Trans-acting RNA switches
09719085 · 2017-08-01
Assignee
Inventors
- Scott A. Tenenbaum (Selkirk, NY, US)
- Francis J. Doyle, II (Albany, NY, US)
- Ajish George (Timonium, MD, US)
- Christopher Zaleski (Huntington, NY, US)
Cpc classification
C12N15/111
CHEMISTRY; METALLURGY
C12N2320/50
CHEMISTRY; METALLURGY
C12N2310/113
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
G01N33/5308
PHYSICS
International classification
C12N15/113
CHEMISTRY; METALLURGY
G01N33/53
PHYSICS
G01N33/50
PHYSICS
Abstract
Disclosed are RNA constructs which function to activate or inactivate a biological process, e.g., may be designed for attachment to a polypeptide coding region. Such RNA constructs modulate translation of a polypeptide from the coding region in response to the presence of a target polynucleotide in an expression environment. Such RNA constructs include a weakened stem-loop structure which, when bound to the target polynucleotide, assumes stem-loop secondary structure and associates with an RNA binding protein. Association with the RNA binding protein modulates translation of the polypeptide coding region. Such RNA constructs also have three-way junction joining regions 3′ and 5′ of the stem-loop structure.
Claims
1. A method for modulating translation of a polypeptide coding region comprising the step of: (A) providing a translatable RNA construct comprising a polypeptide coding region ligated to a non-naturally occurring RNA comprising a continuous sequence of ribonucleotide bases, the continuous sequence of ribonucleotide bases defining: a stem-loop structure which associates with an RNA binding protein present in an expression environment to modulate translation of the polypeptide coding region when the RNA construct is in a stem-loop conformation; simulated, three way junction joining regions 3′ and 5′ of the stem-loop structure; a first region 5′ of the 5′ joining region comprising bases complementary to a 3′ region of a target polynucleotide; a second region 3′ of the 3′ joining region comprising bases complementary to a 5′ region of the target polynucleotide; the base sequence of the first and second regions being selected to hybridize with complementary bases on the target polynucleotide spaced apart by an intermediate region on the target polynucleotide defining another three way junction joining region; and (B) introducing the translatable RNA construct into an expression system, whereby, in the absence of the target polynucleotide, the construct assumes a conformation inhibiting association with the RNA binding protein, and in the presence of the target polynucleotide, the construct assumes a stem-loop conformation promoting association with the RNA binding protein.
2. The method of claim 1, wherein at least one base in the stem of the stem-loop structure is mismatched with its potential binding partner so as to reduce the stability of the stem-loop structure.
3. The method of claim 1, wherein a joining region comprises no more than about 10 nucleotides.
4. The method of claim 1, wherein step (B) is effected by transfecting a DNA encoding the translatable RNA construct.
5. The method of claim 1, wherein the target polynucleotide is characteristic of a pathogen.
6. The method of claim 1, wherein the target polynucleotide is expressed preferentially in a cell type of a multicellular organism.
7. The method of claim 6, wherein the cell type is a neoplastic cell.
8. The method of claim 1, comprising the additional step of introducing the target polynucleotide into the expression environment.
9. The method of claim 1, wherein the expression environment is a cell and the polypeptide coding region encodes a polypeptide lethal to the cell.
10. The method of claim 9, wherein the cell is an infected cell or a neoplastic cell, and the target polynucleotide is expressed by the neoplastic cell or by an organism infecting the cell.
11. The method of claim 1, wherein the polypeptide coding region comprises a sequence encoding an enzyme or pore-forming protein.
12. The method of claim 1, wherein the polypeptide coding region encodes a detectable marker.
13. The method of claim 12, wherein the detectable marker is fluorescent.
14. The method of claim 1, wherein translation of the coding region is suppressed when the RNA binding protein binds to the stem-loop structure.
15. The method of claim 1, wherein translation of the coding region is promoted when the RNA binding protein binds to the stem-loop structure.
16. The method of claim 1, wherein the construct comprises more than one stem-loop structure.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1) The foregoing and other objects, features, and advantages of the present invention, as well as the invention itself, may be more fully understood from the following description of preferred embodiments, when read together with the accompanying drawings.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
(42)
(43)
(44)
(45)
(46)
(47)
(48)
(49)
(50)
(51)
(52)
(53)
(54)
(55)
(56)
(57)
(58)
(59)
DETAILED DESCRIPTION
I. Introduction
(60) A. Concept
(61) The present invention relates to the use of interactions between nucleic acid construct, such as an RNA construct, and a target polynucleotide, such as an RNA, as a functional switch. As disclosed herein, a very large number of RNA constructs of the type illustrated in
(62) In the design of RNA constructs according to the invention, the stem-loop structure of 1A is weakened so that the weakened structure will no longer efficiently associate with the protein (
(63) In order to be able to “turn on” this weakened RNA construct, a portion of the RNA construct is designed to base-pair with a target polynucleotide, often an RNA, such as an RNA from a pathogen or one present in a neoplastic cell. The target polynucleotide acts as a “splint” to reform the original stem-loop structure.
(64) More generally, at least four categories of RNA construct interactions with target polynucleotides can be used to influence RNA construct structure and, therefore, RBP binding site availability (
(65) Another category of interaction is one in which the target polynucleotide-RNA construct interaction is itself the target of an RNA-binding protein (
(66) B. Uses
(67) 1. Expression of a Polypeptide to Kill a Cell or Pathogen
(68) Polypeptide coding regions can be attached to RNA constructs that bind to any target polynucleotide that is a marker for infection or disease. This strategy can be used to target any pathogen, including viruses, bacteria, fungi or protozoa. Thus, the strategy can kill the cell harboring a pathogen and/or the pathogen itself. Beyond pathogens, this strategy can be used to eliminate diseased cells, such as neoplastic cells (e.g., cancer cells). In certain embodiments, an RNA construct connected to polypeptide coding region encoding a polypeptide able to kill a cell (e.g., a neoplastic cell or pathogenically infected cell) or pathogen is designed to bind to a target polynucleotide specifically expressed by, for example, a neoplastic cell or a pathogen. Polypeptide coding regions encoding death polypeptides include, for example, genes that induce apoptosis (e.g., caspases), pore-forming genes, or any other gene that would be toxic to a cell or pathogen. Multiple stem loop structures may be designed as part of the same RNA molecule to increase specificity. For example, two stem loop structures within the construct may be designed to bind different target polynucleotides, such that both target polynucleotides must be present to stabilize the RNA construct and promote translation. In another embodiment, two different types of stem-loop motifs (e.g., HSL and IRE) may be used as part of the same RNA molecule, so that the expression of the attached polypeptide coding region is more robust in a particular cell type (e.g., a cancer cell), in which SLBP and IRE RBPs are likely to be active. While selectivity is particularly important when expressing genes that are toxic to the cell, a construct with two or more stem-loop structures may be used in any of the embodiments of the invention described herein.
(69) 2. Diagnostic Testing and Imaging
(70) In another embodiment, an RNA construct can be used to diagnose the presence of a particular target polynucleotide in a cell. In this strategy, a marker gene encoding any protein that can be visualized or otherwise detected (e.g., a fluorescent or luminescent protein) is attached to an RNA construct. This strategy can be used, for example, for diagnostic testing or to highlight specific cells or tissues during imaging. In one example, an RNA construct is designed to bind a viral target polynucleotide and is attached to Green Fluorescent Protein (GFP). When the construct is delivered to cells, only cells infected with the virus will fluoresce.
(71) 3. Directing Protein Expression in Certain Cells
(72) Rather than simply killing a diseased cell, an RNA construct can be used to direct expression of an attached polypeptide coding region in a specific cell or tissue having a protein deficiency. For example, an RNA construct can be designed to bind to a target polynucleotide indicative of the protein deficiency. When the construct is delivered to cells, it will only direct expression of the protein in cells lacking the protein because the cells contain the target polynucleotide. In one alternative, if all cells of an organism (or cell culture) were lacking a given protein, an RNA construct could be designed to bind to a ubiquitously-expressed target polynucleotide, such that the attached gene would be expressed in all cells. In another alternative, an RNA construct could be designed to bind to a ubiquitously-expressed target polynucleotide, but the RNA construct could be delivered only to the cells or tissues lacking a given polypeptide. Using this strategy, the construct will only direct expression of the protein in cells lacking the protein because it will be delivered to only these cells. Combining administration of an RNA construct attached to a polypeptide coding region and RNAi is also contemplated. For example, for cells that not only lack a certain protein, but also make a defective version of that protein which contributes to the disease, an RNA construct can be administered together with RNAi which specifically targets the defective version of the protein. This strategy will not only eliminate the defective protein, but will also supply the wild-type protein. For example, RNAi targeting a defective Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) and an RNA construct comprising a polypeptide coding region encoding wild-type CFTR can be coadministered to a cell containing a defective CFTR. Table 1 provides examples of diseases that could be ameliorated by expression of the corresponding polypeptide using this type of a system.
(73) TABLE-US-00001 TABLE 1 Disease or Condition Polypeptide(s) to be Expressed by Construct Cystic Fibrosis Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) Lysosomal storage Sulfatases, N-acetylglucosamine-1-phosphate disorders transferase, Cathepsin A, GM2-AP, sphingolipid activator proteins, NPC1 and NPC2, or sialin Mucopolysaccharidosis a-L-iduronidase, iduronate sulfatase, heparan (subset type of lysosomal sulfamidase, N-acetylglucosaminidase, N- storage disease) acetylglucosamine 6-sulfatase, galactose 6- sulfatase, N-acetylgalactosamine 4-sulfatase, β-glucuronidase, or hyaluronidase Fabry's disease Enzyme alpha galactosidase A Addiction Disorders Dopamine receptor Depression Serotonin receptor, norepinephrine receptor, or dopamine receptor Gaucher Disease Acid β-glucosidase Diabetes Insulin
Additionally, other polypeptides that may be useful include interleukins, reproductive hormones, plasminogen activators, human growth hormones, colony-stimulating factors, blood-clotting factors, erythropoietins, and interferons.
4. Selecting Cells Containing a Target Polynucleotide
(74) In another embodiment of the invention, a DNA construct encoding the RNA construct of the invention can be transformed into a cell. The polypeptide coding region attached to the RNA construct encodes a polypeptide necessary for the continued survival of the cell. In the presence of a target polynucleotide, an RBP binds to the stabilized RNA construct and promotes translation of the polypeptide. In this scenario, only cells that contain the target polynucleotide will survive. In a variation of this embodiment, a population of cells is transformed with a DNA construct encoding the RNA construct in which the polypeptide coding region attached to the RNA construct encodes a polypeptide, for example a drug- or antibiotic-resistance gene (e.g., dihydrofolate reductase (DHFR), thymidine kinase, gene conferring resistance to neomycin, a neomycin analog such as G418, hydromycin, or puromycin) necessary for survival of the cell in a given environment. When transformed cells are placed into this environment (e.g., an environment containing a drug or antibiotic), only cells that (1) have been successfully transformed and (2) contain the target polynucleotide will survive.
(75) 5. Suppressing Translation of an Encoded Polypeptide in the Presence of a Target Polynucleotide
(76) In another embodiment, an RNA construct that binds to an RBP that suppresses, rather than enhances, expression may be used to express an attached polypeptide coding region in a cell that lacks a target polynucleotide. Then, if the target polynucleotide enters or becomes expressed in the cell, binding of the target polynucleotide to the RNA construct stabilizes the secondary structure, allowing the RBP to bind, which suppresses translation of the encoded polypeptide. This strategy can be used as a type of feedback loop, wherein, for example, a therapeutic protein is expressed until the cell achieves a certain level of health, at which time the target polypeptide is expressed, and the production of the therapeutic protein ceases. Should the cell return to an unhealthy state wherein the target polypeptide is no longer present, production of the therapeutic protein resumes.
(77) 6. Other Applications of an RNA Construct
(78) Many other applications of this invention are contemplated. Essentially, the expression of any polypeptide coding region encoding a polypeptide can be activated using this approach as long as the environment in which the RNA construct is to be delivered contains the activating target polynucleotide. RNA-constructs can also be designed to activate proteins that would enhance processes already occurring within a cell. Genes that could be targeted include any cellular gene, such as those involved in immune cell activation (IL-2), cell growth (cyclin B2, hTert), or vascular development (VEGF), as well as any gene product from any pathogen such as viruses, bacteria, fungi or protozoa.
II. RNA Construct
(79) A. General
(80) Returning to
(81) B. Construct Design
(82) The following section describes how to design an RNA construct of the type illustrated in
(83) 1. Design of Three-Way Junctions
(84) Three-way junctions are found in nature. (See, e.g., Lescoute et al. (2006) RNA 12:83-93.) The present invention simulates these natural structures and utilizes these simulated three-way junctions as a pattern upon which to build an RNA construct.
(85) When developing an RNA construct, the joining regions of the construct as well as the target polynucleotide are chosen according to
(86) The choice of three-way junction family will be governed by which of these conformations will not obstruct the activity (e.g., RBP binding) of the reinforced stem-loop.
(87) Tertiary interactions of bases in the joining regions with bases in the stem regions, as identified by crystallography in natural forms of three way junctions, may be engineered. On this basis, one can change the conformation to improve a given activity or increase stability, so long as the changes do not interfere with the RBP associating with the stem-loop.
(88) 2. Design of Weakened Stem-Loop
(89) To design a weakened stem-loop, point mutations are engineered in the wild-type (including a consensus motif sequence) by introducing non-canonical base pairs (i.e., mismatches) so that structure formation, without a trans-acting support, is no longer energetically favorable. The resulting weakened structure typically should not form bonds strong enough to spontaneously establish an active form of the structure, and when structure is re-formed via trans-acting stabilization, the bond distances typically should not interfere with function. The positions and identity of nucleotides important for activity typically are identified so that these bases are not changed. While vital nucleotides typically are not altered, the nucleotide with which a given vital nucleotide pairs may be able to be altered to weaken the stem without sacrificing binding to the reconstituted structure. Stem nucleotides that only provide structural integrity can be altered to reduce thermodynamic favorability of stem formation. In this case, both bases of a pair can be altered if desired. Canonical base pairs are defined as A-U, U-A, G-C, C-G. There are a number of alternative pairings such as G-U and U-U with varying energy levels and bond distance. The choice as to which bases should be substituted is made with the awareness that if relative bond distance and/or conformation of certain bases in the stem is important to activity, appropriate non-canonical pairings should be chosen (See, for example, Leontis, et al. (2002) N
(90) TABLE-US-00002 TABLE 2 C1′-C1′ Pairing distance U-U 8.1 Å C-C 8.5 Å U-G 10.2 Å G-U 10.2 Å C-G 10.3 Å A-U 10.3 Å U-A 10.3 Å G-C 10.3 Å C-A 10.4 Å A-C 10.4 Å U-C 11.8 Å C-U 11.8 Å A-A 12.3 Å G-A 12.5 Å A-G 12.5 Å
In addition to bond distance, bond angles and their effects on helix twist and stem “kink” may be considered.
(91) In the case of an RBP binding site, a consensus structure, which can be generated by binding assays, typically is the starting point, but any wild-type sequence (including any consensus sequence) can be used. Although the discussion of RNA construct design principles herein typically refers to an RNA sequence as the starting point, it should be understood that not only RNA sequences but also equivalent DNA sequences can be used. As the skilled artisan understands, an RNA sequence is equivalent to the sequence of a coding strand of genomic DNA or cDNA, because RNA that is transcribed from genomic DNA or cDNA has an identical sequence to the coding strand sequence of the genomic DNA or cDNA (with “T” nucleotides in the DNA sequence and “U” nucleotides in the RNA sequence). Thus, the design principles described herein are applicable when using RNA as a starting point or DNA as a starting point.
(92) In order to demonstrate the concepts of the present invention, a generalized, mock stem-loop consensus sequence is depicted in
(93) 3. Design of Flank Regions
(94) Flank regions are the regions of nucleotides adjacent to the stem on the 5′ and 3′ sides of the stem-loop structure that form two of the three joining regions and that bind to the target polynucleotide.
(95) As shown in
(96) Design of an RNA construct can be aided by use of any number of existing informatic RNA folding programs such as mfold, Sfold and the Vienna software. In addition, RNAFold can be used to examine optimal folds of a single RNA molecule; RNACofold can be used to examine optimal folds of two interacting RNA molecules; MiRanda or RNAHybrid can be used as part of high throughput screens to find naturally occurring instances of RNA-target polynucleotide interactions; and JMol can be used for visualizing existing crystal structures. These tools predict the probable structure of RNA and can be used in the design of complementary RNA constructs with predictable structural influences upon contact with the target polynucleotide. Depending on the target polynucleotide sequence, structural aspects may be exploited in the design of the RNA construct, especially with respect to areas of uniqueness in the target polynucleotide. Examples of this strategy include hairpin, stem-loops, cloverleafs, kissing complexes and other conformational structures known to result from traditional RNA-RNA interactions.
(97) 4. SELEX Approach
(98) Generally, SELEX (Systematic Evolution of Ligands by Exponential Enrichment) is a method for generating a ligand of interest by taking a population of randomly-generated ligands (e.g., small molecules, polynucleotides or polypeptides) and systematically selecting and amplifying ligands that meet chosen criteria. To select for a ligand of interest, a very large polynucleotide library of random sequences is synthesized. Next, the sequences are exposed to a target binding partner (e.g., a protein or small molecule). Unbound sequences are removed, and the bound sequences are eluted and amplified. The amplified population is again exposed to the target binding partner, and the process is repeated. The stringency of binding and elution conditions can be increased to preferentially enrich only the tightest binding sequences. After a number of cycles, the remaining sequences are identified.
(99) An RNA construct can be produced using a combination of the design approach outlined above and a SELEX-like approach. Use of a SELEX-like approach allows efficient screening of a large range of all possible RNA construct sequences for the best functional candidates. Designing an RNA construct with a SELEX-like approach has several steps in common with the above-described design approach, including choosing a functional motif for the RNA construct (e.g., histone stem-loop); identifying nucleotides important for desired activity (e.g., binding to an RBP); choosing a target polynucleotide sequence, such as an miRNA (e.g., HCMV-miR-US4 or miR-373), which is specific to a desired environment (e.g., HCMV-infected cells or breast cancer cells); and designing the flank sequences of the RNA construct by choosing the region of the target polynucleotide sequence to which the RNA construct will bind.
(100) A SELEX-like approach may be taken by keeping the flank sequences and nucleotides critical to the functioning of the motif constant and randomly generating sequences for the remaining positions. Specifically, a library of nucleic acids is generated having sequences in which the constant positions are the same in each sequence, and random nucleotides are placed into the variable positions.
(101) A starting library of potential RNA constructs having sequences in which constant positions are kept constant, and variable regions containing random sequences, is initially screened. In the initial screen, nucleic acids having sequences that bind to a protein of interest (e.g., an RBP) in the absence of the target polynucleotide are removed. Then, remaining nucleic acids are exposed to the protein of interest in the presence of the target polynucleotide, and unbound nucleic acids are removed. Bound nucleic acids are eluted, amplified, and the process is repeated under desired stringency conditions. Nucleic acids that remain after multiple rounds of selection are identified and further tested for desired activity. For example, identified nucleic acids may be attached to a polypeptide coding region that includes one or more reporter genes, placed in an expression environment in the presence or absence of the target polynucleotide and assayed to determine whether the reporter gene is expressed. Desired RNA constructs will be those that express the reporter gene only in the presence of the target polynucleotide.
(102) C. Histone Stem-Loop (HSL)
(103) 1. HSL Biology and Sequences
(104) The principles of RNA construct design can be applied to a histone stem-loop starting point. For example, a wild-type histone stem-loop (HSL) motif (including a consensus sequence of a HSL motif) can be used as the starting point for further design of an RNA construct in accordance with the principles described above.
(105) Metazoan cell cycle-regulated histone mRNAs are the only known cellular mRNAs that do not terminate in a poly(A) tail. Instead, these messages terminate in a conserved HSL motif, which functions to increase translation. The HSL motif is recognized and bound by “Stem-loop Binding Protein” (SLBP), an RBP, which is believed to upregulate the translation of one or more adjacent polypeptide coding regions through the action of a protein complex, shown in
(106) According to the methods of the present invention, an RNA construct can be designed with a HSL weakened sufficiently to prevent formation of the stem-loop, thereby preventing upregulation of an adjacent polypeptide coding region. The HSL of the RNA construct can be reactivated by binding to a target polynucleotide that stabilizes the stem-loop structure, thereby enabling activation of translation. The advantages of using the HSL motif are that it is well-studied and described, minimal translation occurs when it is inactive, and it achieves orders of magnitude of increased translation when active.
(107) The HSL motif has a conserved size and structure. The visual depiction of this is shown in the following HSL consensus sequence.
(108) ##STR00001##
(109) TABLE-US-00003 TABLE 3 shows the FASTA nucleic acid codes that are used throughout the description. FASTA code Nucleotide A Adenosine C Cytidine G Guanine T Thymidine U Uridine R G A (purine) Y T U C (pyrimidine) K G T U (keto) M A C (amino) S G C (strong) W A T U (weak) B G T U C D G A T U H A C T U V G C A N A G C T U (any) — Gap of indeterminate length
(110) In the HSL, one or more of the guanines at the base of the 5′ side stem, the adenine on the 3′ side stem, and the first and third uridines in the loop are typically needed for binding to a SLBP. The remaining nucleotides are more variable. However, in some instances the bases that are typically needed for binding to a SLBP may be altered even if some amount of activity is lost. Examples of naturally occurring HSL sequences are identified in
(111) While the HSL consensus sequence can be described visually, it can also be described using the logic search pattern (“PatSearch description”) described in Grillo, et al. (2003) N
(112) The PatSearch description for the HSL described visually above is:
(113) TABLE-US-00004 r1 = {AU, UA, GC, CG, GU, UG} MMM p1 = GGYYY U HHUH A r1~p1 MM
(114) “r1” indicates the rules for pairing to be applied to the consensus sequence. For example, the HSL stem can include “AU” base pairings, “UA” base pairings, “GC” base pairings, “CG” base pairings, “GU” base pairings, and “UG” base pairings. The next line shows the consensus sequence, beginning at the 5′ end with three “M” nucleotides. Next, “p1” indicates the first pattern of the consensus sequence, “GGYYY,” which represents the 5′ side of the stem. The next nucleotides in the sequence are UHHUHA, which represent the loop. Next, “r1˜p1” indicates that the pairing rules “r1” must be applied to the “p1” sequence to furnish the 3′ side of the stem. Finally, the 3′ end of the consensus sequence has two amino nucleotides, “MM.”
(115) Other examples of HSL consensus sequences are shown below.
(116) ##STR00002##
(117) It should be understood that any wild-type HSL sequence (including a consensus sequence) can be used as the starting point to make any number of RNA constructs. From this wild-type HSL, at least one stem-weakening mutation is incorporated into the construct to decrease the formation of the stem-loop structure in the absence of a target polynucleotide. Consensus sequences that include non-canonical base pairings (i.e., mismatches) are considered to be weakened when such a pairing (e.g., a GU or a UG pairing) is chosen, even if the consensus sequence is broad enough to include non-canonical pairings at those same positions (e.g., because some wild-type sequences falling within the consensus sequence have canonical base pairing, rather than non-canonical base pairing, at the location). Alternatively, an RNA construct can contain a wild-type stem-loop if the stem-loop, in the context of the RNA construct, has an increased Minimum Free Energy (MFE) compared to the stem-loop in a wild-type context, such that the stem-loop of the RNA construct will be less stable than will the stem-loop in a wild-type context.
(118) 2. Design of an Example RNA Construct when Starting from an HSL Motif
(119) This section illustrates the design of an RNA construct, shown in
(120) a. Joining Regions
(121) When designing an RNA construct based on an HSL motif, the size of the J2 joining region can be chosen so that the RNA construct-target polynucleotide structure forms a Family A, Family B or Family C structure. In the example depicted in
(122) HSL Consensus Sequence I begins with three “M” nucleotides. In
(123) The HSL consensus sequence ends with two “M” nucleotides. In
(124) b. Weakening the Stem
(125) The HSL consensus sequence has the sequence “GGYYY” on the 5′ side of the stem, corresponding to “GGUUC” in
(126) c. Flank Regions
(127) Flank regions can be designed according to the principles discussed above. The flank regions of the RNA construct include two of the three joining regions as well as sequence that is complementary to the target polynucleotide. In the example shown in
(128) As described above, the selected HSL sequence is then further modified to attach the polypeptide coding region using standard molecular biological protocols.
(129) D. Iron Response Element (IRE)
(130) Alternatively, a wild type Iron Response Element (IRE), including a consensus sequence of an IRE motif, can be used as the starting point for functional design of an RNA construct in accordance with the principles described above. The IRE is an stem-loop motif with a binding site for RBPs such as iron-responsive binding proteins, for example, aconitase 1 (ACO1, also known as iron-responsive element binding protein 1 or IRP1) and iron-responsive element binding protein 2 (IREB-2, also know as IRP2). IREs occur naturally in the 3′ and 5′UTRs of mRNAs that encode iron metabolism proteins. Translation may be up or down regulated depending upon whether the IRE is located in the 3′ or 5′ UTR and on the concentration of iron. Typically, IREs located in the 5′ UTR of an mRNA inhibit translation, while IREs located in the 3′ UTR stabilize mRNA, leading to increased translation. Additionally, iron-responsive binding proteins actively bind IREs when cellular iron concentration is low. For example, the transferrin receptor mRNA contains an IRE in its 3′ UTR, and therefore more transferrin is produced and more iron will be transported into the cell. Conversely, the ferritin H and L subunit mRNAs contain IREs in their 5′ UTRs and are suppressed when iron concentration is low (i.e., do not make proteins that incorporate iron if it is not available). As cellular iron concentration increases, IRP1 degrades and IRP2 deactivates, thus decreasing production of transferrin and increasing production of H and L ferritin subunits. (See also Matthias W. Hentze and Lukas C. Kuhn (1996) P
(131) In one strategy, depicted in
(132) In another strategy, an RNA construct is engineered from the wild-type sequence of an IRE (including a consensus sequence). The RNA construct includes one or more weakened IREs and is located in the 5′ UTR adjacent to the polypeptide coding region. The presence of a target polynucleotide stabilizes the IRE. The stabilized IRE associates with an RBP, leading to translation inhibition.
(133) In another strategy, RNA constructs are weakened IREs and are located both in the 5′ and 3′ UTRs adjacent to the polypeptide coding region. In this strategy, the flank regions of the weakened IREs in the 5′ and 3′ UTRs are designed to bind to different target polynucleotides. For example, the flank regions of the 3′ UTR RNA construct are designed to bind a target polynucleotide (“target 1”) found in target cells, and the flank regions of the 5′ UTR RNA construct are designed to bind a target polynucleotide (“target 2”) not found in the target cells. When the two RNA constructs adjacent the polypeptide coding region are introduced into target cells, The 3′ RNA construct is stabilized by the binding of target 1, and translation of the encoded polypeptide will increase. At a desired time point, target 2 can be introduced in the target cells to inhibit translation.
(134) The structure of the IRE motif is conserved but the exact composition of nucleotides can be variable, providing a useful platform for design of an RNA construct. Three subtypes of IRE consensus sequences can be used as a starting point from which to design an RNA construct.
(135) The PatSearch pattern for IRE subtype 1 is as follows:
(136) TABLE-US-00005 1.) IRE1 r1 = {AU, UA, GC, CG, GU, UG} p1 = 2 . . . 8 C p2 = 5 . . . 5 CAGWGH r1~p2 r1~p1
(137) “r1” indicates the rules for pairing to be applied to the consensus sequence. For example, the IRE1 consensus sequence can include “AU” base pairings, “UA” base pairings, “GC” base pairings, “CG” base pairings, “GU” base pairings, and “UG” base pairings. The IRE1 consensus sequence begins at the 5′ end with the first pattern, “p1,” which forms the first part of the 5′ side of the stem. “p1” defines a string of 2 to 8 nucleotides of any composition (A, G, C, or U). The next part of the 5′ side of the stem is an unpaired “C” nucleotide, followed by the second pattern “p2,” the last part of the 5′ stem. “p2” defines a string of exactly 5 nucleotides of any composition (A, G, C, or U). Following “p2” is the loop, which consists of the sequence “CAGWGH.” Following the loop is the first part of the 3′ side of the stem, which can be any string of nucleotides that pairs to the “p2” pattern, provided that the nucleotides follow the “r1” rules for pairing (as indicated by the PatSearch description “r1˜p2”). The final part of the 3′ stem can be any string of nucleotides that pairs to the “p1” pattern, provided that the nucleotides follow the “r1” rules for pairing (as indicated by the PatSearch description “r1˜p1”). Examples of specific naturally-occurring IRE1 sequences are identified in
(138) The PatSearch pattern for IRE subtype 2 is as follows:
(139) TABLE-US-00006 2.) IRE2 r1 = {AU, UA, GC, CG, GU, UG} p3 = 2 . . . 8 NNC p4 = 5 . . . 5 CAGWGH r1~p4 N r1~p3
(140) “r1” indicates the rules for pairing to be applied to the consensus sequence. For example, the IRE2 consensus sequence can include “AU” base pairings, “UA” base pairings, “GC” base pairings, “CG” base pairings, “GU” base pairings, and “UG” base pairings. The IRE2 consensus sequence begins at the 5′ end with the first pattern, “p3,” which forms the first part of the 5′ side of the stem. “p3” defines a string of 2 to 8 nucleotides of any composition (A, G, C, or U). The next part of the 5′ side of the stem is the sequence “NNC,” which will be unpaired. Next, the second pattern, “p4,” forms the last part of the 5′ stem. “p4” defines a string of exactly 5 nucleotides of any composition (A, G, C, or U). Following “p4” is the loop, which consists of the sequence “CAGWGH.” Following the loop is the first part of the 3′ side of the stem, which can be any string of nucleotides that pairs to the “p4” pattern, provided that the nucleotides follow the “r1” rules for pairing (as indicated by the PatSearch description “r1˜p4”). The second part of the 3′ stem can be any single unpaired nucleotide “N.” The final part of the 3′ stem can be any string of nucleotides that pairs to the “p3” pattern, provided that the nucleotides follow the “r1” rules for pairing (as indicated by the PatSearch description “r1˜p3”). Examples of specific naturally-occurring IRE2 sequences are identified in
(141) The PatSearch pattern for IRE subtype 3 is as follows:
(142) TABLE-US-00007 3.) IRE3 r1 = {AU, UA, GC, CG, GU, UG} p5 = 6 . . . 8 C p6 = 2 . . . 2 p7 = 3 . . . 3 CAGWGH r1~p7 U r1~p6 r1~p5
(143) “r1” indicates the rules for pairing to be applied to the consensus sequence. For example, the IRE3 consensus sequence can include “AU” base pairings, “UA” base pairings, “GC” base pairings, “CG” base pairings, “GU” base pairings, and “UG” base pairings. The IRE3 consensus sequence begins at the 5′ end with the first pattern, “p5,” which forms the first part of the 5′ side of the stem. “p5” defines a string of 6 to 8 nucleotides of any composition (A, G, C, or U). The next part of the 5′ side of the stem is an unpaired “C” nucleotide, followed by the second pattern “p6,” which makes up the third part of the 5′ stem. “p6” defines a string of exactly 2 nucleotides of any composition (A, G, C, or U). The final part of the 5′ stem is the pattern “p7,” which consists of exactly 3 nucleotides. Following “p7” is the loop, which consists of the sequence “CAGWGH.” Following the loop is the first part of the 3′ side of the stem, which can be any string of nucleotides that pairs to the “p7” pattern, provided that the nucleotides follow the “r1” rules for pairing (as indicated by the PatSearch description “r1˜p7”). The second part of the 3′ stem is the unpaired nucleotide “U.” The next part of the 3′ stem can be any string of nucleotides that pairs to the “p6” pattern, provided that the nucleotides follow the “r1” rules for pairing (as indicated by the PatSearch description “r1˜p6”). The final part of the 3′ stem can be any string of nucleotides that pairs to the “p5” pattern, provided that the nucleotides follow the “r1” rules for pairing (as indicated by the PatSearch description “r1˜p5”). Examples of specific naturally-occurring IRE3 sequences are identified in
(144) E. SECIS
(145) Alternatively, a wild type Selenocysteine Insertion Element (SECIS), including a consensus sequence of a SECIS motif, can be used as the starting point for functional design of an RNA construct in accordance with the principles described above. Two varieties of SECIS elements exist, type 1 and type 2 (SECIS1, SECIS2). An active SECIS element present in the 3′UTR of an mRNA causes the translation machinery to reinterpret a UGA stop codon as a selenocysteine residue. Selenocysteine incorporation at UGA codons also uses specialized trans-acting factors. They include a selenocysteine-specific tRNA, an elongation factor specific for this tRNA and a SECIS-binding protein, (e.g., SBP2, which is an RBP), which recruits the elongation factor to the selenoprotein mRNA. Ribosomal Protein L30 also binds the SECIS element. It is believed that a complex of SELB (the specialized elongation factor), Sec-tRNA.sup.sec (selenocysteine tRNA), GTP (guanosine triphosphate), SBP2 and SECIS form and then associate with the ribosome via L30. At this point, a conformational change in the SECIS element triggers the release of Sec-tRNA.sup.Sec and GTP hydrolysis, which allows incorporation of the selenocysteine residue into the polypeptide. (See, e.g., Chavatte et al. (2005) N
(146) As shown in
(147) The PatSearch description for the SECIS type 1 consensus sequence is as follows:
(148) TABLE-US-00008 A.) SECIS1 r1 = {AU, UA, GC, CG, GU, UG} p1 = 4 . . . 19 p2 = 2 . . . 9 R UGAN p3 = 8 . . . 12 p4 = 0 . . . 3 p5 = aav p7 = 7 . . . 10 r1~p3[1, 0, 0] p3: ((({circumflex over ( )}RR|{circumflex over ( )}MC)|{circumflex over ( )}SU)6 . . . 10) NGAN p8 = 2 . . . 9 r1~p1
“r1” indicates the rules for pairing to be applied to the consensus sequence. For example, the SECIS1 consensus sequence can include “AU” base pairings, “UA” base pairings, “GC” base pairings, “CG” base pairings, “GU” base pairings, and “UG” base pairings. The SECIS1 consensus sequence begins at the 5′ end with the first pattern, “p1,” which forms the first part of the 5′ side of the stem. “p1” defines a string of 4 to 19 nucleotides of any composition (A, G, C, or U). The next part of the 5′ side of the stem is the second pattern “p2,” which defines a string of 2 to 9 unpaired nucleotides of any composition (A, G, C, or U), followed by an “R.” The next part of the 5′ side of the stem is the string of nucleotides “UGAN.” The next part of the 5′ side of the stem is defined by the pattern “p3,” which consists of 8-12 nucleotides. “p3” is further defined by the PatSearch description, “p3:(((^RR|^MC)|^SU) 6 . . . 10),” which indicates that “p3 must start with either “RR,” “MC,” or “SU” followed by 6-10 nucleotides of any composition (making up 8-12 nucleotides total). Pattern “p4” defines the 5′ end of the loop, which can be 0 to 3 nucleotides of any composition (A, G, C, or U). The loop continues with pattern “p5,” defined by the string of nucleotides “AAV.” The loop continues with pattern “p7,” which consists of 7 to 10 nucleotides of any composition (A, G, C, or U). Following the loop is the first part of the 3′ side of the stem, which can be any string of nucleotides that pairs to the “p3” pattern, provided that the nucleotides follow the “r1” rules for pairing. The PatSearch description, “r1˜p3[1,0,0]” indicates that the nucleotides in this section can, but are not required to, incorporate 1 mismatch, 0 insertions, and 0 deletions. The second part of the 3′ stem is the string of nucleotides “NGAN.” The next part of the 3′ stem consists of 2 to 9 unpaired nucleotides of any composition (A, G, C, or U). The final part of the 3′ stem can be any string of nucleotides that pairs to the “p1” pattern, provided that the nucleotides follow the “r1” rules for pairing. Examples of specific naturally-occurring SECIS type 1 sequences are identified in
(149) The PatSearch description for the SECIS type 2 consensus sequence is as follows:
(150) TABLE-US-00009 B.) SECIS2 r1 = {AU, UA, GC, CG, GU, UG} p1 = 4 . . . 19 p2 = 2 . . . 9 A UGAN p3 = 8 . . . 12 p3: ((({circumflex over ( )}RR|{circumflex over ( )}MC)|{circumflex over ( )}SU)6 . . . 10) p4 = 0 . . . 3 p5 = AAV p6 = 11 . . . 14 p6: (0 . . . 1 p7 = 2 . . . 7 3 . . . 6 r1~p7 0 . . . 3$) (((r1~p3[1, 0, 0]|r1~p3[1, 1, 0])|r1~p3 [1, 0, 1])|r1~p3[0, 1, 1]) NGAN pl0 = 2 . . . 9 r1~p1
(151) “r1” indicates the rules for pairing to be applied to the consensus sequence. For example, the SECIS2 consensus sequence can include “AU” base pairings, “UA” base pairings, “GC” base pairings, “CG” base pairings, “GU” base pairings, and “UG” base pairings. The SECIS2 consensus sequence begins at the 5′ end with the first pattern, “p1,” which forms the first part of the 5′ side of the stem. “p1” defines a string of 4 to 19 nucleotides of any composition (A, G, C, or U). The next part of the 5′ side of the stem is the second pattern “p2,” which defines a string of 2 to 9 unpaired nucleotides of any composition (A, G, C, or U), followed by an “A.” The next part of the 5′ side of the stem is the string of nucleotides “UGAN.” The next part of the 5′ side of the stem is defined by the pattern “p3,” which consists of 8-12 nucleotides. “p3” is further defined by the PatSearch description, “p3:(((^rr|^mc)|^su) 6 . . . 10),” which indicates that “p3 must start with either “RR,” “MC,” or “SU” followed by 6-10 nucleotides of any composition (making up 8-12 nucleotides total). Pattern “p4” defines the 5′ end of the loop, and can be 0 to 3 nucleotides of any composition (A, G, C, or U). The loop continues with pattern “p5,” defined by the string of nucleotides “AAV.” The loop continues with pattern “p6,” which consists of 11 to 14 nucleotides which begins with 0 to 1 nucleotide of any compositions (A, G, C, or U), followed by the pattern p7, which can be 2 to 7 nucleotides of any composition (A, G, C, or U) followed by 3 to 6 nucleotides, provided that the last 3 nucleotides, which will form the first part of the 3′ side of the stem, follow the “r1” rules for pairing. The next part of the 3′ side of the stem can be any string of nucleotides that pairs to the “p3” pattern, provided that the nucleotides follow the “r1” rules for pairing. The PatSearch description, “(((r1˜p3[1,0,0]|r1˜p3[1,1,0])|r1˜p3[1,0,1])|r1˜p3[0,1,1])” indicates that the nucleotides in this section can (but are not required to) incorporate 1 mismatch, 0 insertions, and 0 deletions; 1 mismatch, 1 insertion, and 0 deletions; 1 mismatch, 0 insertions, and 1 deletion; or 0 mismatches, 1 insertion, and 1 deletion. The second part of the 3′ stem is the string of nucleotides “NGAN.” Pattern 10 defines the next part of the 3′ stem, which consists of 2 to 9 unpaired nucleotides of any composition (A, G, C, or U). The final part of the 3′ stem can be any string of nucleotides that pairs to the “p1” pattern, provided that the nucleotides follow the “r1” rules for pairing. Examples of specific naturally-occurring SECIS type 2 sequences are identified in
(152) F. Internal Ribosome Entry Site (IRES)
(153) Alternatively, a wild type Internal Ribosomal Entry Site (IRES), including a consensus sequence of a IRES motif, can be used as the starting point for functional design of an RNA construct in accordance with the principles described above. The IRES is located in the 5′ UTR of mRNA and allows for 5′ cap-independent initiation of translation. Multiple forms have been identified and some interact with different factors to begin translation. For example, some IRESes bind eIF4G to initiate translation, while some act by directly binding to the 40S subunit. However, IRESes are not known to bind to an RBP. Instead, proper formation of the IRES facilitates binding of proteins that make up the translation machinery itself (e.g., eIF4G or the 40S subunit).
(154) IRESes typically are large and more complex than a simple stem-loop. A few flaviviruses have an IRES with similar structure, shown generally in
(155) As shown in
III. Target Polynucleotides
(156) Target polynucleotides can be any endogenous polynucleotide (e.g., a DNA or an RNA, such as a coding RNA, non-coding RNA, regulatory RNA, or microRNA) that is present in, or characterizes, a particular cell type or tissue in which a polypeptide coding region attached to an RNA construct of the present invention is to be expressed. Alternatively, a target polynucleotide can be one that has been exogenously supplied to an expression environment. An expression environment is any environment in which a polypeptide coding region can be expressed (e.g., a naturally-occurring cell, such as a neoplastic cell or infected cell; a non-naturally occurring cell; or a cell-free expression system (e.g., available from Life Technologies, Foster City, Calif.), such as rabbit reticulocyte lysate, wheat germ extract or E. coli cell-free system). Target polynucleotides bind to the flank regions of an RNA construct, typically stabilizing the secondary structure of the RNA construct, for example, the stem-loop. (It should be understood that, while the text focuses on a target polynucleotide that stabilizes an RNA construct, it can have other effects, such as those described for
(157) Target polynucleotides can be any non-coding or coding polynucleotide. Typically, though, they are non-coding RNAs, such as microRNAs. Factors for choosing a target polynucleotide having appropriate activity at the RNA construct are that the target polynucleotide be found in the expression environment into which the RNA construct is placed and, preferably, in an abundant manner. In general, the target polynucleotide can function regardless of specific size, sequence, or structure, and a complementary flanking region of an RNA construct can be designed to be specific for any target polynucleotide once it has been identified and sequenced. The RNA construct so designed should change its structure in the presence of the target polynucleotide, thus creating a “switch” with one structural state forming in the absence of the target polynucleotide and another structural state being created in the presence of a target polynucleotide. The specific structure and/or sequence of the target polynucleotide is chosen for its ability to confer a change in the RNA construct structure and thus its activity state.
(158) Selection of a target polynucleotide is based on multiple criteria including, but not limited to, uniqueness, prevalence, and energetics. For example, a target polynucleotide sequence should be unique enough so that the structure of the RNA construct is reinforced and becomes active only in the targeted environment. For instance, a viral microRNA (miRNA) that occurs in infected cells can be used as a target polynucleotide if it is sufficiently different from host sequences in non-infected cells to prevent activation of the RNA construct and translation of the polypeptide coding region where not intended. In addition, the target polynucleotide should be present in sufficient quantity to increase the likelihood that it will interact with the RNA construct. The sequence of the target polynucleotide also should allow for the RNA construct to base pair with a favorable energy minimization to promote structure formation. For example, the calculated MFE (minimum free energy) structure should be such that the target polynucleotide is predicted to hybridize the RNA construct's flank regions as desired (rather than the RNA construct folding with itself and the target polynucleotide folding with itself or the RNA construct and the target polynucleotide hybridizing in a manner other than what is desired).
(159) 1. Uniqueness
(160) One factor in selecting a target polynucleotide, such as a viral RNA, is the degree to which the target polynucleotide can selectively (and specifically) activate the RNA construct. Ideally, this occurs uniquely in the desired environment such as the targeted cell or tissue. The desired selectivity may result from several factors including the target polynucleotide sequence and/or quantity.
(161) The most direct manner to achieve specificity of the target polynucleotide will result as a consequence of the uniqueness of its primary sequence. For example, there are many examples of viral specific expressed RNAs that are different from any known human sequence. Example 2 details just one of these situations, where SV40 microRNA differs from its cellular microRNA counterpart by several nucleotides. These sequence differences can be used to design the RNA construct such that they are optimized. Logically, it is expected that the longer the sequence is, the more likely it will have sufficient uniqueness to serve as the basis for designing a complementary specific RNA construct.
(162) 2. Prevalence
(163) An additional approach to the specificity issue is to take advantage of target polynucleotides that are uniquely expressed in a desired tissue or cell-type. For instance, one could still use a viral target polynucleotide that had an exact cellular counterpart, if the cellular RNA was only expressed at an irrelevant time point (such as during embryogenesis) or in an unrelated cell type that would not be exposed to the RNA construct. Despite the lack of sequence or structural uniqueness, distinctively expressed (or distributed) target polynucleotides could still be used to activate the RNA construct.
(164) Likewise, if there is a substantial difference in the quantity of the target polynucleotide being expressed in a desired environment relative to an environment in which expression of the RNA construct is not desired, then selective activation of the RNA construct can still be achieved. For example, in the case of a viral target polynucleotide that has an exact cellular (host) counterpart, the cellular version could be expressed at very low background levels but during the course of viral infection, a 10.000-fold increase could be produced in infected cells. This quantitative difference could serve to produce the desired selectivity.
(165) 3. Identifying Target Polynucleotides
(166) Target polynucleotides according to the present invention can be identified from a number of sources. For example, to target virally-infected cells, the flanking regions of an RNA construct can be designed to be complementary to microRNAs expressed by viruses. First, using the mirBase web resource (www.microrna.sanger.ac.uk/sequences/) for microRNAs, a search using the keywords “virus” and “viral” was performed. microRNA sequences from viruses known to infect humans were compiled (
(167) The same approach can be taken for any pathogen. For example, the rFam database, which includes many non coding RNA families, can be used and the mirBase databases, which includes many microRNAs coded by viruses and animals, can be used. Additionally, NCBI genome entries can be reviewed individually for particular organisms of interest. Moreover, the same approach can be taken for any diseased cell, such as a neoplastic cell. For example, miRNAs from the mirBase database (microrna.sanger.ac.uk/sequences/) can be examined. Additionally, other disease-specific target polynucleotides, such as RNAs, known in the art can be used. Examples of cancer-specific RNAs include, but are not limited to, the human breast cancer-specific microRNA hsa-miR-373 and the testicular cancer-specific microRNA hsa-miR-520c. miR-373 and miR-520c have been shown to be involved in metastatic breast cancer and testicular cancer, respectively, and not present in normal adult tissue. They may play a role in other cancer types as well. The other isoforms of hsa-miR-520 (see Table 4) are also contemplated to be useful.
(168) TABLE-US-00010 TABLE 4 mirBase mirBaseID Accession Mature miRNA Sequence hsa-miR-520a-5p MIMAT0002833 CUCCAGAGGGAAGUACUUUCU (SEQ ID NO: 180) hsa-miR-520a-3p MIMAT0002834 AAAGUGCUUCCCUUUGGACUGU (SEQ ID NO: 181) hsa-miR-520b MIMAT0002843 AAAGUGCUUCCUUUUAGAGGG (SEQ ID NO: 182) hsa-miR-520c-5p MIMAT0005455 CUCUAGAGGGAAGCACUUUCUG (SEQ ID NO: 183) hsa-miR-520c-3p MIMAT0002846 AAAGUGCUUCCUUUUAGAGGGU (SEQ ID NO: 184) hsa-miR-520d- MIMAT0002855 CUACAAAGGGAAGCCCUUUC (SEQ ID NO: 185) 5p hsa-miR-520d- MIMAT0002856 AAAGUGCUUCUCUUUGGUGGGU (SEQ ID NO: 186) 3p hsa-miR-520e MIMAT0002825 AAAGUGCUUCCUUUUUGAGGG (SEQ ID NO: 187) hsa-miR-520f MIMAT0002830 AAGUGCUUCCUUUUAGAGGGUU (SEQ ID NO: 188) hsa-miR-520g MIMAT0002858 ACAAAGUGCUUCCCUUUAGAGUGU (SEQ ID NO: 189) hsa-miR-520h MIMAT0002867 ACAAAGUGCUUCCCUUUAGAGU (SEQ ID NO: 190)
(169) 4. Experimental Validation of Target Polynucleotide Expression
(170) One direct way to empirically identify viral target polynucleotides is to infect cell cultures with virus and sequence the expressed polynucleotides using a viral specific custom tiling-array strategy or second generation sequencing technologies. The resulting polynucleotide that is identified is compared to polynucleotides from non-infected control cell cultures. Unique viral polynucleotides found to be expressed in abundance are good candidates for use as a viral specific target polynucleotides. These could include microRNAs, non-coding RNAs, regulatory RNAs and even genic/coding RNAs.
(171) A similar procedure can be used to identify target polynucleotides for other pathogens. Moreover, target polynucleotides can be identified for diseased cells, such as neoplastic cells, by comparing the RNA being expressed between a diseased cell and a normal cell. Unique polynucleotides expressed in abundance in a diseased cell are good candidates for use as a diseased-cell specific target polynucleotide.
IV. Polypeptide Coding Region
(172) A polypeptide coding region may be attached 5′ or 3′ of an RNA construct of the present invention. In the presence of a target polynucleotide, the RNA construct will undergo a conformational change which can either promote or inhibit association with an RBP. The RBP will, in turn, promote or inhibit translation of the polypeptide coding region. In one embodiment of the invention, the presence of a target polynucleotide will promote translation of an attached polypeptide coding region, allowing for the directed expression of a desired polypeptide in a target expression environment, for example, a cell. For example, a death gene may be chosen to kill an undesirable cell (or pathogen in a cell), or a reporter gene may be chosen to detect a target polynucleotide. Generally, it is contemplated that the polypeptide coding region will be chosen to suit any of the uses described herein.
(173) A polypeptide coding region can be attached to an RNA construct in any number of ways known in molecular biology. If an RNA construct and polypeptide coding region are to be produced from a DNA vector, a DNA vector incorporating both the RNA construct and polypeptide coding region can be produced. DNA fragments encoding all or a portion of the polypeptide coding region can be obtained from any source, for example, from a cDNA library or amplified from genomic DNA using polymerase chain reaction (PCR). DNA encoding the polypeptide coding region, or portions thereof, together with the remaining portions of the RNA construct can be inserted into an appropriate expression or amplification vector using standard ligation techniques. Alternatively, an RNA construct can be synthesized using any of a number of methods known in the art, and chemically linked to a polypeptide coding region. Vectors suitable for use with the present invention and methods of construction are discussed in more detail below.
(174) 1. Death Genes
(175) It is contemplated that the stabilization of the RNA construct in the presence of a target polynucleotide can either turn on or off expression of a death gene (a polypeptide coding region), as described previously. Examples of turning on a death gene would be for the RNA construct, when activated, to allow the expression of killer genes, such as one of the caspases. Alternatively, when the RNA construct is activated, the expression of a gene is turned off which in turn turns “ON” the production of a death gene. Examples of death genes include, but are not limited to, caspase family genes such as CASP1, CASP2, CASP3, CASP4, CASP5, CASP6, CASP7, CASP8, CASP9, CASP10, CASP14 and death domain family genes such as CRADD, DAPK1, DAPK2, FADD, RIPK1, TNFRSF10A, TNFRSF10B, TNFRSF11B, TNFRSF1A, TNFRSF21, TNFRSF25, TNFRSF6, TRADD. Other death genes that may be used are Bcl-2, Bax, Bcl-x, p53, ICE, and Cytochrome C. Additional death polypeptides encoded by “death genes” are listed in
(176) 2. Reporter Genes
(177) It is further contemplated that the stabilization of the RNA construct in the presence of a target polynucleotide can either turn on or off expression of a reporter gene (a polypeptide coding region), as described previously. A reporter gene is a gene that encodes a detectable marker. For example, the RNA construct, when activated by the presence of a target polynucleotide, can allow for the expression of any number of reporter genes suitable for use with the present invention. Examples of target polynucleotides that can activate an RNA construct include but are not limited to a viral target polynucleotide, a bacterial target polynucleotide, a target polynucleotide characteristic of a neoplastic cell, or a target polynucleotide characteristic of any disease or condition listed in Table 1. Examples of reporter genes suitable for use with the present invention include LacZ, luciferase (e.g., firefly luciferase (FL) from Photinus pyralis and Renilla luciferase (RL) from Renilla reniformis), green fluorescent protein (GFP) and its derivatives (e.g., eGFP, eCFP, eYFP), ferritin, tyrosine hydroxylase, myoglobin, hemoglobin, protein amide H, transferrin receptor, truncated progesterone receptor, β-galactosidase, and non human receptor proteins whose ligands can incorporate detectable tags (e.g., radiolabels, gadolinium). Any protein that can be detected (i.e. a detectable marker) can function as a reporter gene for use with the present invention. Methods of detection are described in detail below.
V. Production, Administration and Testing of an RNA Construct
(178) 1. Production of an RNA Construct
(179) DNA encoding the RNA construct (and, optionally, a polypeptide coding region) of the present invention can be prepared in any number of ways known in the art. DNA fragments encoding portions of the RNA construct can be obtained from any source, for example, from a cDNA library or amplified from genomic DNA using polymerase chain reaction (PCR). Methods for isolating nucleic acids, synthesizing nucleic acids, hybridizing nucleic acids, making and screening cDNA libraries, and performing PCR are well known in the art (see, e.g., Gubler et al. (1983), G
(180) In an exemplary embodiment, at least a portion of a contemplated RNA constructs are chemically synthesized. The single stranded molecules that comprise RNA constructs may be synthesized using any of a variety of techniques known in the art, such as those described in Usman et al. (1987) J. A
(181) Alternative methods of chemical synthesis well known to the skilled artisan (see, for example, Engels et al. (1989) A
(182) DNA encoding the RNA construct, or portions thereof, (and, optionally, a polypeptide coding region) can be inserted into an appropriate expression or amplification vector using standard ligation techniques. The vector is typically selected to be functional in the particular expression environment employed (i.e., the vector is compatible with the host cell machinery such that amplification of the RNA construct and/or expression of the RNA construct can occur). DNA encoding the RNA construct may be amplified/expressed in prokaryotic, yeast, insect (baculovirus systems) and/or eukaryotic host cells. These transgenes can be introduced as a linear construct, a circular plasmid, or a viral vector, which can be incorporated and inherited as a transgene integrated into the host genome. The transgene can also be constructed to permit it to be inherited as an extrachromosomal plasmid (Gassmann et al. (1995) P
(183) RNA constructs and, optionally, polypeptide coding regions can be expressed and purified using common molecular biology and biochemistry techniques. For example, recombinant expression vectors can be used which can be engineered to carry an encoded RNA construct and, optionally, polypeptide coding region into a host cell to provide for expression of the RNA construct and attached polypeptide coding region. Such vectors, for example, can be introduced into a host cell by transfection means including, but not limited to, heat shock, calcium phosphate, DEAE-dextran, electroporation or liposome-mediated transfer. Recombinant expression vectors include, but are not limited to, Escherichia coli based expression vectors such as BL21 (DE3) pLysS, COS cell-based expression vectors such as CDM8 or pDC201, or CHO cell-based expression vectors such as pED vectors. An RNA construct and, optionally, polypeptide coding region can be linked to one of any number of promoters in an expression vector that can be activated in the chosen cell line. In an embodiment, a cassette (RNA construct and promoter) is carried by a vector that contains a selectable marker such that cells receiving the vector can be identified.
(184) For example, promoters to express the RNA construct within a cell line can be drawn from those that are functionally active within the host cell. Such promoters can include, but are not limited to, a T7 promoter, a CMV promoter, a SV40 early promoter, a herpes TK promoter, and others known in recombinant DNA technology. Inducible promoters can be used, and include promoters such as metallothionine promoter (MT), mouse mammary tumor virus promoter (MMTV), and others known to those skilled in the art. Exemplary selectable markers and their attendant selection agents can be drawn, for example, from the group including, but not limited to, ampicillin, kanamycin, aminoglycoside phosphotransferase/G418, hygromycin-B phosphotransferase/hygromycin-B, and amplifiable selection markers such as dihydrofolate reductase/methotrexate and others known to skilled practitioners.
(185) Additional elements for directing the replication and transcription of an RNA construct and, optionally, polypeptide coding region) can be included in a vector to express RNA constructs in a variety of cell types, including but not limited to, eukaryotic, prokaryotic, insect, plant and yeast. For example, microorganisms such as bacteria can be transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing the RNA construct coding sequences; yeast can be transformed with recombinant yeast expression vectors containing the RNA construct coding sequences; insect cell systems can be infected with recombinant virus expression vectors (e.g., baculovirus) containing the RNA construct coding sequences; plant cell systems can be infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing the RNA construct coding sequences.
(186) Typically, the vectors used in any of the host cells will contain at least a 5′ flanking sequence (also referred to as a promoter) and, optionally, other regulatory elements, such as an enhancer(s), an origin of replication element, a transcriptional termination element, a complete intron sequence containing a donor and acceptor splice site, a signal peptide sequence, a ribosome binding site element, a polyadenylation sequence, a polylinker region for inserting the DNA encoding the polypeptide coding region, and a selectable marker element. Suitable modifications may be made to the 5′ cap in order to direct translation of the encoded polypeptide using cap-independent mechanisms. Such modifications are well-known in the art (Kowalska, J. et al. (2008) N
(187) The recombinant RNA construct expression vectors can be DNA plasmids or viral vectors. RNA construct-expressing viral vectors can be constructed based on, but not limited to, adeno-associated virus (for a review, see Muzyczka et al. (1992) C
(188) 2. Testing an RNA Construct
(189) A DNA vector encoding an RNA construct, and optionally a polypeptide coding region can be transfected into desired cell culture lines or cell-free expression systems, with or without target polynucleotide, and tested to determine whether stem formation, recruitment of an RBP, and/or translation of an encoded polypeptide can occur in the presence of a target polynucleotide.
(190) The ability of an RNA construct to form a stem-loop and bind an RBP in the presence of a target sequence can be tested by incorporating a label, for example, a radiolabel, fluorescent label, or luminescent label, into the RNA construct. The RNA construct, target polynucleotide and any additional desired reagents, such as buffers, may be added to the appropriate RBP. If a target polynucleotide is present, the RNA construct assumes a structure to which the RBP can bind. The RBP is then isolated and the presence of label is assayed. Detection of the label indicates that the RNA construct has attained the structure required for binding to the RBP, which further indicates that the target nucleotide is present. Alternatively, assays useful for detecting the binding of an RNA construct to an RBP, but that do not require labeled RNA construct, include, but are not limited to, absorbance assays, immunoassays, assays for enzymatic activity of the RBP and Western blots.
(191) Examples of suitable fluorescent labels include fluorescein isothiocyanate (FITC), 5,6-carboxymethyl fluorescein, Texas red, nitrobenz-2-oxa-1,3-diazol-4-yl (NBD), coumarin, dansyl chloride, rhodamine, amino-methyl coumarin (AMCA), Eosin, Erythrosin, BODIPY®, Cascade Blue®, Oregon Green®, pyrene, lissamine, xanthenes, acridines, oxazines, phycoerythrin, macrocyclic chelates of lanthanide ions such as quantum Dye®, fluorescent energy transfer dyes, such as thiazole orange-ethidium heterodimer, and the cyanine dyes Cy3, Cy3.5, Cy5, Cy5.5 and Cy7. Examples of other specific fluorescent labels include 3-Hydroxypyrene 5,8,10-Tri Sulfonic acid, 5-Hydroxy Tryptamine (5-HT), Acid Fuchsin, Alizarin Complexon, Alizarin Red, Allophycocyanin, Aminocoumarin, Anthroyl Stearate, Astrazon Brilliant Red 4G, Astrazon Orange R, Astrazon Red 6B, Astrazon Yellow 7 GLL, Atabrine, Auramine, Aurophosphine, Aurophosphine G, BAO 9 (Bisaminophenyloxadiazole), BCECF, Berberine Sulphate, Bisbenzamide, Blancophor FFG Solution, Blancophor SV, Bodipy F1, Brilliant Sulphoflavin FF, Calcien Blue, Calcium Green, Calcofluor RW Solution, Calcofluor White, Calcophor White ABT Solution, Calcophor White Standard Solution, Carbostyryl, Cascade Yellow, Catecholamine, Chinacrine, Coriphosphine O, Coumarin-Phalloidin, CY3.1 8, CY5.1 8, CY7, Dans (1-Dimethyl Amino Naphaline 5 Sulphonic Acid), Dansa (Diamino Naphtyl Sulphonic Acid), Dansyl NH—CH.sub.3, Diamino Phenyl Oxydiazole (DAO), Dimethylamino-5-Sulphonic acid, Dipyrrometheneboron Difluoride, Diphenyl Brilliant Flavine 7GFF, Dopamine, Erythrosin ITC, Euchrysin, FIF (Formaldehyde Induced Fluorescence), Flazo Orange, Fluo 3, Fluorescamine, Fura-2, Genacryl Brilliant Red B, Genacryl Brilliant Yellow 10GF, Genacryl Pink 3G, Genacryl Yellow 5GF, Gloxalic Acid, Granular Blue, Haematoporphyrin, Indo-1, Intrawhite Cf Liquid, Leucophor PAF, Leucophor SF, Leucophor WS, Lissamine Rhodamine B200 (RD200), Lucifer Yellow CH, Lucifer Yellow VS, Magdala Red, Marina Blue, Maxilon Brilliant Flavin 10 GFF, Maxilon Brilliant Flavin 8 GFF, MPS (Methyl Green Pyronine Stilbene), Mithramycin, NBD Amine, Nitrobenzoxadidole, Noradrenaline, Nuclear Fast Red, Nuclear Yellow, Nylosan Brilliant Flavin EBG, Oxadiazole, Pacific Blue, Pararosaniline (Feulgen), Phorwite AR Solution, Phorwite BKL, Phorwite Rev, Phorwite RPA, Phosphine 3R, Phthalocyanine, Phycoerythrin R, Polyazaindacene Pontochrome Blue Black, Porphyrin, Primuline, Procion Yellow, Pyronine, Pyronine B, Pyrozal Brilliant Flavin 7GF, Quinacrine Mustard, Rhodamine 123, Rhodamine 5 GLD, Rhodamine 6G, Rhodamine B, Rhodamine B 200, Rhodamine B Extra, Rhodamine BB, Rhodamine BG, Rhodamine WT, Serotonin, Sevron Brilliant Red 2B, Sevron Brilliant Red 4G, Sevron Brilliant Red B, Sevron Orange, Sevron Yellow L, SITS (Primuline), SITS (Stilbene Isothiosulphonic acid), Stilbene, Snarf 1, sulpho Rhodamine B Can C, Sulpho Rhodamine G Extra, Tetracycline, Thiazine Red R, Thioflavin S, Thioflavin TCN, Thioflavin 5, Thiolyte, Thiozol Orange, Tinopol CBS, True Blue, Ultralite, Uranine B, Uvitex SFC, Xylene Orange, and XRITC.
(192) Other useful fluorescent labels include fluorescein (5-carboxyfluorescein-N-hydroxysuccinimide ester), rhodamine (5,6-tetramethyl rhodamine), and the cyanine dyes Cy3, Cy3.5, Cy5, Cy5.5 and Cy7. The absorption and emission maxima, respectively, for these fluors are: FITC (490 nm; 520 nm), Cy3 (554 nm; 568 nm), Cy3.5 (581 nm; 588 nm), Cy5 (652 nm: 672 nm), Cy5.5 (682 nm; 703 nm) and Cy7 (755 nm; 778 nm), thus allowing their simultaneous detection. Other examples of fluorescein dyes include 6-carboxyfluorescein (6-FAM), 2′,4′,1,4,-tetrachlorofluorescein (TET), 2′,4′,5′,7′,1,4-hexachlorofluorescein (HEX), 2′,7′-dimethoxy-4′,5′-dichloro-6-carboxyrhodamine (JOE), 2′-chloro-5′-fluoro-7′,8′-fused phenyl-1,4-dichloro-6-carboxyfluorescein (NED), and 2′-chloro-7′-phenyl-1,4-dichloro-6-carboxyfluorescein (VIC). Fluorescent labels can be obtained from a variety of commercial sources, including Amersham Pharmacia Biotech, Piscataway, N.J.; Molecular Probes, Eugene, Oreg.; and Research Organics, Cleveland, Ohio.
(193) It is further contemplated that labels that detect a structural change in a polynucleotide can be incorporated into an RNA construct or directly into a nucleotide of the RNA construct to detect the conformational change that results upon binding to a target polynucleotide. Many such labels are known to those of skill in the art. Examples of labels suitable for use in the disclosed method are radioactive isotopes, fluorescent molecules, phosphorescent molecules, enzymes, antibodies, and ligands. More specifically, molecular beacons, Amplifluors®, FRET probes, cleavable FRET probes, TagMan® probes, scorpion primers, fluorescent triplex oligonucleotides including but not limited to triplex molecular beacons or triplex FRET probes, fluorescent water-soluble conjugated polymers, PNA probes or QPNA probes, for example, can be used to activate or quench a given label based on stem formation.
(194) Stem activated labels are labels or pairs of labels where fluorescence is increased or altered by formation of a stem structure. Stem activated labels can include an acceptor fluorescent label and a donor moiety such that, when the acceptor and donor are in proximity (when the nucleic acid strands containing the labels form a stem structure), fluorescence resonance energy transfer from the donor to the acceptor causes the acceptor to fluoresce. Stem activated labels are typically pairs of labels positioned on nucleic acid molecules, such as the sides of the stem-loop, such that the acceptor and donor are brought into proximity when a stem structure is formed in the nucleic acid molecule. If the donor moiety of a stem activated label is itself a fluorescent label, it can release energy as fluorescence (typically at a different wavelength than the fluorescence of the acceptor) when not in proximity to an acceptor (that is, when a stem structure is not formed). When the stem structure forms, the overall effect would then be a reduction of donor fluorescence and an increase in acceptor fluorescence. FRET probes are an example of the use of stem activated labels, the operational principles of which can be adapted for use with RNA constructs.
(195) Stem quenched labels are fluorescent labels positioned on a nucleic acid such that when a stem structure forms a quenching moiety is brought into proximity such that fluorescence from the label is quenched. When the stem is disrupted, the quenching moiety is no longer in proximity to the fluorescent label and fluorescence increases. Examples of this effect can be found in molecular beacons, fluorescent triplex oligonucleotides, triplex molecular beacons, triplex FRET probes, and QPNA probes, the operational principles of which can be adapted for use with RNA constructs.
(196) Examples of labels that can be incorporated into nucleic acids include nucleotide analogs such as BrdUrd (5-bromodeoxyuridine, Hoy et al., (1993) M
(197) Labels that are incorporated into nucleic acid, such as biotin, can be subsequently detected using sensitive methods well-known in the art. For example, biotin can be detected using streptavidin-alkaline phosphatase conjugate (Tropix, Inc.), which is bound to the biotin and subsequently detected by chemiluminescence of suitable substrates (for example, chemiluminescent substrate CSPD: disodium, 3-(4-methoxyspiro-[1,2,-dioxetane-3-2′-(5′-chloro)tricyclo[3.3.1.1.sup.3,7]decane]-4-yl)phenyl phosphate; Tropix, Inc.). Labels can also be enzymes, such as alkaline phosphatase, soybean peroxidase, horseradish peroxidase and polymerases, that can be detected, for example, with chemical signal amplification or by using a substrate to the enzyme which produces light (for example, a chemiluminescent 1,2-dioxetane substrate) or fluorescent signal.
(198) Methods for detecting and measuring signals generated by labels are also known to those of skill in the art. For example, radioactive isotopes can be detected by scintillation counting or direct visualization; fluorescent molecules can be detected with fluorescent spectrophotometers; phosphorescent molecules can be detected with a spectrophotometer or directly visualized with a camera; enzymes can be detected by detection or visualization of the product of a reaction catalyzed by the enzyme; antibodies can be detected by detecting a secondary label coupled to the antibody.
(199) 3. Administration of an RNA Construct
(200) Any of the delivery methods known in the art suitable for use with RNA-based drugs are contemplated to work for RNA constructs according to the invention. For example, recombinant vectors capable of expressing RNA constructs are delivered as described above, and persist in target cells. Alternatively, viral vectors can be used that provide for transient expression of RNA constructs. Such vectors can be repeatedly administered as necessary. Once expressed, the RNA constructs bind to target polynucleotides and undergo a conformational change, for example, strengthening of a stem-loop structure. Delivery of RNA construct-expressing vectors can be systemic, such as by intravenous or intramuscular administration, by administration to target cells ex-planted from a multicellular organism followed by reintroduction into the multicellular organism, or by any other means that allows for introduction into a desired target cell.
(201) DNA plasmids carrying RNA constructs can be transfected into target cells as a complex with cationic lipid carriers (e.g. Oligofectamine) or non-cationic lipid-based carriers (e.g. Transit-TKO™). Multiple lipid transfections for RNA constructs targeting different regions of a single target polynucleotide or multiple target polynucleotides over a period of a week or more are also contemplated by the present invention. Successful introduction of the vectors of the invention into host cells can be monitored using various known methods. For example, transient transfection can be signaled with a reporter, such as a fluorescent marker, such as Green Fluorescent Protein (GFP). Stable transfection of ex vivo cells can be ensured using markers that provide the transfected cell with resistance to specific environmental factors (e.g., antibiotics and drugs), such as hygromycin B resistance.
(202) Alternatively, RNA constructs can be produced in cell culture and isolated, or can be chemically synthesized, and administered. Absorption or uptake of an RNA construct can occur through unaided diffusive or active cellular processes, or by auxiliary agents or devices. An RNA construct may be introduced into a cell, either in vitro or where the cell is part of a living organism. If the cell is part of an organism, introduction into the cell will include delivery to the organism. For example, for in vivo delivery, an RNA construct can be injected into a tissue site or administered systemically. In vitro introduction into a cell includes methods known in the art such as electroporation and lipofection.
(203) An RNA construct can be chemically modified to enhance stability. The nucleic acids of the invention may be synthesized and/or modified by methods well established in the art, such as those described in C
(204) In yet another embodiment, nucleotides may be modified to prevent or inhibit the activation of cellular enzymes, such as, for example, without limitation, certain nucleases. Techniques for inhibiting the activation of cellular enzymes are known in the art including, but not limited to, 2′-amino modifications, 2′-amino sugar modifications, 2′-F sugar modifications, 2′-F modifications, 2′-alkyl sugar modifications, uncharged backbone modifications, morpholino modifications, 2′-O-methyl modifications, and phosphoramidate (see, e.g., Wagner (1995) N
(205) Conjugating a ligand to an RNA construct can enhance its cellular absorption. In certain instances, a hydrophobic ligand is conjugated to the RNA construct to facilitate direct permeation of the cellular membrane. Alternatively, the ligand conjugated to the RNA construct is a substrate for receptor-mediated endocytosis. These approaches have been used to facilitate cell permeation of antisense oligonucleotides. For example, cholesterol has been conjugated to various antisense oligonucleotides resulting in compounds that are substantially more active compared to their non-conjugated analogs. See Manoharan et al., (2002) A
(206) In certain instances, conjugation of a cationic ligand to oligonucleotides results in improved resistance to nucleases. Representative examples of cationic ligands are propylammonium and dimethylpropylammonium.
(207) A composition that includes an RNA construct (it should be understood that the RNA construct compositions and administration methods referenced below include both RNA constructs and DNA vectors encoding an RNA construct) can be delivered to a subject by a variety of routes. Exemplary routes include intrathecal, parenchymal, intravenous, nasal, oral, parenteral and ocular delivery. An RNA construct can be incorporated into pharmaceutical compositions suitable for administration. For example, compositions can include one or more species of an RNA construct and a pharmaceutically acceptable carrier. As used herein the language “pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
(208) The pharmaceutical compositions of the present invention may be administered in a number of ways depending upon whether local or systemic treatment is desired and upon the area to be treated. Administration may be topical (including ophthalmic, intranasal, transdermal), oral or parenteral. Parenteral administration includes intravenous drip, subcutaneous, intraperitoneal or intramuscular injection, site-specific injection (e.g. delivery directly to a tumor or other site of disease), or intrathecal or intraventricular administration.
(209) In general, an RNA construct can be administered by any suitable method. As used herein, topical delivery can refer to the direct application of an RNA construct to any surface of the body, including the eye, a mucous membrane, surfaces of a body cavity, or to any internal surface. Formulations for topical administration may include transdermal patches, ointments, lotions, creams, gels, drops, sprays, and liquids. Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable. Topical administration can also be used as a means to selectively deliver the RNA construct to the epidermis or dermis of a subject, or to specific strata thereof, or to an underlying tissue.
(210) Compositions for intrathecal or intraventricular administration may include sterile aqueous solutions which may also contain buffers, diluents and other suitable additives.
(211) Formulations for parenteral administration may include sterile aqueous solutions which may also contain buffers, diluents and other suitable additives. Intraventricular injection may be facilitated by an intraventricular catheter, for example, attached to a reservoir. For intravenous use, the total concentration of solutes should be controlled to render the preparation isotonic.
(212) An RNA construct can be administered to a subject by pulmonary delivery. Pulmonary delivery compositions can be delivered by inhalation by the patient of a dispersion so that the RNA construct within the dispersion can reach the lung where it can be readily absorbed through the alveolar region directly into blood circulation. Pulmonary delivery can be effective both for systemic delivery and for localized delivery to treat diseases of the lungs.
(213) Pulmonary delivery can be achieved by different approaches, including the use of nebulized, aerosolized, micellular and dry powder-based formulations. Delivery can be achieved with liquid nebulizers, aerosol-based inhalers, metered-dose devices, and dry powder dispersion devices. One of the benefits of using an atomizer or inhaler is that the potential for contamination is minimized because the devices are self contained. Dry powder dispersion devices, for example, deliver drugs that may be readily formulated as dry powders. An RNA construct may be stably stored as lyophilized or spray-dried powders by itself or in combination with suitable powder carriers. The delivery of a composition for inhalation can be mediated by a dosing timing element which can include a timer, a dose counter, time measuring device, or a time indicator which when incorporated into the device enables dose tracking, compliance monitoring, and/or dose triggering to a patient during administration of the aerosol medicament.
(214) An RNA construct can be modified such that it is capable of traversing the blood brain barrier. For example, the RNA construct can be conjugated to a molecule that enables the agent to traverse the barrier. Such modified RNA construct can be administered by any desired method, such as by intraventricular or intramuscular injection, or by pulmonary delivery, for example.
(215) An RNA construct can be administered ocularly, such as to treat retinal disorder, e.g., a retinopathy. For example, the pharmaceutical compositions can be applied to the surface of the eye or nearby tissue, e.g., the inside of the eyelid. They can be applied topically, e.g., by spraying, in drops, as an eyewash, or an ointment. Ointments or droppable liquids may be delivered by ocular delivery systems known in the art such as applicators or eye droppers. Such compositions can include mucomimetics such as hyaluronic acid, chondroitin sulfate, hydroxypropyl methylcellulose or poly(vinyl alcohol), preservatives such as sorbic acid, EDTA or benzylchronium chloride, and the usual quantities of diluents and/or carriers. The pharmaceutical composition can also be administered to the interior of the eye, and can be introduced by a needle or other delivery device which can introduce it to a selected area or structure. The composition containing the RNA construct can also be applied via an ocular patch.
(216) An RNA construct can be administered by an oral or nasal delivery. For example, drugs administered through these membranes have a rapid onset of action, provide therapeutic plasma levels, avoid first pass effect of hepatic metabolism, and avoid exposure of the drug to the hostile gastrointestinal (GI) environment. Additional advantages include easy access to the membrane sites so that the drug can be applied, localized and removed easily.
(217) The types of pharmaceutical excipients that are useful as carrier include stabilizers such as human serum albumin (HSA), bulking agents such as carbohydrates, amino acids and polypeptides; pH adjusters or buffers; salts such as sodium chloride; and the like. These carriers may be in a crystalline or amorphous form or may be a mixture of the two.
VI. Detection Assays
(218) In one aspect of the invention, the RNA construct is used to detect the presence of a target polynucleotide. The target polynucleotide may exist in any expression environment, including, but not limited to, a cell, such as an infected or neoplastic cell; a sample comprising components of a cell; a mixture of polynucleotides; or a cell culture. The RNA construct is designed such that, in the presence of a target polynucleotide, a conformational change occurs, which leads to detection of the RNA construct.
(219) The RNA construct of the invention, when operably linked with a reporter gene, allows one to determine whether a target polynucleotide is present or absent in a variety of expression environments and for a variety of purposes. For example, methods utilizing the RNA construct can either be scientific or commercial diagnostic assays. The target polynucleotide is either itself the molecule of interest to be detected or is a marker whose detection allows identification of another molecule, an organism of interest, or a health state of a patient. For example, the target polynucleotide could be unique to a particular pathogen, and the presence of the target polynucleotide would indicate presence of the pathogen. Alternatively, the target polynucleotide could be a marker for whether a patient has, or is likely to develop, a disease and/or whether a patient is likely to respond to, or is responding to, a particular therapeutic intervention. Samples to be assayed can be a cell culture, a disrupted cell culture, media from a cell culture, or a patient sample. Patient samples can include, but are not limited to, a tissue or body fluid sample. The tissue sample can be any tissue of the body, such as breast tissue, colon tissue, prostate tissue, pancreas tissue, liver tissue, bone tissue, cardiac tissue, lung tissue, skin, endothelium, and hair. The body fluid sample can be selected from any body fluid, such as blood, serum, plasma, stool, urine, sputum, nipple aspirate, pus, semen, saliva, and cerebrospinal fluid.
(220) In practice, a sample to be assayed is obtained. To the extent the sample contains the cellular components needed to express the reporter gene when the RNA construct associates with the target polynucleotide (if present), the RNA construct linked with the reported gene can be directly added to the sample and incubated to allow expression of the reporter gene. The expressed reporter gene is then detected. If the sample does not have the cellular components needed to express the reporter gene, these can be added along with the RNA construct linked to the reporter gene. The reporter gene can be a detectable marker. For example, a color-forming, luminescent or fluorescent molecule such as LacZ, luciferase (e.g., firefly luciferase (FL) from Photinus pyralis and Renilla luciferase (RL) from Renilla reniformis), green fluorescent protein (GFP) and its derivatives (e.g., eGFP, eCFP, eYFP), can be used. In the presence of a target polynucleotide, the RNA construct assumes a conformation to which an RBP can bind, promoting translation of the encoded detectable molecule. Detection of the expressed reporter gene (directly or indirectly) indicates the presence of the target polynucleotide.
(221) Alternatively, any polypeptide that can be detected by any number of methods known in the art, such as a Western blot, can be encoded by the polynucleotide coding region and used in accordance with the methods of the present invention to detect the presence of a target polynucleotide. Polypeptides that can be detected in living organisms using magnetic resonance or a PET scan, for example, can also be used. For example, the polypeptide coding region can encode ferritin, tyrosine hydroxylase, myoglobin, hemoglobin, protein amide H, transferrin receptor, truncated progesterone receptor, β-galactosidase, or non human receptor proteins whose ligands can incorporate detectable tags (e.g., radiolabels, gadolinium).
EXAMPLES
Example 1
Design of a Stem-Loop RNA Construct Starting from a Naturally-Occurring Thermus thermophilus Three-Way Junction
(222) To validate the design principles of the present invention, an RNA construct based on a naturally occurring, Family A three-way junction in the 16S ribosomal subunit of Thermus thermophilus (Protein Data Bank entry 1J5E, Chain A), shown in
(223) TABLE-US-00011 (SEQ ID NO: 192) UUUGUUGGAGAGUUUGAUCCUGGCUCAGGGUGAACGCUGGCGGCGUGCCU AAGACAUGCAAGUCGUGCGGGCCGCGGGGUUUUACUCCGUGGUCAGCGGC GGACGGGUGAGUAACGCGUGGGUGACCUACCCGGAAGAGGGGGACAACCC GGGGAAACUCGGGCUAAUCCCCCAUGUGGACCCGCCCCUUGGGGUGUGUC CAAAGGGCUUUGCCCGCUUCCGGAUGGGCCCGCGUCCCAUCAGCUAGUUG GUGGGGUAAUGGCCCACCAAGGCGACGACGGGUAGCCGGUCUGAGAGGAU GGCCGGCCACAGGGGCACUGAGACACGGGCCCCACUCCUACGGGAGGCAG CAGUUAGGAAUCUUCCGCAAUGGGCGCAAGCCUGACGGAGCGACGCCGCU UGGAGGAAGAAGCCCUUCGGGGUGUAAACUCCUGAACCCGGGACGAAACC CCCGACGAGGGGACUGACGGUACCGGGGUAAUAGCGCCGGCCAACUCCGU GCCAGCAGCCGCGGUAAUACGGAGGGCGCGAGCGUUACCCGGAUUCACUG GGCGUAAAGGGCGUGUAGGCGGCCUGGGGCGUCCCAUGUGAAAGACCACG GCUCAACCGUGGGGGAGCGUGGGAUACGCUCAGGCUAGACGGUGGGAGAG GGUGGUGGAAUUCCCGGAGUAGCGGUGAAAUGCGCAGAUACCGGGAGGAA CGCCGAUGGCGAAGGCAGCCACCUGGUCCACCCGUGACGCUGAGGCGCGA AAGCGUGGGGAGCAAACCGGAUUAGAUACCCGGGUAGUCCACGCCCUAAA CGAUGCGCGCUAGGUCUCUGGGUCUCCUGGGGGCCGAAGCUAACGCGUUA AGCGCGCCGCCUGGGGAGUACGGCCGCAAGGCUGAAACUCAAAGGAAUUG ACGGGGGCCCGCACAAGCGGUGGAGCAUGUGGUUUAAUUCGAAGCAACGC GAAGAACCUUACCAGGCCUUGACAUGCUAGGGAACCCGGGUGAAAGCCUG GGGUGCCCCGCGAGGGGAGCCCUAGCACAGGUGCUGCAUGGCCGUCGUCA GCUCGUGCCGUGAGGUGUUGGGUUAAGUCCCGCAACGAGCGCAACCCCCG CCGUUAGUUGCCAGCGGUUCGGCCGGGCACUCUAACGGGACUGCCCGCGA AAGCGGGAGGAAGGAGGGGACGACGUCUGGUCAGCAUGGCCCUUACGGCC UGGGCGACACACGUGCUACAAUGCCCACUACAAAGCGAUGCCACCCGGCA ACGGGGAGCUAAUCGCAAAAAGGUGGGCCCAGUUCGGAUUGGGGUCUGCA ACCCGACCCCAUGAAGCCGGAAUCGCUAGUAAUCGCGGAUCAGCCAUGCC GCGGUGAAUACGUUCCGGGCCUUGUACACACCGCCCGUCACGCCAUGGGA GCGGGCUCUACCCGAAGUCGCCGGGAGCCUACGGGCAGGCGCCGAGGGUA GGGCCCGUGACUGGGGCGAAGUCGUAACAAGGUAGCUGUACCGGAAGGUG CGGCUGGAUCACCUCCUUUCU
(224) Part I: Design of an RNA Construct and Target Sequence
(225) The sequences of the three-way junction of Thermus thermophilus are separated into their constituent segments and two of these segments are joined using the naturally-occurring loop found within the same Thermus thermophilus 16S ribosomal subunit sequence (positions 675-680 of Protein Data Bank entry 1J5E). The predicted three way junction structure of this RNA construct (in this instance, two sides of the three-way junction of Thermus thermophilus along with the naturally-occurring loop found within the same Thermus thermophilus 16S ribosomal subunit sequence), when bound to a target polynucleotide (in this instance, one side of the three-way junction of Thermus thermophilus), is shown in
(226) Prior to performing an in vivo experiment, the potential secondary structures formed by the RNA construct and target polynucleotide separately and together were analyzed with secondary structure predicting tools (RNAFold for each individual sequence and RNACofold for two sequences acting on each other). The intent of this analysis was to predict the structure and the associated reduction in free energy for the sequences folded alone versus together. If the overall reduction in free energy is greater for the sequences folded together (into the desired secondary structure) versus the sum of their individual folds (i.e., the secondary structure assumed), they are more likely to interact as desired.
(227) The reduction in free energy predicted to occur as a result of the folding of the RNA construct alone is −25.00 kcal/mol. The reduction in free energy predicted to occur as a result of the folding of the target polynucleotide alone is −4.60 kcal/mol. Thus, the sum reduction in free energy for the individual sequence predictions is −29.60 kcal/mol (−25.00 kcal/mol+−4.60 kcal/mol). The MFE value of the two sequences folding together into the desired structure is −45.00 kcal/mol. This interaction shows a net free energy reduction of more than 15 kcal/mol beyond the two sequences folding independently, indicating that it is energetically favorable for the RNA construct and target polynucleotide to fold together rather than separately. Therefore, the RNA construct and target polynucleotide are more likely to interact to form the predicted structure than not.
(228) Part II: Expressing and Testing the RNA Construct In Vitro
(229) The next steps of the experiment are performed as follows.
(230) DNA oligonucleotide templates are designed using the T7 promoter to express both the RNA construct and the target polynucleotide. This RNA construct and target polynucleotide is transcribed and used for in vitro experiments.
(231) To test whether the RNA construct and target polynucleotide form the desired structure in vivo, the RNA construct and target polynucleotide are exposed to chemical probes. The more reactive bases (e.g., unpaired adenines and cytosines for DMS probing) are altered in such a way that they stop transcription during a primer extension. By comparing relative counts of varying length transcripts, the reactivity (hence the likelihood of being base paired) of each base in the sequence is determined. That information is used in conjunction with a partition function based algorithm (i.e., RNAFold) to make a determination as to what structure is present. The Twort primer that is incorporated into the RNA construct is present specifically to allow this analysis, as explained below.
(232) In order to experimentally validate a change in conformation of RNA structure, the high-throughput chemical mapping approach “CAFA” (Capillary Automated Footprinting Analysis, Mitra et al. (2008) N
(233) Chemical mapping techniques leverage the unique chemical reactivity of probes (either chemical or enzymatic) to detect aspects of nucleic acid structure (Donis-Keller et al. (1977) N
(234) Detecting chemical modification or cleavage in a nucleic acid is straight forward thanks to reverse transcription coupled with primer extension (Tijerina et al. (2007) N
(235) Recent advances in capillary electrophoresis sequencing technology (Araya et al. (2007) M
(236) DMS Chemical Probing:
(237) DMS chemical probing measures the degree of base-pairing by selectively methylating unpaired nucleotides. The degree of methylation at each nucleotide is evaluated by reverse-transcription, as the reverse-transcriptase will stop if it encounters a methylated nucleotide. The results of a partition function calculation can be directly compared to this type of probing. The DMS results are used to confirm the computational predictions and assess the predictive ability of the partition function calculation.
(238) .OH Radical Chemical Probing (Footprinting):
(239) .OH footprinting measures the solvent-accessibility of nucleotides by selectively cleaving the backbone of exposed nucleotides (Latham and Cech (1989) S
(240) Structural characterizations will be performed under three experimental conditions; CE buffer, 100 mM KCl and 10 mM MgCl.sub.2. Salt conditions are well known to affect RNA folding (Laederach et al. (2007) P
(241) Alternatively, in vitro RNA binding assays will be done to demonstrate that the target polynucleotide and RNA construct associate, reinforcing the stem structure. Association also can be determined experimentally by separation on a native polyacrylamide electrophoretic gel.
(242) Part III: Use of a Reporter Gene to Test the RNA Construct In Vivo
(243) Once it has been confirmed that the simulated three way junction can form as a result of the RNA construct and target polynucleotide interacting, additional experiments described below can be performed to confirm that the structure of the RNA construct, when bound to the target polynucleotide, will allow it to interact with an RBP and promote translation of an attached polypeptide coding region. Instead of a Twort primer, a polypeptide coding region that encodes a fluorescent reporter will be included in the RNA construct. Following transfection of the RNA construct into an in vivo system, translation of the reporter gene in the presence or absence of target polynucleotide can be measured. It is anticipated that some translation of the reporter gene will take place even in the absence of the target polynucleotide, because the stem will not have been weakened. However, removing the three-way junction from the surrounding context of the entire 16S ribosomal subunit may weaken stem formation, in which case it is anticipated that translation of the reporter gene will only occur in the presence of the target polynucleotide.
(244) Mutations that will modify the strength of the stem, or the binding of the flanking regions to the target polynucleotide, can be introduced as desired to prevent stem formation in the absence of the target polynucleotide. The RNA construct then can be introduced into cells and fluorescence can be measured in the absence of, and in the presence of, a target polynucleotide. If fluorescence occurs in the absence of the target polynucleotide, additional stem-weakening mutations can be introduced. If no fluorescence occurs in the presence of the target polynucleotide, nucleotides can be altered to increase either the likelihood of association of the RNA construct with the target polynucleotide, or to increase the strength of the stem.
(245) Part IV: Variations
(246) To demonstrate that RNA constructs can be made from different stem-loop motifs, a variation of the RNA construct that incorporates a Histone Stem-loop (HSL) motif can be designed (
(247) It is anticipated that the RNA construct described in
Example 2
MS2 Protein-Binding RNA Constructs
(248) The following demonstrates design of an RNA construct capable of binding an RBP only in the presence of a target.
(249) Part I: Background
(250) The bacteriophage MS2 capsid protein acts as a translational repressor by binding to a specific RNA stem-loop structure that contains the viral replicase translation initiation region (Peabody (1990) J. B
(251) TABLE-US-00012 TABLE 5 Relative Wild-type Nucleotide Dissociation Position(s) Variation Constant A.sub.−17 deletion >3000 G 1.0 A.sub.−16 G 1.0 U.sub.−12-A.sub.+1 A-U 1.1 G.sub.−11-C.sub.−1 C-G 4.2 U-A 3.9 G-G or C-C >3000 A.sub.−10 deletion >3000 C >3000 U >3000 G 1.7 G.sub.−9-C.sub.−2 C-G 3.4 U-A 9.5 G.sub.−8-C.sub.−3 C-G 1.0 A.sub.−7 C 10 U >3000 U.sub.−6 A 3.0 C 1.0 G 3.0 U.sub.−5 A 10 C 0.02-0.2 G 15 A.sub.−4 C >3000 U >3000 G >3000 A.sub.+1 to U.sub.+4 deletion 330 U.sub.+2 to U.sub.+4 deletion 1.7 G.sub.+3 to U.sub.+4 deletion 1.0 U.sub.+4 deletion 1.0
(252) Although MS2, in its natural context, functions as a translational repressor, the opposite effect can be attained by incorporating it as part of a Xenopus Poly-A Binding Protein (PABP) fusion protein (e.g., Coller et al., (1998) G
(253) TABLE-US-00013 TABLE 6 (Proteins) Label Full Name Sequence MS2-PABP MS2- MGSSHHHHHHSSGLVPRGSHMGPRASNFTQFVLVDNGGTGDVTVAPSN PABP[human] FANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTV fusion protein GGEELPVAGWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS AIAANSGIYASPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILS IRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWS QRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN GSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEL GARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSK GFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRK FEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQ AHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYY PPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASS QVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRN PQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLF PLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQ AHQAKEAAQKAVNSATGVPTV (SEQ ID NO: 95) SLBP Stem-loop MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEA Binding Protein EHRGAERRPESFTTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYK [human RKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINY recombinant] GKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKV ALHFWDPPAEEGCDLQEIHPVDLESAESSSEPQTSSQDDFDVYSGTPT KVRHMDSQVEDEFDLEACLTEPLRDFSAMS (SEQ ID NO: 196)
(254) As shown in
(255) TABLE-US-00014 TABLE 7 (RNA Constructs) Label Description Sequence MS2- Wild Type MS2 Motif AAACAUGAGGAUUACCCAUGU (SEQ ID NO: 99) WT MS2-P1 Positive Control AGAGAAACAUGAGGAUCACCCAUGUGAGAGAGAGAGAG AG (SEQ ID NO: 191) MS2-B1 MS2_engineered_sxRNA2.0 CCGCGGGAGCUCGUUUUUGGGCGCCAUCAGGGUUUUUU GCCAAGUGGAU (SEQ ID NO: 101) MS2-B2 MS2_engineered_sxRNA2.1 CCGCGGGAGCUCGUUUUUGGGGCGCCAUCAGGGUUUUU UGCCAAGUGGAU (SEQ ID NO: 102) MS2-B3 MS2_engineered_sxRNA3.1 AACUAUACAACCGUUUUUGGGGCGCCAUUAGGGUUUUU UGCCUACCUCA (SEQ ID NO: 104) MS2-B5 MS2_engineered_sxRNA4.0 AAAGUGUCAGAGUUUUUGGGGCGCCAUUAGGGUUUUUU GACGGUGUGG (SEQ ID NO: 107) HSL-C1 Histone Stem-loop Consensus MMMMGGYYYUHHUHARRRCCMM (SEQ ID NO: 109) HSL-P1 NM_001005464.2(HIST2H3A): position AGGUUCCAUCGUAUCCAAAAGGCUCUUUUCAGAGCCAC 467-507 positive control histone CCA (SEQ ID NO: 193) stem-loop HSL-Bl NM_001005464.2_minor_mutant AGGUUCCAUCGUAUCCAAAAGGCUCUUUUCAGAGCUAC (HIST2H3A): 467-507(U sub at 502) CCA (SEQ ID NO: 110) HSL-B2 NM_001005464.2_major_mutant AGGUUCCAUCGUAUCCAAAAGGUUCUUUUCAGGGCUAC (HIST2H3A): 467-507(U sub at 489, CCA (SEQ ID NO: 111) G sub at 499,U sub at 502) HSL-B3 NG_011683.1(SEPT 9): 215412- GGGGCCGUGGGGGUAACACCCUGUGGGCCACAGGUUUU 215468 CUUUAAAAUCCCAGCUCCG (SEQ ID NO: 113) HSL-B4 HSL_engineered_sxRNA1.0 GAAGAGAGCCGCCCAAAACAGAAAGAAAGGCUCUUUUC AGAGCUACACUUU (SEQ ID NO: 114)
(256) TABLE-US-00015 TABLE 8 (Targets) Label Description Sequence T-1 hcmv-miR-us25-2-3p AUCCACUUGGAGAGCUCCCGCGG (SEQ ID NO: 103) T-2 hsa-let-7e UGAGGUAGGAGGUUGUAUAGUU (SEQ ID NO: 105) T-3 hsa-miR-220a CCACACCGUAUCUGACACUUU (SEQ ID NO: 108) T-4 hsa-miR-363* CGGGUGGAUCACGAUGCAAUUU (SEQ ID NO: 112) T-5 hsa-miR-1250 ACGGUGCUGGAUGUGGCCUUU (SEQ ID NO: 115) T-6 xla-miR-427 AAAGUGCUUUCUGUUUUGGGCG (SEQ ID NO: 116)
(257) Part II: Design Considerations 1) To generally weaken the wild type structure in the MS2-B1 construct, the stem's first base pairing was changed to U-U, and pairs 2-4 were changed to G-U. In MS2-B2, the first four pairs were changed to G-U which makes the pairing slightly stronger. 2) The A bulge at position −10 was changed to a G to prevent base pairing with the U's introduced to the lower stem. 3) The top 3 base pairings in the stem were changed from G-C to C-G to a.) prevent the upper C's from pairing with the G's introduced in the lower opposite side of the stem, b.) prevent the upper G's pairing with the U's introduced into the lower opposite side of the stem c.) promote the G bulge. 4) The U at position −5 was changed to a C to increase affinity for the protein when stem-loop structure forms and partially compensate for some of the other base changes made to weaken the structure. 5) The desired three-way junction conformation was “family A” as defined in
(258) Secondary structure and minimum free energy predictions for the target alone, the RNA construct alone and the RNA construct and target together were determined using RNAFold and RNACoFold and are shown in
(259) Part III: The RNA Construct Selectively Binds the MS2 Fusion Protein in the Presence of the Target Polynucleotide
(260) a. Native Gel Binding Experiment
(261) To determine whether the RNA construct bound the target, a binding experiment under native conditions was performed. All RNA used for the experiment was dissolved in a buffer containing 10 mM Tris-HCl (pH 8.0) and 100 mM NaCl. The MS2-B1 or MS2-B2 RNA construct and target were mixed in a 1:2 ratio and annealed at 85° C. for 3 minutes and gradually cooled to room temperature for about an hour. The resulting mixture was run on a native PAGE (15% TBE-PAGE) gel.
(262) b. RNA-Protein Interaction Studies Using Immunoprecipitation (IP)
(263) Immunoprecipitation commonly used to precipitate a target protein from a solution using an antibody specific to the target protein. If the protein is also bound to other proteins or to RNA, forming a complex, the complex can be pulled down as an intact unit by co-precipitation.
(264) A slurry of magnetic beads (Dynabeads®, Invitrogen, Carlsbad, Calif.) coated in Protein A and G were mixed by vortexing, and 75 μl were transferred to a new tube and washed twice with 0.5 ml of NT-2. The beads were resuspended in 100 μl of NT-2 (50 mM Tris-HCl, pH 7.4, 150 mM NaCl, 1 mM MgCl.sub.2, 0.05% NP-40), and 5 μg of anti-His tag antibody were added. Anti-his antibody was chosen because the MS2-PABP fusion protein has a His tag at the N-terminal end. The tube was mixed at room temperature overnight at 4° C., and then washed five times with 1 ml of NT-2. In parallel, RNA construct, target or RNA construct and target were added to respective tubes, heated to 85° C. for 5 minutes and gradually cooled down to room temperature to allow binding of RNA construct to target to occur. MS2-PABP was added to the tubes containing RNA construct, target or RNA construct and target and incubated at 37° C. for 1 hour. The beads were resuspended in 900 μl of NET-2 (NT2, with 20 mM EDTA (pH 8.0), 10 μL 1 mM DTT, 200 Units Rnase OUT™ (Invitrogen, Carlsbad, Calif.)). RNA-protein complexes were added to the tubes containing the beads to which the anti-His antibody was bound and were mixed overnight at 4° C. The beads were washed six times with 1.0 ml of ice cold NT-2. Before the beads were spun down for the sixth wash, 100 μl of the bead slurry (out of 1 ml total volume) were removed for confirming protein pull down by Western. To remove protein, the beads were resuspended in 150 μl Proteinase K buffer and mixed at 55° C. for 30 min using a thermomixer. To precipitate RNA, 150 μl phenol-chloroform were added, mixed by vortexing, and centrifuged at 12,000 rpm for 5 min. The upper aqueous layer was removed and 150 μl chloroform added. The tubes were then mixed by vortexing and centrifuged. 50 μl 5M ammonium acetate, 5 μl of glycogen and 1.0 ml of cold 100% ethanol were added to the supernatant. The tubes were placed at −80° C. for half an hour. The tubes were then centrifuged at 14,000 rpm for 30 min, washed with 80% ethanol, and centrifuged again for 30 min. The resulting pellets were dried in a Speed-vac and resuspended in 10 μl of buffer (10 mm Tris (pH8.0), 100 mM NaCl).
(265) Magnetic beads (Dynabeads®, Invitrogen, Carlsbad, Calif.) coated with protein A/G were used for the IPs. Since the MS2 fusion protein has a His tag at the N-terminal end, anti-His was chosen as the antibody. Anti-His was incubated with the beads overnight at 4° C. MS2 protein was incubated with the RNA construct and target, the RNA construct alone, or the target alone at 37° C. for 1 hour. The whole mixture was added to the anti-His bound beads and incubated overnight at 4° C. To verify RNA pull down, the beads were treated with proteinase k for protein digestion followed by phenol-chloroform extraction and ethanol precipitation.
(266) The precipitated samples were tested on a denaturing PAGE (10% TBE-Urea) gel. The bands of interest are marked on the gel (
(267) Additional MS2-RNA constructs were designed and designated MS2-B3-MS2-B5 (
(268) Part IV: RNA Constructs Based on a Histone Stem-Loop (HSL) Motif
(269) A HSL consensus sequence shown in
Example 3
Increasing Expression of a Polypeptide Coding Region 5′ of an RNA Construct
(270) To demonstrate that an RNA construct placed downstream of a polypeptide coding region is capable of increasing expression of the polypeptide coding region in the presence of a target polynucleotide, MS2-based RNA constructs are engineered and inserted downstream of a luciferase reporter gene. In the presence of a target sequence capable of binding to the RNA construct, the RNA construct is stabilized, allowing it to bind an MS2-polyA binding protein (PABP) fusion protein, which increases translation of the luciferase reported gene.
(271) The luciferase gene from the Luciferase T7 control DNA vector (#L4821, Promega, Madison, Wis.) vector is used to construct a DNA vector for transcribing the RNA construct and subsequently translating luciferase. Restriction sites downstream of the T7-expressed luciferase gene are used to clone in DNA sequences encoding MS2-engineered RNA construct sequences, which allow for binding by either wild-type or MS2-PABP fusion protein. Control MS2-engineered RNA constructs, termed Positive control MS2 and Wild-Type MS2 motif, are constructed by annealing designed oligonucleotides to each other in overlapping region, filling in bases with DNA Polymerase I, Large (Klenow) fragment (#M0210, New England BioLabs, Ipswitch, Mass.), amplifying by PCR, and digesting the resulting DNA with SacI and BtgI (#R0156 and #R0608, respectively, New England BioLabs, Ipswitch, Mass.). Once the vector and MS2-RNA construct sequence insert are digested with their respective enzymes, T4 DNA ligase is used (#M0202, New England BioLabs, Ipswitch, Mass.) to attach the two sequences together and the resulting clones are transformed into Escherichia coli DHSα bacterial cells. Once the series of MS2-engineered RNA constructs are cloned downstream of the luciferase gene, purified DNA is linearized for in vitro transcription followed by in vitro translation in with and without the addition of the MS2-PABP fusion protein.
(272) Part I: In Vitro Transcription of the Templates
(273) After linearization of the plasmid with SacI, the DNA is purified with DNA clean and Concentrator™ (#D4003, Zymo Research, Orange, Calif.). The DNA is then transcribed into uncapped RNA using Ambion® MEGAscript® T7 Kit (#AM1333, Applied Biosystems, Carlsbad, Calif.). 1 μg of linear template DNA is added to a 20 μL transcription reaction containing 8 μL ribonucleotides solution, 2 μL of 10× reaction buffer, 2 μL enzyme mix, and nuclease-free water. Also, capped RNA is manufactured using Ambion® mMESSAGE mMACHINE® T7 Kit (#AM1344, Applied Biosystems, Carlsbad, Calif.), with 1 μg of linear template DNA added to a 20 μL transcription reaction containing 10 μL 2×NTP/CAP solution, 2 μL of 10× reaction buffer, 2 μL enzyme mix, and nuclease-free water. The transcription reactions are incubated in an undisturbed environment at 37° C. overnight. After incubation, 1 μL of Ambion® TURBO™ DNase (2 U/μL, Applied Biosystems, Carlsbad, Calif.) is added and incubated at 37° C. for another 15 minutes to remove the template DNA. The RNA is recovered by lithium chloride precipitation as the transcription reactions are mixed thoroughly with 30 μL of nuclease-free water and 30 μL of 7.5 M LiCl. The mixture is chilled at −20° C. for 30 minutes, and centrifuged at 4° C. for 15 minutes at 14,000 rpm to pellet the RNA. The supernatants are carefully removed and the pellets are washed with 1 mL of 70% ethanol to maximize removal of unincorporated nucleotides. The 70% ethanol is carefully removed after centrifuging again at 4° C. for 15 minutes at 14,000 rpm. The pellets are placed in a Speed vac for 5 minutes for drying, and the RNA is resuspended in nuclease-free water. The concentration of the RNA is determined by Nanodrop analysis (Nanodrop® 2000, Thermo Scientific, Waltham, Mass.), and the transcription products are analyzed by 1% agarose gel electrophoresis.
(274) Part II: In Vitro Translation and Western Blot Analysis
(275) To demonstrate that an RNA construct attached to a polypeptide coding region is capable of increasing expression of the polypeptide coding region in the presence of a target polynucleotide, the RNA construct attached to luciferase RNA and target RNA are placed into an in vitro translation system (Pierce Human in vitro protein expression kit (#88857, Thermo Scientific, Waltham, Mass.)). A 25 μL translation reaction is performed with 2 μg of RNA combined with 12.5 μL of lysate mixture, 2.5 μL accessory proteins, 1 μL salt solution B, 0.5 μL of amino acid minus methionine, 0.5 μL of amino acid minus leucine, 1 μL RNAse inhibitor (40 U/mL), 1.5 μL energy mix, and nuclease-free water. The reaction is assembled in a 0.5 mL centrifuge tube on ice, and the lysate is preincubated with accessory proteins for 5 minutes before adding the subsequent components to enable better translation. Nuclease-free water is substituted with varying quantities of MS2-PABP fusion protein. The reaction is mixed thoroughly by stirring with the pipette tip and gently flicking the tube before incubating at 30° C. overnight. The reaction is stopped by placing the centrifuge tube on ice. Translation products are then analyzed using Western blotting. SDS-PAGE electrophoresis is performed using 4-20% linear gradient polyacrylamide precast gels (#161-1105, BioRad, Hercules, Calif.) before transferring to a nitrocellulose membrane. The nitrocellulose is developed by ONE-HOUR WESTERN™ (#L00228, Genscript, Piscataway, N.J.) using 10 ng of goat monoclonal anti-Luciferase antibody (Millipore, Billerica, Mass.). The intensity of the expression is analyzed by the BioRad Versa Doc™ 4000 imaging system (BioRad, Hercules, Calif.). An increase in intensity of luciferase expression is expected to be seen in tubes containing both RNA construct and target, compared to tubes containing RNA construct or target alone. The target stabilizes the RNA construct, which allows the RNA construct to be stably bound by the MS2-PABP fusion RBP, leading to an increase in expression of the attached luciferase polypeptide coding region.
Example 4
Naturally-Occurring RNA Switch
(276) This example relates to a naturally-occurring RNA switch. The principles described in this example further validate RNA constructs of the invention.
(277) MicroRNAs Target mRNA-Binding Protein Sites
(278) Several recent studies suggested that the biological targets of microRNAs reside in the 3′UTRs of many mRNAs. The present invention contemplated that the cis-regulatory code targeted by trans-acting microRNAs was, at least in part, the same as that read by trans-acting RNA binding proteins. This model provides a new mechanism for gene regulation that provides a biochemical means to explain how the expression patterns of genes are selected for the required needs of a cell. It also provides a novel strategy for turning ON or OFF a polynucleotide coding region.
(279) Confirmation that microRNAs Target mRNA-Binding Protein Sites
(280) To confirm this model, it was determined whether any of the presently known microRNAs targeted a well-characterized mRNA regulatory element, such as the stem-loop structure, which is present in the 3′-untranslated region (UTR) of many higher eukaryotic histone mRNAs. Unlike most mRNAs, histone messages are not poly-adenylated. Instead, this family of mRNAs utilizes a 26 base stem-loop structure in its 3′-UTR called the histone stem-loop (HSL), which is regulated by the histone stem-loop binding protein (SLBP) and facilitates efficient translation.
(281) Twenty-five human histone mRNA sequences containing the HSL (
(282) Found microRNA and RBP Target Overlapping Code
(283) A group of microRNAs were identified that are contemplated to specifically interact with the HSL sequence with binding activity centered on the HSL regulatory element. These included the mir-518 and mir-319 microRNA families (
(284) This first informatic search focused on human microRNAs. It was then expanded to include all presently characterized microRNAs. This expanded search additionally identified a microRNA encoded by SV40 (first example listed in
(285) It is likely that this SV40 microRNA represents a viral counterpart to what was a scavenged cellular microRNA, both performing a similar function, but in one case to perform a cellular need and the other case to satisfy a viral function. The cellular microRNA mir-518 family as well as the SV40 microRNA are likely all competing with the SLBP for binding to the HSL. When the SLBP binds, the histone mRNA that it is attached to is actively translated and the histone protein readily produced. When the microRNA binds the HSL, the histone protein is not expressed and translation is repressed.
(286) The cell likely uses the mir-518 to help regulate SLBP binding, and thus the expression of histones, in an elaborate post-transcriptional regulatory mechanism that affords tight control that is directly linked to the cell cycle. SV40 may have developed to use this pathway for its own purposes so that it can better control the cellular production of histone protein, around which it wraps its genomic DNA as part of its replication process. Therefore, the mir-518/SLBP system appears to represent a naturally occurring RNA-based structural switch that has been scavenged by the SV40 virus.
Example 5
An RNA Construct that Turns Off a Reporter Gene
(287) The inventive concept has been validated using an SV40-specific non-coding RNA (a microRNA), a target polynucleotide, that melts a stem-loop structured element based upon those known to exist in the 3′-untranslated region of many human histone-mRNAs (the RNA construct). This structure, called the histone stem-loop (HSL), is the natural target of a regulatory RNA-binding-protein called the stem-loop binding protein (SLBP). When SLBP binds to the HSL present in the histone mRNA, it activates translation, resulting in the increased production of histone protein. The SV40 non-coding RNA can act as a competitor to this process because it base pairs with the HSL in a manner that melts the stem-loop structure and thus destroys the natural binding site for SLBP (an example of the schema depicted in
(288) The naturally occurring histone mRNA has been rationally designed into a RNA construct with improved base-pairing kinetics for the SV40 non-coding RNA, and the histone mRNA coding region has been replaced with that of a green fluorescent protein (GFP) reporter gene. This trans-acting RNA switch strategy can be used as a molecular tool for biological research as a post-transcriptional reporter assay by inserting a gene of interest to then be turned ON or OFF, post-transcriptionally when the RNA switch is activated. An anti-viral strategy is specifically contemplated that utilizes virally-encoded RNA as the target to turn ON or OFF the RNA construct, resulting in cell death or inhibition of viral replication using one or more of the following additional strategies. The SV40/HSL construct, more fully described below, is able to be used as an antiviral compound when the reporter gene is replaced with, for example, a death gene.
(289) The SV40/HSL/GFP construct was engineered such that the expression of the SV40 microRNA (the first entry in
(290) The following approach was used to create a trans-acting RNA-structural switch. (1) A hybrid gene (construct) was made containing the reporter gene, GFP, coding sequence (CDS) fused to a histone stem-loop (HSL) regulatory element (conforming to Consensus Sequence I), which serves as the RNA construct. This hybrid gene is shown in
(291) The HSL is the natural target of the stem-loop binding protein (SLBP), and this protein needs to bind in order for the upstream gene to be efficiently translated into protein (in this case it is the reporter GFP). In the presence of the SV40 miRNA, which is the target polynucleotide for this RNA construct, it base-pairs with the melted HSL, preventing SLBP binding and reducing GFP expression.
(292) The On-Off nature of the RNA-structural switch can be directly measured by assessing the amount of GFP-HSL-RNA construct that can be immunoprecipitated with the SLBP in the presence or absence of the SV40 miRNA. This is what is depicted in
(293) The activity of the switch can also be indirectly assessed by determining the amount of reporter gene being expressed. As can be seen in
(294) Additional Experimental Validation
(295) Further experimental work is contemplated to confirm and develop an RNA construct which can bind a viral RNA. (1) The existing technology as described above will be optimized to show a greater difference in reporter gene expression in cells that contain the mir-518 or SV40 microRNA versus cells that do not. This will be accomplished by adjusting the amount of basal reporter gene expression as well as the amount of mir-518 or SV40 microRNA co-expressed in the cells. (2) Once a change (reduction) in reporter gene expression by approximately 50% is achieved, use of mir-518 or SV40 microRNA co-expression will be replaced with actual SV40 virus infection in cell culture. This system will be used to determine the effect of SV40 virus on the expression of the reporter gene. It is contemplated that those cells infected with SV40 virus will show a decrease in reporter gene expression. (3) The present version of the trans-acting RNA structural switch used in the experiment described above acts as a repressor and decreases the translation (protein production) of the gene fused to it. To produce an effective anti-viral biological (or other anti-pathogen or anti-neoplastic biological), it is desired to activate the expression of a death gene. To accomplish this, the approach of a repressor and an operator will be used. The RNA construct will be fused downstream of a gene coding for a repressor protein (such as the lac-repressor) instead of a reporter gene. This repressor protein will be constitutively expressed because the switch is in the “ON” state in the absence of target polynucleotide (e.g., virus microRNA) and therefore, translationally active. Additionally, the expression of a “Death-gene” will be driven by an inducible promoter, which is the target of the repressor gene being expressed from the RNA construct. This will keep the death-gene expression in the basal “OFF” state because the repressor protein binds it. In the presence of SV40, or the expression of the mir-518 or SV40 microRNA, the repressor gene expression will be reduced or shut OFF, which will activate the expression of the death-gene, thus killing the infected cell. (4) Specificity could then be determined by measuring the degree to which virally infected cells or those expressing mir-518 or SV40 microRNA are selectively killed and the degree to which the anti-viral drug is inert in non-infected cells.
(296) Although the anti-viral described above reverses a negative-type switch (i.e. is an indirect mechanism), it is contemplated that activating a positive-type regulating switch also will be a useful anti-viral mechanism. A rationally designed positive-activating RNA structural switch can be used to directly turn on a death gene when it is activated by a viral target polynucleotide, such as the mechanism depicted in
EQUIVALENTS
(297) The invention may be embodied in other specific forms without departing from the spirit or essential characteristics thereof. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting on the invention described herein. Scope of the invention is thus indicated by the appended claims rather than by the foregoing description, and all changes which come within the meaning and range of equivalency of the claims are intended to be embraced therein.
INCORPORATION BY REFERENCE
(298) The entire disclosure of each of the patent documents, scientific publications, and other database references disclosed hereinabove is expressly incorporated herein by reference for all purposes.