bnAbs. In certain embodiments the immunogens, methods and compositions of the invention comprise agents which modulate transiently host immune response mechanisms. In certain embodiments the immunogens, methods and compositions of the invention comprise immunomodulatory components. In a non-limiting embodiment, the immunogen is a fusion peptide which comprises CD40L.
[0136] Immunomodulatory Agents
[0137] In certain embodiments the invention provides agents, immunization methods and compositions which modulate the bone marrow/first tolerance checkpoint, agents which modulate the immune responses in the periphery, and agents which modulate B cell development at both checkpoints. Non-limiting examples of this modulation include PD-1 blockade; T regulatory cell depletion; CD40L hyperstimulation; soluble antigen administration, wherein the soluble antigen is designed such that the soluble agent eliminates B cells targeting dominant epitopes.
[0138] In non-limiting embodiments, these agents include PTP1B inhibitors, e.g. PTP1B Inhibitor—CAS 765317-72-4—Calbiochem (Wiesmann, C., et al. 2004. Nat. Struct. Mol. Biol. 11, 730), MSI 1436 (See Krishnan et al. Nature Chemical Biology 10, 558-566 (2014); chloroquine; clodronate or any other bisphosphonate; Foxo1 inhibitors, e.g. 344355|Foxo1 Inhibitor, —Calbiochem (See Nagashima et al. Mol Pharmacol 78:961-970, 2010).
[0139] Foxo1 is a key downstream target of the PI3K signaling cascade involved in shutting off RAG expression/promoting positive B cell selection, shutting it off should therefore release cells from central tolerance (See Amin and Schlissel NATURE IMMUNOLOGY VOLUME 9 NUMBER 6 Jun. 2008 pp. 613-622 and Chow et al refs). STI-571 (Gleevac) is used to inhibit the PTK that regulates foxo1 (See Amin and Schlissel in NATURE IMMUNOLOGY VOLUME 9 NUMBER 6 Jun. 2008 pp. 613-622. Although this appears critical in very early B-cells, it may be relevant for enriching for the initial bnAb repertoire, for example for long CDHR3 bnAbs that could be counterselected at the pre-ag stage. Foxo1 has multiple critical roles in B-cell development e.g. regulation of AID SHM (see Dengler et al 2008 NATURE IMMUNOLOGY VOLUME 9 NUMBER 12 Dec. 2008 pp. 1388-1398) and thus if its inhibition has a large effect in breaking central tolerance, may be useful not only in primes, could also be useful for modulating SHM levels in later boosts.
[0140] Other targets for immunomodulation as part of a vaccination schedule to elicit bNAbs are PI3K and downstream, negatively-regulated targets of PI3K, for example the delta isoform of PKC and GSK3a/b. See Verkoczy et al 2007 J Immunol 2007; 178:6332-6341 showing importance of the PI3K pathway in the first B cell tolerance checkpoint; See also Mecklenbrauker, I., Saijo, K., Zheng, N. Y., Leitges, M. and Tarakhovsky, A., Protein kinase Cdelta controls self-antigen-induced Bcell tolerance. Nature 2002. 416: 860-865; Miyamoto, A., Nakayama, K., Imaki, H., Hirose, S., Jiang, Y., Abe, M., Tsukiyama, T., Nagahama, H., Ohno, S., Hatakeyama, S. and Nakayama, K. I., Increased proliferation of B cells and autoimmunity in mice lacking protein kinase Cdelta. Nature 2002. 416: 865-869; Limnander, A., Depeille, P., Freedman, T. S., Liou, J., Leitges, M., Kurosaki, T., Roose, J. P. and Weiss, A., STIM1, PKC-delta and RasGRP set a threshold for proapoptotic Erk signaling during B cell development. Nat Immunol 2011. 12: 425-433, which show in the HEL model that PKDdelta is involved in peripheral tolerance/anergy.
[0141] Lithium chloride or carbonate are non-limiting examples of GSK inhibitors, and Rottlerin (3′-[(8-Cinnamoyl-5,7-dihydroxy-2,2-dimethyl-2H-1-benzopyran-6-yl)methyl]-2′,4′,6′-trihydroxy-5′-methylacetophenone) is a non-limiting example of PKCdelta-inhibitor.
[0142] In certain embodiments, these agents include as non-limiting examples anti-CD25 Abs to deplete Tregs. In other embodiments the agents include CCR4 inhibitors to modulate T cells—specifically effector human Tregs express CCR4, (but not naive T cells, Th1, and CTLs). See Bayry et al. Trends in Pharmacological Sciences, April 2014, Vol. 35, No. 4 163-165.
[0143] In certain embodiments the CCR4 inhibitor is ani-CCR4 antibody. In other embodiments, the CCR4 inhibitor is AF399/420/18 025 (Inserm U872) (see Pere et al. BLOOD, 3 Nov. 2011_VOLUME 118, NUMBER 18, p. 4853-4862), CCR4 inhibitor is CB20, CCR4 inhibitor is SP50, CCR4 inhibitor is CAS 864289-85-0 (Santa Cruz).
[0144] In certain embodiments, the method comprise administering an agent which modulates germinal center (GC) responses, in an amount sufficient to eliminate dominant B-cell clones, thereby providing an opportunity for a sub-dominant B cell clone expansion. See Han et al. J. Exp Med (1995), vol 182: 1635-1644. The agent is an immunogen/soluble antigen, for example but not limited to a peptide derived from HIV-1 envelope, is designed such that it binds to B-cells with receptors for dominant epitopes, but does not bind or binds less well to B cells with receptors for subdominant epitopes. The timing and amount of administering of this agent is critical, and in non-limiting embodiments this agent is administered shortly post vaccination with the immunogen of interest.
[0145] The immunostimulatory agents are administered at times appropriate for selection against unwanted GC B-cells. This selection is known to be active during the first and second thirds of the primary GC reaction; in primary immune responses, this period generally comprises days 5-12 post immunization. In some embodiments the agent is administered on day 5, 6, 7, 8, 9, 9, 11, 12, 13, or 14 after immunization to not interfere with T follicular helper cell induction of the GC but to rather interfere with T regulatory cell dampening of clones that are desired. The agent is administered in an amount which is in excess of an amount needed for triggering B cell responses. In experimental animal models, this dose (given i.v. and/or i.p.) has ranged from about 10 mg/kg to 0.30 mg/kg. Using this as guidance, a skilled artisan can readily determine the dose of soluble antigen that effective, including the minimum effective dose, to achieve selection against GC B cells.
[0146] For agents that interfere with the first tolerance checkpoint in bone marrow, for example but not limited to chloroquine or its analogues, these agents would be administered for several days, for example but not limited to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days before and up to 7-10, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 days after each immunization. A skilled artisan can readily determine the time of immunization in conjunction with treatment of immunomodulatory agent of the first and/or second checkpoint.
[0147] Similar regiment could be used for agents that interfere with the second tolerance checkpoint (ie tolerance checkpoints in the periphery) such as CD25 antibody. One embodiment of the invention is to administer the anti-CD25 antibody in low doses (such as 1-5 mg or less) IV or IM approximately 5-7, 5-12, 5-15, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 days after immunization to allow T help to occur and germinal center reactions to be started, and then to disrupt the T regulatory cell down-modulation of disfavored broadly neutralizing B cell lineages (bnAbs). For those bnAb lineages where both the first and second checkpoints are involved in limiting them (such as MPER gp41 bnAbs), it can be envisioned that combinations of first and second checkpoint inhibitors can be co-administered in such regimens as described above. For those bnAb lineages where just the second checkpoint tolerance mechanisms in the periphery are thought to be limiting such as for loop binding CD4 binding site antibodies, only those agents such as, but not limited to, CD25 antibodies would be administered as noted above.
[0148] In a non-limiting embodiment, a gp41 soluble immunogen is the agent which binds to B cells with dominant gp41 epitopes, but does not bind to B cells with subdominant epitopes within gp120. In certain embodiments, these B cells express receptors for subdominant epitopes for bnAbs, e.g. a CD4 bs. In a non-limiting embodiment, the gp41 soluble agent is administered in a vaccination method using non-gp120 HIV-1 envelope as an immunogen, e.g. gp140, gp145, gp160. In a non-limiting embodiment, aglycone V3 peptide is administered as the soluble antigen in an immunization regimen using V3 glycopeptide as an immunogen (See
[0149] In certain embodiments, the agents may be administered prior to, with, or after the immunogen. Dosing could be readily determined by a skilled artisan, such that the immunomodulation is transient. Dosing range could be about 1.25 μM (˜1 μg/mL) for PTP1B inhibitor, 250 mg/mL for the bisphosphonates, and 0.43 μg/mL for the Foxo1 inhibitor AS1842856.
[0150] In certain embodiments, the invention provides formulations wherein these agents are formulated in a manner that permits coadministration with the immunogen such that the compound may be released in a controlled manner (e.g., via polylactate/polyglycolate particles) so that the immunomodulatory agent will be present during any or all of the phases of the immune response. Existing data on these agents (see supra for respective citations) show that their effects are not permanent, and so the biological effect on immune modulation will be transient in the absence of continued administration. These immunomodulatory agents may be used singularly or in combination. These agents may also be administered at a single time point or at multiple time points, and may be administered prior to, with, and/or following the priming immunization and/or the boosting immunization(s) as might be necessary for production of bnAb. The composition comprising the immunogens to induce immune responses might be administered multiple times (multiple boosts) after treatment with the immunomodulatory agents of the invention.
EXAMPLES
Example 1: GCN4 Envelope Trimers and CD40L Containing Immunogens Bind HIV-1 Envelope Antibodies and are Functionally Active
[0151] Provided is one example of the design and formulation of liposomes that present immune-modulating CD40 ligand (CD40L) and HIV-1 gp41 neutralizing antigen. CD40L, the ligand for CD40 expressed on B-cell surface is anchored on the liposomes that had HIV-1 gp41 MPER peptide immunogen conjugated in them. Two broadly neutralizing gp41 membrane proximal external region (MPER) antibodies (2F5, 4E10) bound strongly to CD40L conjugated MPER peptide liposomes. This construct has important application as an experimental AIDS vaccine in providing immune-modulating effect to stimulate proliferation of B-cells capable of producing neutralizing antibodies targeting HIV-1 gp41 MPER region. CD40L-gp41 MPER peptide-liposome conjugates: Recombinant CD40L with an
TABLE-US-00002 N-terminal Histidine Tag (MGSSHHHHHH SSGLVPRGSH MQKGDQNPQI AAHVISEASS KTTSVLQWAE KGYYTMSNNL VTLENGKQLT VKRQGLYYIY AQVTFCSNRE ASSQAPFIAS LCLKSPGRFE RILLRAANTH SSAKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL (SEQ ID NO: 14))
was anchored to MPER peptide liposomes via His-Ni-NTA chelation by mixing CD40L with MPER656-Ni-NTA liposomes at 1:50 CD40L and Ni-NTA molar ratio (Figure-5).
[0152] The construction of MPER peptide Ni-NTA liposomes utilized the method of co-solubilization of MPER peptide having a membrane anchoring amino acid sequence and synthetic lipids 1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphocholine (POPC), 1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphoethanolamine (POPE), 1,2-Dimyristoyl-sn-Glycero-3-Phosphate (DMPA), Cholesterol and 1,2-dioleoyl-sn-Glycero-3-[(N-(5-amino-1-carboxypentyl)iminodiacetic acid)succinyl] (nickel salt) (DGS-NTA(Ni) at mole fractions 0.216, 35.00, 25.00, 20.00, 1.33 and 10 respectively. Appropriate amount of MPER peptide dissolved in chloroform-methanol mixture (7:3 v/v), appropriate amounts of chloroform stocks of phospholipids were dried in a stream of nitrogen followed by over night vacuum drying. Liposomes were made from the dried peptide-lipid film in phosphate buffered saline (pH 7.4) using extrusion technology.
[0153] Biolayer interferometry (BLI) assay showed the binding of anti-human CD40L antibody to CD40L-MPER656 liposomes and confirmed the correct presentation of CD40 L on liposome surface (
[0154] CD40L containing immunogens—MPER and gp120 envelopes—activate human CD40 expressing HEK cells.
Example 2—Combination of Antigens from CH505 Envelope Sequences for Immunization
[0155] Provided herein are non-limiting examples of combinations of antigens derived from CH505 envelope sequences for a swarm immunization. The selection includes priming with a virus which binds to the UCA, for example a T/F virus or another early (e.g. but not limited to week 004.3, or 004.26) virus envelope. In certain embodiments the prime could include D-loop variants. In certain embodiments the boost could include D-loop variants.
[0156] Non-limiting embodiments of envelopes selected for swarm vaccination are shown as the selections described below. A skilled artisan would appreciate that a vaccination protocol can include a sequential immunization starting with the “prime” envelope(s) and followed by sequential boosts, which include individual envelopes or combination of envelopes. In another vaccination protocol, the sequential immunization starts with the “prime” envelope(s) and is followed with boosts of cumulative prime and/or boost envelopes. In certain embodiments, the prime does not include T/F sequence (W000.TF). In certain embodiments, the prime includes w004.03 envelope. In certain embodiments, the prime includes w004.26 envelope. In certain embodiments, the immunization methods do not include immunization with HIV-1 envelope T/F. In other embodiments for example the T/F envelope may not be included when w004.03 or w004.26 envelope is included. In certain embodiments, there is some variance in the immunization regimen; in some embodiments, the selection of HIV-1 envelopes may be grouped in various combinations of primes and boosts, either as nucleic acids, proteins, or combinations thereof.
[0157] In certain embodiments the immunization includes a prime administered as DNA, and MVA boosts. See Goepfert, et al. 2014; “Specificity and 6-Month Durability of Immune Responses Induced by DNA and Recombinant Modified Vaccinia Ankara Vaccines Expressing HIV-1 Virus-Like Particles” J Infect Dis. 2014 Feb. 9. [Epub ahead of print].
[0158] HIV-1 Envelope Selection A (Ten Envelopes Sensitive Envelopes)):
[0159] 703010505.TF, 703010505.W4.03, 703010505.W4.26, 703010505.W14.21, 703010505.W20.14, 703010505.W30.28, 703010505.W30.13, 703010505.W53.31, 703010505.W78.15, 703010505.W100.B4, optionally in certain embodiments designed as trimers. See U.S. Provisional Application No. 62/027,427 incorporated by reference.
[0160] HIV-1 Envelope Selection B (Twenty Envelopes Sensitive Envelopes):
[0161] 703010505.TF, 703010505.W4.03, 703010505.W4.26, 703010505.W14.3, 703010505.W14.8, 703010505.W14.21, 703010505.W20.7, 703010505.W20.26, 703010505.W20.9, 703010505.W20.14, 703010505.W30.28, 703010505.W30.12, 703010505.W30.19, 703010505.W30.13, 703010505.W53.19, 703010505.W53.13, 703010505.W53.31, 703010505.W78.1, 703010505.W78.15, 703010505.W100.B4, optionally in certain embodiments designed as trimers. See U.S. Provisional Application No. 62/027,427 incorporated by reference.
[0162] HIV-1 Envelope Selection C (Four Envelopes):
[0163] 703010505.TF, 703010505.W53.16, 703010505.W78. 33, 703010505.W100.B6, optionally in certain embodiments designed as trimers. See
[0164] HIV-1 Envelope Selection D (Ten Production Envelopes):
[0165] CH505.M6; CH505.M11; CH505w020.14; CH505w030.28; CH505w030.21; CH505w053.16; CH505w053.31; CH505w078.33; CH505w078.15; CH505w100.B6, optionally in certain embodiments designed as trimers. See
[0166] HIV-1 Envelopes Selection E (Ten Early Envelopes):
[0167] CH505.M11; CH505.w004.03; CH505.w020.14; CH505.w030.28; CH505.w030.12; CH505.w020.2; CH505.w030.10; CH505.w078.15; CH505.w030.19; CH505.w030.21, optionally in certain embodiments designed as trimers. See
[0168] HIV-1 Selection F(10PR):
[0169] CH505.T/F; CH505.M11; CH505w020.14; CH505w030.28; CH505w030.21; CH505w053.16; CH505w053.31; CH505w078.33; CH505w078.15; CH505w100.B.
Example 3: Examples of Immunization Protocols in Subjects with Swarms of HIV-1 Envelopes
[0170] Immunization protocols contemplated by the invention include envelopes sequences as described herein including but not limited to nucleic acids and/or amino acid sequences of gp160s, gp150s, cleaved and uncleaved gp140s, gp120s, gp41s, N-terminal deletion variants as described herein, cleavage resistant variants as described herein, or codon optimized sequences thereof. A skilled artisan can readily modify the gp160 and gp120 sequences described herein to obtain these envelope variants. The swarm immunization protocols can be administered in any subject, for example monkeys, mice, guinea pigs, or human subjects.
[0171] In non-limiting embodiments, the immunization includes a nucleic acid is administered as DNA, for example in a modified vaccinia vector (MVA). In non-limiting embodiments, the nucleic acids encode gp160 envelopes. In other embodiments, the nucleic acids encode gp120 envelopes. In other embodiments, the boost comprises a recombinant gp120 envelope. The vaccination protocols include envelopes formulated in a suitable carrier and/or adjuvant, for example but not limited to alum. In certain embodiments the immunizations include a prime, as a nucleic acid or a recombinant protein, followed by a boost, as a nucleic acid or a recombinant protein. A skilled artisan can readily determine the number of boosts and intervals between boosts.
[0172] In non-limiting embodiments, the prime includes a 703010505.TF envelope and a loop D variant as described herein. In non-limiting embodiments, the prime includes a 703010505.TF envelope and/or 703010505.W4.03, 703010505.W4.26 envelope, and a loop D variant as described herein. In certain embodiments, the loop D variant is M6. In certain embodiments, the loop D variant is M5. In certain embodiments, the loop D variant is M10. In certain embodiments, the loop D variant is M19. In certain embodiments, the loop D variant is M11. In certain embodiments, the loop D variant is M20. In certain embodiments, the loop D variant is M21. In certain embodiments, the loop D variant is M9. In certain embodiments, the loop D variant is M8. In certain embodiments, the loop D variant is M7.
[0173] Table 1 shows a non-limiting example of a sequential immunization protocol using a swarm of HIV1 envelopes (703010505.TF, 703010505.W4.03, 703010505.W4.26, 703010505.W14.21, 703010505.W20.14, 703010505.W30.28, 703010505.W30.13, 703010505.W53.31, 703010505.W78.15, 703010505.W100.B4, optionally in certain embodiments designed as trimers. In a non-limiting embodiment, a suggested grouping for prime and boost is to begin with the CH505 TF+W4.03, then boost with a mixture of w4.26+14.21+20.14, then boost with a mixture of w30.28+30.13+53.31, then boost with a mixture of w78.15+100.B4.
TABLE-US-00003 Envelope Prime Boost(s) Boost(s) Boost(s) CH505 TF + W4.03 CH505 TF + W4.03 as a nucleic acid e.g. DNA/MVA vector and/or protein w4.26 + 14.21 + w4.26 + 14.21 + 20.14 20.14 as a nucleic acid e.g. DNA/MVA vector and/or protein w30.28 + 30.13 + w30.28 + 30.13 + 53.31 53.31 as a nucleic acid e.g. DNA/MVA vector and/or protein w78.15 + 100.B4 w78.15 + 100.B4 as a nucleic acid e.g. DNA/MVA vector and/or protein
[0174] A skilled artisan can readily determine the number and interval between boosts.
[0175] Table 2 shows a non-limiting example of a sequential immunization protocol using a swarm of HIV1 envelopes optionally in certain embodiments designed as trimers.
TABLE-US-00004 Envelope Prime Boost(s) 703010505.TF, 703010505.TF 703010505.TF, 703010505.W4.03, (optionally 703010505.W4.03, 703010505.W4.26, 703010505.W4.03, 703010505.W4.26, 703010505.W14.21, 703010505.W4.26) 703010505.W14.21, 703010505.W20.14, as a nucleic acid 703010505.W20.14, 703010505.W30.28, e.g. DNA/MVA 703010505.W30.28, 703010505.W30.13, vector and/or protein 703010505.W30.13, 703010505.W53.31, 703010505.W53.31, 703010505.W78.15, 703010505.W78.15, 703010505.W100.B4. 703010505.W100.B4 as a nucleic acid e.g. DNA/MVA vector and/or protein
[0176] A skilled artisan can readily determine the number and interval between boosts
[0177] For a 20mer immunization regimen (envelopes (703010505.TF, 703010505.W4.03, 703010505.W4.26, 703010505.W14.3, 703010505.W14.8, 703010505.W14.21, 703010505.W20.7, 703010505.W20.26, 703010505.W20.9, 703010505.W20.14, 703010505.W30.28, 703010505.W30.12, 703010505.W30.19, 703010505.W30.13, 703010505.W53.19, 703010505.W53.13, 703010505.W53.31, 703010505.W78.1, 703010505.W78.15, 703010505.W100.B4), in a non-limiting embodiment, one can prime with CH505 TF+W4.03, then boost with a mixture of w4.26+14.21+20.14+14.3+14.8+20.7, then boost with a mixture of w 20.26+20.9+30.12+w30.28+30.13+53.31, then boost with a mixture of w78.15+100.B4+30.19+53.19+53.13+78.1. Other combinations of envelopes are contemplated for boosts.
[0178] Table 3 shows a non-limiting example of a sequential immunization protocol using a swarm of HIV1 envelopes optionally in certain embodiments designed as trimers
TABLE-US-00005 Envelope Prime Boost(s) 703010505.TF, 703010505.TF, 703010505.TF, 703010505.W4.03, (optionally 703010505.W4.03, 703010505.W4.26, 703010505.W4.03, 703010505.W4.26, 703010505.W14.3, 703010505.W4.26, 703010505.W14.3, 703010505.W14.8, 703010505.W14.3, 703010505.W14.8, 703010505.W14.21, 703010505.W14.8, 703010505.W14.21, 703010505.W20.7, 703010505.W14.21), 703010505.W20.7, 703010505.W20.26, as a nucleic acid 703010505.W20.26, 703010505.W20.9, e.g. DNA/MVA 703010505.W20.9, 703010505.W20.14, vector and/or protein 703010505.W20.14, 703010505.W30.28, 703010505.W30.28, 703010505.W30.12, 703010505.W30.12, 703010505.W30.19, 703010505.W30.19, 703010505.W30.13, 703010505.W30.13, 703010505.W53.19, 703010505.W53.19, 703010505.W53.13, 703010505.W53.13, 703010505.W53.31, 703010505.W53.31, 703010505.W78.1, 703010505.W78.1, 703010505.W78.15, 703010505.W78.15, 703010505.W100.B4. 703010505.W100.B4. as a nucleic acid e.g. DNA/MVA vector and/or protein
[0179] A skilled artisan can readily determine the number and interval between boosts.
[0180] Table 4 shows a non-limiting example of a sequential immunization protocol using a swarm of HIV1 envelopes optionally in certain embodiments designed as trimers.
TABLE-US-00006 Envelope Prime Boost(s) Boost(s) Boost(s) CH505.M6 CH505.M6 CH505.M11 CH505.M11 as a nucleic acid e.g. DNA/MVA vector and/or protein CH505w020.14 CH505w020.14 CH505w030.28 CH505w030.28 as a nucleic acid e.g. DNA/MVA vector and/or protein CH505w078.15 CH505w078.15 CH505w053.31 CH505w053.31 CH505w030.21 CH505w030.21as a nucleic acid e.g. DNA/MVA vector and/or protein CH505w078.33 CH505w078.33 CH505w053.16 CH505w053.16 CH505w100.B6 CH505w100.B6 as a nucleic acid e.g. DNA/MVA vector and/or protein
[0181] A skilled artisan can readily determine the number and interval between boosts.
Example 4
[0182] The immunization methods and compositions of Example 4 can further comprise an agent for transient immunomodulation of the host immune response during vaccination.
[0183] One embodiment of the invention would be to administer the “production 10” CH505 Envs in the following regimen with each immunization being followed with a regimen such as low dose CD25 antibody 0.5-5 mg 5-7 days after each immunization. Immunization 1 would be DNA gp120, gp145, or gp160+gp120 or gp140 Env protein of M11 and M6 Envs, Immunization 2 would be DNA+Env protein of week 20.14, w30.28 and w78.15 Envs. Immunization 3 would be DNA+Env protein of week 53.31, w30.21 and w78.33 Envs and immunization 4 would be w52.16+w100B6 DNA+Env protein in the designs of the first immunization ie gp120 gp145 or gp160 etc. the protein could be g-120 monomers, gp120 trimers or gp140 trimers.
Example 5: Non-Human Primate Studies
[0184] NHP 79: CH505T/F gp120 envelope in GLA/SE. NHP 85: CH505T/F gp140 envelope in GLA/SE. This compares gp140 with gp120 induced antibodies.
[0185] NHP study of CH505T/F gp120 with GCN4 CH505 T/F in GLA/SE.
[0186] NHP study of CH505T/F gp120 with GCN4 CD40L CH505 T/F in GLA/SE.
[0187] NHP study of CH505T/F gp120 with GCN4 CD40L CH505 T/F in ALUM.
[0188] NHP study of CH505 T/F gp120 with GCN4 CD40L CH505 T/F=−HIS tag with liposomes in ALUM.
[0189] NHP study of M6 then rest of “production 10” (Table 4) gp120 in sequence gp120 GNC4 CD40L CH505 trimers with ALUM or GLA/SE (depends on antigenicity).
[0190] NHP study of M6 then rest of production 10 (Table 4) gp120 in sequence gp120 GNC4 CD40L CH505 trimers in ALUM or GLA/SE (depends on antigenicity), with a dose of chloloquine orally each day 10 days before each immunization and then a dose of CD25 Ab 5 days after each immunization.
Example 6: A New Pathway for Central B-Cell Tolerance: Interaction of AID, MyD88, and BCR
[0191] Example 6 shows that BCR and MyD88 signals synergize to increase AID expression in autoreactive immature and transitional B cells and to mediate their loss by apoptosis.
[0192] Expression of activation-induced cytidine deaminase (AID) in immature and transitional B cells in mice and humans is genetically linked to the first tolerance checkpoint.sup.1,2. In the absence of AID, autoreactive immature/transitional-1 (T1) B cells are inefficiently purged and exhibit increased resistance to receptor-induced apoptosis.sup.1. These substantial effects are surprising given that AID expression in the immature/T1 B-cell pools is only 3% of that in germinal center (GC) B cells.sup.1,3. It is now shown that B-cell antigen receptor (BCR) and Toll-like receptor (TLR) signaling synergize to elicit high levels of AID expression in immature/T1 B cells. This synergy is restricted to intracellular TLR ligands, requires both activation of phospholipase-D and intracellular acidification, and acts to ensure self-tolerance through a process that requires Myd88. Consistent with the requirement of AID and MyD88 for central B-cell tolerance and the role for intracellular acidification in activating intracellular TLR signaling and in the synergistic AID increase in immature/T1 B cells, mice treated with chloroquine exhibited relaxed central B-cell tolerance. These findings identify a novel mechanism for central B-cell tolerance and resolve several problematic weaknesses of current models for the first tolerance checkpoint. It is suggested that this intracellular acidification/MyD88/AID-mediated pathway may be the primary mechanism for central B-cell tolerance by deletion.
[0193] BCR- and TLR signaling synergistically activate mature, anti-DNA autoreactive B cells.sup.4, suggesting co-operative roles for these signaling in the regulation of B cells. To determine whether these signaling pathways elicit high levels of AID expression in immature/T1 B cells, immature/T1 B cells were sorted from bone marrow of B6 mice and these cells were stimulated with F(ab′).sub.2 anti-IgM antibody (anti-μ), CpG, LPS, or combination of these stimuli in vitro, and the AID message levels were quantified. As expected.sup.5, AID expression in immature/T1 B cells was elevated by stimulations with TLR ligands, CpG and LPS (
[0194] To explore mechanistic insight of this synergy, specific inhibitors were used to block respective intracellular events and signaling pathways. Upon anti-μ stimulation, surface BCR are internalized and located in the phagosome-like compartment′. Concomitantly, intracellular TLR, such as TLR7 and TLR9, are recruited to the same compartment in an activation of phospholipase D-dependent manner.sup.7,8. It is hypothesized that the co-localization of BCR and intracellular TLR, and subsequent unique signaling.sup.7,8 might be involved in the synergy. To test this possibility, activation of phospholipase D was blocked with normal (n)-butanol and assessed AID expression by immature/T1 B cells in vitro (
[0195] Both intracellular acidification and the adaptor protein MyD88 are essential for TLR9-mediated signaling. To determine if intracellular acidification is also required for the synergy, immature/T1 B cells were stimulated with CpG or CpG+anti-μ in the presence or absence of chloroquine. It was found that AID expression in immature/T1 B cells elevated by CpG or CpG+anti-μ stimulation was abrogated in the presence of 2.0 μg/ml of chloroquine (
[0196] Given that AID expression in immature/T1 B cells is required for central B-cell tolerance.sup.1,2, lack of the synergistic AID increase in immature/T1 B cells could also result in defective central B-cell tolerance in Myd88.sup.−/− mice. Indeed, the first tolerance checkpoint is mitigated in a MyD88-deficient patient.sup.10. To determine if MyD88 plays any role in central B-cell tolerance, repertoires of immature/T1 B cells between wild type and Myd88.sup.−/− mice were compared by measuring frequency and avidity of anti-DNA IgG obtained from single B-cell cultures; single immature/T1 B cells and MF B cells from B6 and Myd88.sup.−/− mice were sorted, and CD154-/BAFF-/IL-21-expressing feeder cells were used to culture on, which induce proliferation and differentiation into IgG-secreting cells. The average 1.2-4.5 μg/ml IgG in culture supernatants (Extended data
[0197] To assess effects of Myd88 on development of DNA-reactive B cells, Myd88.sup.−/− mice homozygous were generated for the autoreactive 3H9 VDJ knock-in allele.sup.11 and B-cell development in the bone marrow of these animals was examined by flow cytometry.sup.1. As B-cell development in mice homozygous for the “innocent” VDJ allele (B1-8 mice) were substantially different from that in wild-type mice (
[0198] The analysis of 3H9 mice heterozygous for Aicda, Myd88, or both (Aicda.sup.+/−Myd88.sup.+/−) revealed inverse correlation between gene dosage and the numbers of immature/T1 B cells in the bone marrow (
[0199] To determine whether intracellular acidification plays a role in central B-cell tolerance, 3H9 mice were treated with multiple injections of chloroquine for up to 8 days, and B-cell development in the bone marrow of these animals was assessed. The numbers of large- and small pre-B cells decreased in 3H9 mice treated with chloroquine. In contrast, the chloroquine treatment augmented the transition of small pre-B to immature/T1 B cells and/or the retention of immature/T1 B cells in bone marrow of 3H9 mice, as the ratio of immature/T1 B cells over small pre-B cells significantly increased in chloroquine-treated 3H9 mice (
[0200] Tolerance mechanisms negatively impact on B-cell development in mice homozygous for the anti-HIV-1 2F5 heavy- and light chain rearrangements (2F5 mice). It is hypothesized that B-cell tolerance mediated by intracellular acidification also play roles in the suppression of B cells in 2F5 mice. To test this, 2F5 mice were treated with chloroquine or PBS and B-cell development in these mice was compared. The chloroquine injections relaxed the severe suppression of B-cell development in 2F5 mice.
[0201] Example 6 shows that chloroquine treatment relaxed B-cell tolerance and altered B-cell repertoires in mice. It is a useful strategy to develop effective vaccine against pathogens, such as HIV-1.
[0202] Methods
[0203] Mice and Immunizations
[0204] Female C57BL/6 (B6), and congenic AID-deficient mice (B6(B6CB)-Aica.sup.tm1Hon; Aicda.sup.−/−).sup.14, MyD88-deficient mice (B6.129-Myd8.sup.tm1Aki; Myd88.sup.−/−).sup.15, 3H9 heavy chain knock-in mice (B6.129P2(Cg)-Igh-J.sup.tm1(3H9-VDJ)Mwg).sup.11, 3H9.Aicda.sup.−/− mice (3H9×Aicda.sup.−/−).sup.1, 3H9.Myd88.sup.−/− mice, and 3H9.Bcl2-Tg mice (3H9×B6.Cg-Tg(BCL2)22Wehi/J.sup.18) (all B6 background) were bred and maintained under specific pathogen-free conditions at the Duke University Animal Care Facility. Mice used in experiments were 7-12 weeks of age. All experiments involving animals were approved by the Duke University Institutional Animal Care and Use Committee.
[0205] In some experiments, 3H9 mice were injected i.p. with 100 μl PBS with or without 1.2 mg of chloroquine daily from day 0 to day 4, and then twice a day from day 4 to day 7 or day 8.
[0206] Flow Cytometry and Definition of Hematopoietic Populations
[0207] Specific B-lineage developmental compartments were identified as described.sup.1: CD43.sup.+ B (pre-pro-B and pro-B; B220.sup.lowCD93.sup.+IgM.sup.−IgD.sup.−CD43.sup.+), large pre-B (B220.sup.lowCD93.sup.+IgM.sup.− IgD.sup.−CD43.sup.−FSC.sup.high), small pre-B (B220.sup.lowCD93.sup.+IgM.sup.−IgD.sup.−CD43.sup.−FSC.sup.low), immature/T1 B (B220.sup.lowCD93.sup.+IgM.sup.+IgD.sup.+/−CD21.sup.−CD23.sup.−) and mature B (B220.sup.hiCD93.sup.−) cells in bone marrow, and splenic MF B (B220.sup.hiCD93.sup.−IgM.sup.intIgD.sup.hiCD21.sup.intCD23.sup.hi) cells of naïve mice, and germinal center B (GL-7.sup.+B220.sup.highFas.sup.+IgD.sup.−) cells in spleen of NP-CGG/alum immunized mice. Specific developmental compartments were designated for B6, and then identical gatings were used for all samples. Cells that take up propidium iodide were excluded from our analyses. Labeled cells were analyzed/sorted in a FACS Canto (BD Bioscience) or FACS Vantage with DIVA option (BD Bioscience). Flow cytometric data were analyzed with FlowJo software (Treestar Inc.).
[0208] Cell Cultures
[0209] Sorted bone marrow immature/T1 B cells and splenic MF B cells (2.5×10.sup.4 cells/well) were cultured in IMDM (Invitrogen) containing 10% HyClone FBS (Thermo scientific), 2-mercaptoethanol (5.5×10.sup.−5 M), penicillin (100 units/ml), streptomycin (100 μg/ml; all Invitrogen) and recombinant BAFF (250 ng/ml; R & D systems), in the presence or absence of F(ab′).sub.2 fragment of anti-IgM (anti-0 Ab (10 μg/ml; Jackson Immunoresearch), CpG (ODN1826, 0.5 and 5 μg/ml; InvivoGen), LPS (0127:B8, 0.5 and 5 μg/ml; Sigma) or combinations of these stimuli. In some cultures, n-butanol (0.1, 0.3, and 1.0%; Sigma) or chloroquine (0.4 and 2.0 μg/ml; Sigma) was also added. Twenty-four hours after culture, B cells were harvested in TRIzol-LS reagent for AID mRNA quantification.
[0210] Single immature/T1 B cells and MF B cells from unimmunized B6 and Myd88.sup.−/− mice, and control- and chloroquine-treated 3H9 mice were expanded in the presence of NB-21.2D9 feeder cells (N-cultures). Briefly, single immature/T1 B cells and MF B cells were directly sorted into each well of 96-well plates and cultured in the presence of exogenous recombinant IL-4 (2 ng/ml, Peprotech) and CD154-/BAFF-/IL-21-expressing NB-21.2D9 cells in RPMI 1640 (Invitrogen) supplemented with 10% HyClone FBS (Thermo scientific), 2-mercaptoethanol (5.5×10.sup.−5 M), penicillin (100 units/ml), streptomycin (100 μg/ml), HEPES (10 mM), sodiumpyruvate (1 mM), and MEM nonessential amino acid (1×; all Invitrogen). Two thirds of culture media were replaced with fresh media daily from day 2 to day 8. On days 9-10, culture supernatants were harvested for ELISA determinations.
[0211] Quantitative RT-PCR and Quantification of AID Expression
[0212] Expression of AID mRNA was determined by a quantitative RT-PCR.sup.1. Briefly, sorted immature/T1 and mature follicular B cells were lysed in TRIzol LS before and after cultures. Total RNA was prepared from these cells using standard phenol/chloroform extraction method, and then cDNA was prepared using SuperScript III reverse transcriptase (Invitrogen) with oligo(dT).sub.20 primers (Invitrogen). One-twentieth volume of cDNA samples were amplified in a primary PCR using Ramp-Taq DNA polymerase (Denville Scientific) with AID118 and AID119 primers.sup.14. Primary PCR condition: initial incubation of 95° C. for 7 min followed by 15 cycles of amplification steps (95° C. for 30 s, 58° C. for 20 sec, and 72° C. for 45 sec.). Primary PCR products were then subjected to quantitative PCR using SYBR Green core reagents and AIDF2/AIDR2 primers.sup.5.
[0213] ELISA Determinations
[0214] Concentrations of total IgG in culture supernatants were determined by standard ELISA. Briefly, 96-well ELISA plates (Corning) were coated with anti-mouse Igκ Ab and anti-mouse Igλ Ab (2 μg/ml each; Southern Biotech) in carbonate buffer for overnight. After washing, plates were blocked with PBS containing 0.5% BSA for 1 h. Diluted samples (at 1:100 and 1:1,000 dilutions in PBS containing 0.5% BSA and 0.1% Tween-20) and serially diluted standard anti-DNA mAb (HYB331-01; Abcam) were then applied to the plates and incubated for overnight. After washing, HRP-conjugated anti-mouse IgG (Southern Biotech) was added to the plates and incubated for 2 h. The HRP-activity was visualized with TMB substrate reagents (Biolegend) and OD.sub.450-OD.sub.620 was measured by spectrophotometer (Bio-Rad).
[0215] Anti-DNA IgG was measured by ELISA.sup.19. Briefly, ELISA plates were coated with phenol/chloroform-purified calf thymus DNA (Sigma) in 1×SSC (10 μg/ml) and dried up at 37° C. for overnight. After blocking with hypotonic buffer (1.5×10.sup.−2 M NaCl, 4.3×10.sup.−4 M Na.sub.2HPO.sub.4, and 1.9×10.sup.−3 M NaH.sub.2PO.sub.4) containing 3% FBS and 0.5% BSA for 1 h, samples (at 1:10 dilutions in hypotonic buffer containing 0.5% BSA and 0.1% Tween-20) and serially diluted standard anti-DNA mAb were applied to the plates and incubated for overnight. Bound IgG was detected by HRP-conjugated anti-mouse IgG and TMB substrates as described above. The cut-off OD.sub.450-OD.sub.620 values for total IgG and anti-DNA IgG were set at the point representing six-standard deviations above the mean OD.sub.450-OD.sub.620 values for supernatants from mock-treated, B-cell negative culture supernatant samples.
[0216] DNA avidity index, [anti-DNA IgG]/[total IgG], represents proportion of DNA-binding IgG to total IgG in reference to the anti-DNA mAb. To compare DNA avidity indices of individual immature/T1 B cells from control- and chloroquine-treated 3H9 mice, culture supernatant samples that contain total IgG (range: 1-3 μg/ml) were analyzed. Hapten-specific mAb, H33Lγ1.sup.20 was used as a negative control for DNA binding and (DNA avidity index of sample)<(DNA avidity index of H33Lγ1=0.003) was considered as negative in the assays.
[0217] Statistical Analyses of Data
[0218] Statistical significance (P<0.05) was determined by two-tailed Student's t test and Mann-Whitney's U test.
REFERENCES FOR EXAMPLE 6
[0219] 1 Kuraoka, M. et al. Activation-induced cytidine deaminase mediates central tolerance in B cells. Proc Natl Acad Sci USA (2011). [0220] 2 Meyers, G. et al. Activation-induced cytidine deaminase (AID) is required for B-cell tolerance in humans. Proc Natl Acad Sci USA (2011). [0221] 3 Kuraoka, M. et al. Activation-induced cytidine deaminase expression and activity in the absence of germinal centers: insights into hyper-IgM syndrome. J Immunol 183, 3237-3248 (2009). [0222] 4 Leadbetter, E. A. et al. Chromatin-IgG complexes activate B cells by dual engagement of IgM and Toll-like receptors. Nature 416, 603-607 (2002). [0223] 5 Ueda, Y., Liao, D., Yang, K., Patel, A. & Kelsoe, G. T-independent activation-induced cytidine deaminase expression, class-switch recombination, and antibody production by immature/transitional 1 B cells. J Immunol 178, 3593-3601 (2007). [0224] 6 Pone, E. J. et al. BCR-signalling synergizes with TLR-signalling for induction of AID and immunoglobulin class-switching through the non-canonical NF-kappaB pathway. Nat Commun 3, 767 (2012). [0225] 7 Chaturvedi, A., Dorward, D. & Pierce, S. K. The B cell receptor governs the subcellular location of Toll-like receptor 9 leading to hyperresponses to DNA-containing antigens. Immunity 28, 799-809 (2008). [0226] 8 Chaturvedi, A., Martz, R., Dorward, D., Waisberg, M. & Pierce, S. K. Endocytosed BCRs sequentially regulate MAPK and Akt signaling pathways from intracellular compartments. Nat Immunol 12, 1119-1126 (2011). [0227] 9 Han, J. H. et al. Class switch recombination and somatic hypermutation in early mouse B cells are mediated by B cell and Toll-like receptors. Immunity 27, 64-75 (2007). [0228] 10 Isnardi, I. et al. IRAK-4- and MyD88-dependent pathways are essential for the removal of developing autoreactive B cells in humans. Immunity 29, 746-757 (2008). [0229] 11 Chen, C., Nagy, Z., Prak, E. L. & Weigert, M. Immunoglobulin heavy chain gene replacement: a mechanism of receptor editing. Immunity 3, 747-755 (1995). [0230] 12 Chen, C. et al. The site and stage of anti-DNA B-cell deletion. Nature 373, 252-255 (1995). [0231] 13 Di Noia, J. M. & Neuberger, M. S. Molecular mechanisms of antibody somatic hypermutation. Annu Rev Biochem 76, 1-22 (2007). [0232] 14 Muramatsu, M. et al. Class switch recombination and hypermutation require activation-induced cytidine deaminase (AID), a potential RNA editing enzyme. Cell 102, 553-563 (2000). [0233] 15 Adachi, O. et al. Targeted disruption of the MyD88 gene results in loss of IL-1- and IL-18-mediated function. Immunity 9, 143-150 (1998). [0234] 16 Nilsen, H. et al. Uracil-DNA glycosylase (UNG)-deficient mice reveal a primary role of the enzyme during DNA replication. Mol Cell 5, 1059-1065 (2000). [0235] 17 Reitmair, A. H. et al. MSH2 deficient mice are viable and susceptible to lymphoid tumours. Nat Genet 11, 64-70 (1995). [0236] 18 Strasser, A. et al. Enforced BCL2 expression in B-lymphoid cells prolongs antibody responses and elicits autoimmune disease. Proc Natl Acad Sci USA 88, 8661-8665 (1991). [0237] 19 Chen, Z., Koralov, S. B. & Kelsoe, G. Complement C4 inhibits systemic autoimmunity through a mechanism independent of complement receptors CR1 and CR2. J Exp Med 192, 1339-1352 (2000). [0238] 20 Dal Porto, J. M., Haberman, A. M., Shlomchik, M. J. & Kelsoe, G. Antigen drives very low affinity B cells to become plasmacytes and enter germinal centers. J Immunol 161, 5373-5381 (1998).
Example 7: Oral Chloroquine Limits B-Cell Tolerance In Vivo
[0239] Chloroquine blocked synergistic AID up-regulation in vitro (Example 6).
[0240]
[0241] Whether administrations of chloroquine and/or anti-CD25 Abs enhance GC responses in 2F5 dKI mice is being tested.
[0242] The contents of all documents and other information sources cited herein are herein incorporated by reference in their entirety.