ROQ1 provides resistance to both xanthomonas and pseudomonas in plants

11236355 · 2022-02-01

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided herein is a non-Nicotiana transgenic plant comprising an exogenous polynucleotide encoding Nicotiana benthamiana Roq1 or a variant thereof. These plants have enhanced resistance to at least one species of Xanthomonas, Pseudomonas, Ralstonia, and/or another pathogen containing a homolog of XopQ whose recognition is mediated by Roq1.

Claims

1. A transgenic plant comprising an exogenous polynucleotide encoding a polypeptide that is identical to SEQ ID NO: 1, wherein the plant is not a Nicotiana plant.

2. The transgenic plant of claim 1, wherein the exogenous polynucleotide is operably linked to a promoter.

3. The transgenic plant of claim 2, wherein the promoter is exogenous to the plant.

4. The transgenic plant of claim 2, wherein the promoter is endogenous to the plant.

5. A seed of a transgenic plant of claim 1, wherein the seed comprises the exogenous polynucleotide.

6. A population of at least 100 plants of claim 1, growing in a field.

7. A method for enhancing the resistance of a non-Nicotiana plant to at least one species of Xanthomonas, Pseudomonas and/or Ralstonia, comprising: (a) introducing an exogenous polynucleotide encoding a polypeptide that is at least 90% identical to SEQ ID NO: 1 into a non-Nicotiana plant cell; (b) regenerating a transgenic non-Nicotiana plant from the non-Nicotiana plant cell; and (c) selecting said transgenic non-Nicotiana plant or a progeny of the same that contains the exogenous polynucleotide for resistance to Xanthomonas, Pseudomonas, and/or Ralstonia.

8. The method of claim 7, wherein the amino acid sequence of the polypeptide is at least 95% identical to the amino acid sequence of SEQ ID NO:1.

9. The method of claim 7, further comprising collecting seed from said transgenic non-Nicotiana plant or a progeny of the same that contains the exogenous polynucleotide.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The skilled artisan will understand that the drawings, described below, are for illustration purposes only. The drawings are not intended to limit the scope of the present teachings in any way.

(2) FIG. 1. Effect of XopQ perception on bacterial growth and disease symptoms. X. euvesicatoria and X. gardneri wild type and XopQ knockout strains were infiltrated into N. benthamiana leaves at low inoculum (OD.sub.600=0.0001). Bacterial growth was assayed at six days post infiltration and disease symptoms were imaged at thirteen and nine days post infiltration for Xe and Xg respectively. Error bars indicate standard deviation from three replicates. CFU—colony forming units.

(3) FIG. 2. GFP-based reporter for immune activation. GFP-TMV was co-expressed with an empty vector or XopQ transiently using Agrobacterium in wild type and eds1-1 mutant N. benthamiana leaves. The leaves were imaged three days post infiltration under white light (left) or long-wave UV (right) using a handheld digital camera.

(4) FIG. 3. GFP-TMV reporter in VIGS leaves of N. benthamiana. Viral-Induced Gene Silencing was used to downregulate either the GUS gene (as a negative control, top) or Roq1 (bottom). XopQ was transiently expressed along with the TMV-GFP reporter using Agrobacterium and the plants were imaged at four days post infiltration under white light (left) or long-wave UV (right).

(5) FIG. 4. Transient expression of Roq1 and XopQ. Roq1 and XopQ were transiently expressed using Agrobacterium in leaf tissue of N. tabacum, N. sylvestris and B. vulgaris. The Agrobacterium was infiltrated at a total OD.sub.600 of 0.5 and the plants were imaged at six days post infiltration for N. tabacum and N. sylvestris, and nine days post infiltration for B. vulgaris.

(6) FIG. 5: Co-immunoprecipitation of XopQ and Roq1. XopQ-3×Flag, ATR1-3×Flag and HopQ1-3×Flag were transiently co-expressed with either Rpp1-6×HA or Roq1-6×HA in the N. benthamiana eds1 mutant. Western blots with α-HA primary antibody (top) and α-Flag primary antibody (middle) show proteins pulled down with anti-Flag beads for each combination. A Western blot of the input protein extract (prior to precipitation) is shown on the bottom. The Arabidopsis NLR protein RPP1 and its cognate effector ATR1 were included as controls. Predicted molecular weights are as follows: XopQ-3×Flag 53 kD, HopQ1-3×Flag 52kD, ATR1-3×Flag 33kD, RPP1-6×HA 145 kD, and Roq1-6×HA 159 kD.

(7) FIG. 6: XopQ phylogenetic tree. XopQ homologs were identified by BLAST search and used to generate a phylogenetic tree. Sequences identified with * were cloned and tested for their ability to be recognized by Roq1. All tested homologs of XopQ elicited a Roq1-dependent immune response. Genbank accession numbers for the various sequences are in brackets next to the species name.

(8) FIG. 7 (A-B): Roq1 gene models. (A) The gene models for Roq1 from Nicotiana benthamiana, the highly similar ortholog from Nicotiana tabacum and the putative pseudogene from Nicotiana sylvestris are shown. The Roq1 gene contains five exons (depicted as white-filled box) and four introns. The predicted CDS for Roq1 is 3921 bp and the gene spans a predicted 9.6 kb from the start codon to the stop codon. The N. sylvestris gene contains a predicted stop codon in exon 2 and is missing part of exon 1 and most of exon 2 (B, aberrant sequences boxed). An aberrant, 8.7 kb insert is present between exon1 and exon2 in the N. sylvestris gene. The genomic sequence from N. benthamiana was obtained from Benth Genome website, the N. tabacum sequence from Sol Genomics and the N. sylvestris sequence was obtained from NCBI. Accession numbers for the genome scaffolds are shown in parentheses for each. SEQ ID NOS. 2-7.

(9) FIG. 8: Roq1 perception of XopQ/HopQ1 alleles. The indicated XopQ/HopQ1 alleles were cloned and transiently expressed along with the GFP-TMV reporter and either Roq1 or an empty vector in Nicotiana sylvestris. The leaves were imaged at six days post infiltration under white light and long-wave UV to view the visible HR response and viral GFP expression. Agrobacterium harboring the expression constructs was infiltrated at an OD.sub.600 of 0.05 for each of the three TMV-GFP constructs and 0.3 for the other elicitor/receptor constructs. Xe—X. euvsicatoria, Xg—X. gardneri, Xam—X. axonipodis pv. manihotis, Xcc—X. campestris pv. campestris, Xoo—X. oryzae pv. oryzae, EV—empty vector, Xaj—X. axonopodis pv. juglandis, Xcitrii—X. citrii, Psp—P. syringae pv. phaseolicola, Pst—P. syringae pv. tomato, Xfa—X. fuscans subsp. aurantifolii.

(10) FIG. 9: Roq1 mediates recognition of the Ralstonia solanacearum effector RipB. Two alleles of the Ralstonia solanacearum effector RipB (WP_003278485.1 and CAD13773.2) we cloned and transiently expressed in N. benthamiana using Agrobacterium. Expression of both RipB alleles resulted in a visible immune response in wild type plants but was not observed plants homozygous for loss of function mutations in the Roq1 gene. This indicates that Roq1 mediates recognition of the Ralstonia solanacearum effector RipB.:

(11) FIG. 10: Roq1 confers resistance to several bacterial pathogens in tomato. Xanthomonas euvesiactoria (Xe), Xanthomonas perforans (Xp), Xanthomonas gardneri (Xg) and Pseudomonas syringae pv tomato (Ps) were infiltrated into leaf tissue of wild type and Roq1 tomato plants. Bacterial growth was quantified after four days (Ps) or six days (Xe, Xp, Xg). The tomato plants expressing Roq1 were found to have approximately ten-fold fewer bacteria, indicating that Roq1 confers resistance to these bacteria.

(12) FIG. 11: Visible disease symptoms were imaged at six days post infiltration of Pseudomonas syringae pv tomato at an OD.sub.600 of 0.0001. Wild type tomato leaves (left) have visible necrotic disease lesions in the infiltrated region, marked with an arrow and outline in black marker. The Roq1 tomato plants (right) do not develop disease lesions, indicating that they are resistant to this pathogen.

(13) FIG. 12: The Roq1 signaling pathway depends on EDS1 and NRG1. Viral Induced Gene Silencing (VIGS) was used to silence the EDS1 and NRG1 genes in N. benthamiana. Relative to the negative control, these plants were unable to perceive transiently expressed XopQ as observed by the lack of a visible immune response. This indicates that both EDS1 and NRG1 are required for Roq1-dependent perception of XopQ.

DEFINITIONS

(14) Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are described.

(15) All patents and publications, including all sequences disclosed within such patents and publications, referred to herein are expressly incorporated by reference.

(16) Numeric ranges are inclusive of the numbers defining the range. Unless otherwise indicated, nucleic acids are written left to right in 5′ to 3′ orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.

(17) The headings provided herein are not limitations of the various aspects or embodiments of the invention. Accordingly, the terms defined immediately below are more fully defined by reference to the specification as a whole.

(18) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Singleton, et al., DICTIONARY OF MICROBIOLOGY AND MOLECULAR BIOLOGY, 2D ED., John Wiley and Sons, New York (1994), and Hale & Markham, THE HARPER COLLINS DICTIONARY OF BIOLOGY, Harper Perennial, N.Y. (1991) provide one of skill with the general meaning of many of the terms used herein. Still, certain terms are defined below for the sake of clarity and ease of reference.

(19) It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as “solely”, “only” and the like in connection with the recitation of claim elements, or the use of a “negative” limitation.

(20) As used herein, “resistance” is a relative term in that the presence of a polypeptide of the invention (i) reduces the disease symptoms of a plant comprising the gene (R (resistance) gene) that confers resistance, relative to a plant lacking the R gene, and/or (ii) reduces pathogen reproduction or spread on a plant or within a population of plants comprising the R gene and/or (iii) would act to confer resistance to a particular pathogen in the absence of other resistance mechanism(s). Resistance as used herein is relative to the “susceptible” response of a plant to the same pathogen. Typically, the presence of the R gene improves at least one production trait of a plant comprising the R gene when infected with the pathogen, such as grain yield, when compared to an isogenic plant infected with the pathogen but lacking the R gene. The isogenic plant may have some level of resistance to the pathogen, or may be classified as susceptible. Thus, the terms “resistance” and “enhanced resistance” are generally used herein interchangeably. Furthermore, a polypeptide of the invention does not necessarily confer complete pathogen resistance, for example when some symptoms still occur or there is some pathogen reproduction on infection but at a reduced amount within a plant or a population of plants. Resistance may occur at only some stages of growth of the plant, for example in adult plants (fully grown in size) and less so, or not at all, in seedlings, or at all stages of plant growth. By using a transgenic strategy to express an polypeptide in a plant, the plant of the invention can be provided with resistance throughout its growth and development Enhanced resistance can be determined by a number of methods known in the art such as analysing the plants for the amount of pathogen and/or analysing plant growth or the amount of damage or disease symptoms to a plant in the presence of the pathogen, and comparing one or more of these parameters to an isogenic plant lacking an exogenous gene encoding a polypeptide of the invention.

(21) The terms “non-Nicotiana plant” and “not a Nicotiana plant” refer to a plant that is not a member of the Nicotiana genus of herbaceous plants and shrubs also referred to as “tobacco” plants.

(22) Other definitions of terms may appear throughout the specification.

DETAILED DESCRIPTION

(23) Before the present invention is described, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.

(24) Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.

(25) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, some potential and preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. It is understood that the present disclosure supersedes any disclosure of an incorporated publication to the extent there is a contradiction.

(26) It must be noted that as used herein and in the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “a nucleic acid” includes a plurality of such nucleic acids and reference to “the compound” includes reference to one or more compounds and equivalents thereof known to those skilled in the art, and so forth.

(27) The practice of the present invention may employ, unless otherwise indicated, conventional techniques and descriptions of organic chemistry, polymer technology, molecular biology (including recombinant techniques), cell biology, biochemistry, and immunology, which are within the skill of the art. Such conventional techniques include polymer array synthesis, hybridization, ligation, and detection of hybridization using a label. Specific illustrations of suitable techniques can be had by reference to the example herein below. However, other equivalent conventional procedures can, of course, also be used. Such conventional techniques and descriptions can be found in standard laboratory manuals such as Genome Analysis: A Laboratory Manual Series (Vols. I-IV), Using Antibodies: A Laboratory Manual, Cells: A Laboratory Manual, PCR Primer: A Laboratory Manual, and Molecular Cloning: A Laboratory Manual (all from Cold Spring Harbor Laboratory Press), Stryer, L. (1995) Biochemistry (4th Ed.) Freeman, New York, Gait, “Oligonucleotide Synthesis: A Practical Approach” 1984, IRL Press, London, Nelson and Cox (2000), Lehninger, A., Principles of Biochemistry 3.sup.rd Ed., W. H. Freeman Pub., New York, N.Y. and Berg et al. (2002) Biochemistry, 5.sup.th Ed., W. H. Freeman Pub., New York, N.Y., all of which are herein incorporated in their entirety by reference for all purposes.

(28) The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.

(29) Provided herein is a transgenic plant comprising an exogenous polynucleotide encoding a polypeptide that is at least 80% identical to (e.g., at least 90% identical to, at least 94% identical to, at least 95% identical to, at least 98% identical to or the same as) the Nicotiana benthamiana Roq1 sequence of SEQ ID NO: 1, wherein the plant is not a Nicotiana plant.

(30) SEQ ID NO:1 provides the amino acid sequence of the Roq1 protein from Nicotiana benthamiana and is shown below. Roq1 orthologs may be found in other species and utilized herein.

(31) TABLE-US-00001 MLTSSSHHGRSYDVFLSFRGEDTRKTFVGHLFNALIEKGIHTFMDDKELK RGKSISSELMKAIGESRFAVVVFSKNYASSTWCLEELVKILEIHEKFELI VVPVFYDVDPSTVRKQNGEYAVCFTKFEANLVDDRDKVLRWREALTKVAN ISGHDLRNTYNGDESKCIQQILKDIFDKFCFSISITNRDLVGIESQIKKL SSLLRMDLKGVRLVGIWGMGGVGKTTAARALFNRYYQNFESACFLEDVKE YLQHHTLLYLQKTLLSKLLKVEFVDCTDTEEMCVILKRRLCSKKVLVVLD DVNHNDQLDKLVGAEDWFGSGSRIVITTRDMKLLKNHDVHETYEIKVLEK DEAIELFNLHAFKRSSPEKEFKELLNLVVDYTGGLPLALKVLGSLLYKED LDVWISTIDRLKDNPEGEIMATLKISFDGLRDYEKSIFLDIACFFRGYNQ RDMTALFHASGFHPVLGVKTLVEKSLIFILEDKIQMHDLMQEMGRQIAVQ ESPMRRIYRPEDVKDACIGDMRKEAIEGLLLTEPEQFEEGELEYMYSAEA LKKTRRLRILVKEYYNRGFDEPVAYLPNSLLWLEWRNYSSNSFPSNFEPS KLVYLTMKGSSIIELWNGAKRLAFLTTLDLSYCHKLIQTPDFRMITNLER LILSSCDALVEVHPSVGFLKNLILLNMDHCISLERLPAIIQSECLEVLDL NYCFNLKMFPEVERNMTHLKKLDLTSTGIRELPASIEHLSSLENLQMHSC NQLVSLPSSIWRFRNLKISECEKLGSLPEIHGNSNCTRELILKLVSIKEL PTSIGNLTSLNFLEICNCKTISSLSSSIWGLTSLTTLKLLDCRKLKNLPG IPNAINHLSGHGLQLLLTLEQPTIYERLDLLRIIDMSWCSCISSLPHNIW MLKFLRILCISYCSRLEYLPENLGHLEHLEELLADGTGILRLPSSVARLN KLEVLSERKKFAIGPKVQYSSSMLNLPDDVEGSLGSLGSVVKLNLSGNGF CNLPETMNQLFCLEYLDITFCQRLEALPELPPSIKELYVDEHLALRIMED LVIKCKELNLIAVTKIEYQNFYRWLDSIWSDVSELLENSQKQQLDDMLQL IPFSYLSTAKREEVLKIVIHGTRIPEWFRWQDRSATTMSVNLPEYWYTEN FLGFAICCSCCFYHSARSYDVEFEGSMHHYNYDSSYWKEYEEPSYDFYER DSIFITAKLTPRHKGMRTEELKKVCSFSMNVLRRATAVPNMCFAFFPFNS LCHISNLQANNPNDYGIFETCLSPGDIRHRGKQWGFNLVYKDETGGSVTH EMLINR*

(32) The transgenic plant may be monocotyledonous or dicotyledonous. Target plants include, but are not limited to, the following: cereals (for example, wheat, barley, rye, oats, rice, maize, sorghum and related crops); grapes; beet (sugar beet and fodder beet); pomes, stone fruit and soft fruit (mango, kiwi, apples, pears, plums, peaches, almonds, cherries, strawberries, raspberries and black-berries); leguminous plants (beans, lentils, peas, soybeans); oil plants (rape or other Brassicas, mustard, poppy, olives, sunflowers, safflower, flax, coconut, castor oil plants, cocoa beans, groundnuts); cucumber plants (marrows, cucumbers, melons); fibre plants (cotton, flax, hemp, jute); citrus fruit (oranges, lemons, grapefruit, mandarins); vegetables (spinach, lettuce, asparagus, cabbages, carrots, onions, tomatoes, peppers, potatoes, paprika); lauraceae (avocados, cinnamon, camphor); or plants such as maize, cassava, nuts (walnut), coffee, sugar cane, tea, vines, hops, turf, bananas and natural rubber plants, as well as ornamentals (flowers, shrubs, broad-leaved trees and evergreens, such as conifers). In many embodiments, the plant may be susceptible to infection by one or more species of Xanthomonas, Pseudomonas, Ralstonia, or another pathogen containing an effector with homology to XopQ recognized by Roq1 (e.g., one or more species of Xanthomonas and one or more species of Pseudomonas) without the exogenous polynucleotide. In some cases the plant may be a hybrid.

(33) As would be apparent, the transgenic plant has enhanced resistance to at least one species of Xanthomonas, Pseudomonas, Ralstonia, or another pathogen containing an effector with homology to XopQ which is recognized by Roq1 (e.g., one or more species of Xanthomonas and one or more species of Pseudomonas), relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide. Xanthomonas/Pseudomonas species to which the Roq1 provide resistance to include those that encode a XopQ/HopQ1 polypeptide. These polypeptides appear to be present in many pathogenic strains of Xanthomonas/Pseudomonas and, as such, Roq1 is believed to provide resistance to one or more of the bacteria listed in FIG. 6, including, but not limited to, Xanthomonas gardneri, Xanthomonas perforans, Xanthomonas euvesicatoria, Xanthomonas oryzae pv oryzae, Xanthomonas oryzae pv. oryzicola, Xanthomonas hortorum, Xanthomonas campestris, Xanthomonas axonopodis, Xanthomonas citri, Xanthomonas arboricola, Xanthomonas asicola, Xanthomonas fragariae, Xanthomonas sacchari and Pseudomonas syringae, as well as Acidovorax citrulli, Xanthomonas translucens and Ralstonia solanacearum. A list of Xanthomonas and Pseudomonas to which the plants should have enhanced resistance is set forth in Bull et al. J. Plant Pathology (2010 92: 551-591, which is incorporated by reference for that list.

(34) In some embodiments, the amino acid sequence of the polypeptide may be at least 80% identical to (e.g., 90% identical to, 94% identical to, at least 95% identical to, at least 96% identical to, at least 97% identical to, at least 98% identical to, at least 99% identical to, or 100% identical to) the amino acid sequence of a wild type Roq1 polypeptide from tobacco, e.g., a Roq1 polypeptide from N. benthamiana, N. tabacum, N. attenuata, or N. tomentosiformis (the sequences for which are available in Genbank as accession numbers ATD14363.1, XP_019226668.1, XP_009615050.1, and XP_016467297.1).

(35) Methods for making transgenic plants are very well known in the art, as are the choices for promoters and other regulatory regions (see, e.g., US20160076050, US20170218386 and US20160208279). As such, the present plants may be readily implemented by adapting any suitable method. In some embodiments, the exogenous polynucleotide is operably linked to a promoter. The promoter can be exogenous to the plant or endogenous to the plant. In some embodiments, the plant may be made by replacing a coding sequence in the genome of the plant with the exogenous polynucleotide.

(36) Also provided is a seed of a transgenic plant described above. These seeds may be made by selfing the plant or crossing the plant with another plant of the same species to produce, e.g., hybrid seed.

(37) Also provided is a population of at least 100 of the transgenic plants, e.g., at least 1,000, or at least 10,000 of the transgenic plants, growing in a field.

(38) Also provided is a method for enhancing the resistance of a non-Nicotiana plant to at least one species of Xanthomonas or Pseudomonas (e.g., one or more species of Xanthomonas and one or more species of Pseudomonas). In some embodiments, this method may comprise: (a) introducing an exogenous polynucleotide encoding a polypeptide that is at least 90% identical (e.g., at least 95%, at least 98%, or 100% identical) to the Roq1 sequence of SEQ ID NO: 1 into a plant cell that is from a plant that is susceptible to infection by Xanthomonas and/or Pseudomonas; and (b) regenerating a transgenic plant from the plant cell.

(39) In some embodiments, the amino acid sequence of the polypeptide may be at least 80% identical to (e.g., at least 90% identical to, at least 95% identical to, at least 95% identical to, at least 96% identical to, at least 97% identical to, at least 98% identical to, at least 99% identical to, or 100% identical to) the amino acid sequence of a tobacco Roq1 polypeptide, e.g., a Roq1 polypeptide from N. benthamiana, N. tabacum, N. attenuata, or N. tomentosiformis. (the sequences for which are available in Genbank as accession numbers ATD14363.1, XP_019226668.1, XP_009615050.1, and XP_016467297.1).

(40) Roq1 activity appears to require a functional and compatible NRG1 and/or EDS1 gene. As such, a functional NRG1 and/or EDS1 gene can be added to plants that do not already have a functional NRG1 and/or EDS1 gene or that contain a version of these genes which is not compatible with Roq1, in order for Roq1 to be active in immune activation.

(41) As noted above, methods for making transgenic plants are very well known in the art, as are the choices for promoters and other regulatory regions (see, e.g., US20160076050, US20170218386 and US20160208279). As such, the present plants may be readily implemented by adapting any suitable method.

EMBODIMENTS

(42) A transgenic plant comprising an exogenous polynucleotide encoding a polypeptide that is at least 80% identical to the Nicotiana benthamiana Roq1 sequence of SEQ ID NO: 1, wherein the plant is not a Nicotiana plant.

(43) The transgenic plant of any prior embodiment, wherein the plant has enhanced resistance to at least one species of Xanthomonas, Pseudomonas, Ralstonia, or another pathogen containing an effector with homology to XopQ which is recognized by Roq1 relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide.

(44) The transgenic plant of any prior embodiment, wherein the plant has enhanced resistance to at least one species of Xanthomonas and at least one species of Pseudomonas relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide.

(45) The transgenic plant of any prior embodiment, wherein the plant is a monocot.

(46) The transgenic plant of any prior embodiment, wherein the plant is a dicot.

(47) The transgenic plant of any prior embodiment, wherein the amino acid sequence of the polypeptide is at least 90% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1

(48) The transgenic plant of any prior embodiment, wherein the amino acid sequence of the polypeptide is at least 94% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1

(49) The transgenic plant of any prior embodiment, wherein the amino acid sequence of the polypeptide is at least 95% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1

(50) The transgenic plant of any prior embodiment, wherein the amino acid sequence of the polypeptide is identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1.

(51) The transgenic plant of any prior embodiment, wherein the exogenous polynucleotide is operably linked to a promoter.

(52) The transgenic plant of any prior embodiment, wherein the promoter is exogenous to the plant or wherein the promoter is endogenous to the plant.

(53) A seed of a transgenic plant of any prior embodiment.

(54) A population of at least 100 plants of any prior embodiment, growing in a field.

(55) A method for enhancing the resistance of a non-Nicotiana tobacco plant to at least one species of Xanthomonas, Pseudomonas, Ralstonia, or another pathogen containing an effector with homology to XopQ which is recognized by Roq1 (e.g., enhancing the resistance to at least one species of Xanthomonas and at least one species of Pseudomonas), comprising: (a) introducing an exogenous polynucleotide encoding a polypeptide that is at least 80% identical to the Nicotiana benthamiana Roq1 sequence of SEQ ID NO: 1 into the plant cell, wherein the plant cell is from a plant that is susceptible to infection by Xanthomonas, Pseudomonas, Ralstonia, or another pathogen containing an effector with homology to XopQ which is recognized by Roq1; and (b) regenerating a transgenic plant from the plant cell.

(56) The method of any prior method embodiment, wherein the plant has enhanced resistance to at least one species of Xanthomonas or Pseudomonas relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide.

(57) The method of any prior method embodiment, wherein the plant has enhanced resistance to at least one species of Xanthomonas and at least one species of Pseudomonas) relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide.

(58) The method of any prior method embodiment, wherein the plant is a monocot.

(59) The method of any prior method embodiment, wherein the plant is a dicot.

(60) The method of any prior method embodiment, wherein the amino acid sequence of the polypeptide is at least 90% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1.

(61) The method of any prior method embodiment, wherein the amino acid sequence of the polypeptide is at least 94% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1.

(62) The method of any prior method embodiment, wherein the amino acid sequence of the polypeptide is at least 95% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1

(63) The method of any prior method embodiment, wherein the amino acid sequence of the polypeptide is identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1.

(64) The method of any prior method embodiment, wherein the exogenous polynucleotide is operably linked to a promoter.

(65) The method of any prior method embodiment, wherein the promoter is exogenous to the plant or wherein the promoter is endogenous to the plant.

(66) The transgenic plant, seed, or method of any prior embodiment, wherein the plant is a cereal (for example, wheat, barley, rye, oats, rice, maize, sorghum and related crops); a grape; a beet (sugar beet and fodder beet); a pome, a stone fruit and a soft fruit (mango, kiwi, apple, pear, plum, peach, almond, cherry, strawberry, raspberry and black-berry); leguminous plant (bean, lentil, pea, soybean); oil plant (rape or other Brassicas, mustard, poppy, olive, sunflower, safflower, flax, coconut, castor oil plant, cocoa bean, groundnut); cucumber plant (marrow, cucumber, melon); fibre plant (cotton, flax, hemp, jute); citrus fruit (orange, lemon, grapefruit, mandarin); a vegetable (spinach, lettuce, asparagus, cabbage, carrot, onion, tomato, pepper, potato, paprika); a lauraceae (avocado, cinnamon, camphor); or a plant such as maize, cassava, nuts (walnut), coffee, sugar cane, tea, vines, hops, turf, banana or a natural rubber plant, or an ornamental (flower, shrub, broad-leaved tree or evergreen).

(67) In any embodiment, the exogenous polynucleotide may additionally provide resistance to other pathogen species containing an effector with homology to XopQ which is recognized by Roq1, such as species of the genus Ralstonia, e.g, Ralstonia solanacearum. As such, in transgenic plant embodiments, the plant may have enhanced resistance to at least one species of Xanthomonas, at least one species of Pseudomonas and at least one species of Ralstonia, relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide

EXAMPLES

(68) Aspects of the present teachings can be further understood in light of the following examples, which should not be construed as limiting the scope of the present teachings in any way.

(69) In this study the perception pathway of XopQ in N. benthamiana was investigated. Using the CRISPR/CAS9 system (Jinek et al., 2012), a stable eds1 mutants of N. benthamiana was created which were unable to perceive XopQ/HopQ1, thereby implicating a TLR in the perception of these effectors as was recently reported (Adlung and Bonas, 2016). A reverse genetic screen was conducted using Viral Induced Gene Silencing (VIGS) of the TLRs in N. benthamiana. A single TLR was identified which is required for the perception of XopQ. Biochemical experiments suggest that this protein, named Recognition of XopQ (Roq1), directly interacts with XopQ and HopQ1. Expression of Roq1 in other plant species is sufficient to enable the perception of diverse XopQ/HopQ1/RipB alleles, suggesting this gene may be useful for engineering resistance against Xanthomonas, Pseudomonas, Ralstonia and other pathogens containing a Roq1-recognized homolog of XopQ in many different crop species.

Results

(70) Perception of XopQ depends on EDS1. The Xanthomonas effector protein XopQ and the close homolog HopQ1 from Pseudomonas have previously been shown to trigger an avirulence response in N. benthamiana, indicating the presence of an immune perception pathway capable of detecting XopQ. To test if this pathway is dependent on eds1, a growth assay using wild type Xanthomonas euvesicatoria and the XopQ knockout was performed on both N. benthamiana wild type and eds1 mutant plants. Wild type X. euvesicatoria grew approximately 100-fold more on the eds1 mutant than the wild type plants, whereas the XopQ knockout grew to similarly high levels on both the wild type and eds1 plant (FIG. 1). Similar but less pronounced results were observed for X. gardneri, which grew 10-fold more in the absence of either EDS1 or XopQ (FIG. 1).

(71) Development of a fluorescence-based assay for XopQ perception. Unlike some recognized effector proteins that give a strong visible cell death response when transiently expressed, expression of XopQ in wild type N. benthamiana typically gives a mild chlorotic phenotype not well suited for a screen (FIG. 2). The disease symptoms observed to be associated with a loss of XopQ recognition do give a strong visible response (FIG. 1), but this assay was found to be inconsistent on Viral-Induced Gene Silencing (VIGS) plants, possibly due to only a partial knockdown of the target gene. An alternative assay was designed in which the XopQ protein was transiently expressed along with a Tobacco Mosaic Virus replicon containing a GFP gene (Marillonnet et al., 2005). In wild type plants XopQ perception resulted in immune activation and a lack of visible GFP from the viral replicon (FIG. 2). Lack of XopQ perception in the eds1 mutant allowed for strong GFP fluorescence to be observed using a handheld long-wave UV light. This phenotype was very robust in the eds1 mutants and consistent, though weaker, in EDS1 VIGS plants. This assay was employed to a reverse genetic screen of the TLR genes in N. benthamiana to identify the immune recognition receptor for XopQ.

(72) Identification of a TLR required for XopQ perception. VIGS constructs were designed to target all TLR genes in N. benthamiana. Nine VIGS constructs were cloned with fragments of up to four TLRs each. In this initial screen one of the nine constructs, targeting three distinct TLRs, was found to consistently prevent perception of XopQ and allow for expression of the GFP reporter. Individual VIGS constructs were made for these three candidate genes and one was found to prevent XopQ perception (FIG. 3). The gene targeted by this construct was named Recognition of XopQ1 (Roq1). Putative orthologs of Roq1 were identified in several other Nicotiana species but were absent in Solanum lycopersicum, Solanum tuberosum, Capsicum annuum and all other non-Nicotiana species examined.

(73) Roq1 is sufficient to allow perception of XopQ in Nicotiana sylvestris and Beta vulgaris. While highly conserved orthologs of Roq1 were identified in several other Nicotiana species including N. tabacum, N. attenuata, and N. tomentosiformis, the copy of Roq1 from N. sylvestris was found to contain an aberrant sequence disrupting the first and second exons, as well as a stop codon in a conserved part of the second exon (FIG. 7). Disruption of the endogenous Roq1 gene in N. sylvestris is consistent with a previous report that this species is unable to perceive XopQ (Adlung and Bonas, 2016). Transient expression of the N. benthamiana Roq1 gene along with XopQ in N. sylvestris resulted in a visible hypersensitive response that was not present when either Roq1 or XopQ were expressed alone (FIG. 4). To determine if Roq1 can be used to enable perception of XopQ in plants outside of the Nicotiana genus, Roq1 was co-expressed with XopQ in Beta vulgaris. This resulted in a chlorotic effect similar to that observed when XopQ is expressed in wild type N. benthamiana leaves (FIG. 4).

(74) Roq1 co-immunoprecipitates with XopQ. The recognition of HopQ1 in N. tabacum has previously been shown to be independent of HopQ1 activity (Li et al., 2013b). It was hypothesized that Roq1 may directly interact with XopQ instead of “Guarding” a protein or molecule that is modified by this effector. To test this, a series of co-immunoprecipitation experiments in eds1-1 N. benthamiana were performed. Roq1-6×HA was found to be pulled down by both XopQ-3×Flag and HopQ1-3×Flag, but not by ATR1-3×Flag, an effector known to interact with the TLR RPP1 (FIG. 5) (Krasileva et al., 2010). ATR1-3×Flag was found to be able to pull down RPP1-6×HA, consistent with previous results, but not Roq1-6×HA.

(75) Roq1 can mediate the perception of diverse proteins with homology to XopQ. Homologous alleles of XopQ, HopQ1 and RipB are widely distributed among Xanthomonas, Pseudomonas and Ralstonia species that are pathogenic on various crops. This suggests that Roq1 may be useful to engineer resistance into these crops species, but depends on Roq1 being able to recognize these diverse alleles. To sample the diversity of XopQ proteins a phylogenetic tree was generated and select XopQ and HopQ1 alleles for transient expression. Out of thirteen XopQ/HopQ1 alleles cloned, all elicited a with a Roq1-dependent immune response in N. benthamiana or N. sylvestris (FIG. 6, FIG. 8).

(76) Expression of Roq1 confers disease resistance against Pseudomonas syringae. With reference to FIG. 11, wild type tomato leaves (left) and Roq1-expressing tomato leaves (right) were infiltrated with Pseudomonas syringae pv. tomato. Six days after inoculation, disease symptoms are clearly visible in the infiltrated area in the wild type leaves (left), whereas no symptoms are visible on the Roq1-transgenic plants (right). The infiltrated parts of the leaves were delimitated with black marker and marked with an arrow. Circular wounds visible in the leaves are from the inoculation procedure and not a result of disease symptoms.

(77) Roq1 confers resistance to pathogens containing a recognized homolog of XopQ. With reference to FIG. 10, bacterial pathogens Xanthomonas euvesicatoria (Xe), Xanthomonas perforans (Xp), Xanthomonas gardneri (Xg) and Pseudomonas syringae pv. tomato (Ps) were infiltrated into the leaves of wild type tomato plants and tomato plants expressing Roq1. After six days, the leaf tissue was homogenized in buffer and plated to determine bacterial abundance. Approximately ten-fold fewer bacteria were detected in the Roq1 tomato leaves compared to the wild type, indicating that Roq1 confers disease resistance to these pathogens. All of these bacterial have a homolog of XopQ that is recognized by Roq1. Error bars indicated standard deviation.

(78) Roq1 activity depends on EDS1 and NRG1. With reference to FIG. 11, XopQ was transiently expressed in N. benthamiana leaf tissue using Agrobacterium. Following infiltration, leaves were covered in foil for three days before imaging. Activation of Roq1 leads to a strong immune activation, visible as a cell death response (top) in VIGS negative control plants. Silencing either EDS1 or NRG1 blocks Roq1 activation, indicating that both may be required Roq1 activity and that functional and compatible versions of these genes may need to be added along with Roq1 into a plant species to enable Roq1 function.

Methods

(79) CAS9 mediated knockout of EDS1 and Roq1. Guides to target the N. benthamiana EDS1 and Roq1 genes were designed and cloned into entry plasmids containing the CAS9 gene and the Arabidopsis thaliana U6-26 promoter to drive guide expression. LR reactions were performed to move the guide and CAS9 cassette into a binary vector which was used for stable transformation into N. benthamiana by Agrobacterium co-cultivation. Transformed plants were genotyped by PCR and Sanger sequencing, and homozygous knockout lines were obtained from the T1 generation

(80) Viral Induced Gene Silencing. Target TLR genes from N. benthamaiana were identified using a BLAST search of a transcript database (Nakasugi et al., 2013). The predicted protein sequences of identified genes were aligned and manually curated to remove gene fragments and pseudogenes. Candidate TLRs were targeted for silencing by cloning approximately 300 bp into the TRV2 VIGS vector (Liu et al., 2002) using restriction ligation cloning with the enzyme BsaI. The plasmids were transformed into Agrobacterium tumefaciens strain GV3101 and infiltrated into N. benthamiana plants along with TRV1 at an OD.sub.600 of 0.2 each. The plants were infiltrated at 4-6 weeks of age and phenotyped 2-4 weeks after infiltration.

(81) GFP-reporter assay for XopQ perception. Agrobacterium harboring the vectors pICH2011, pICH14011, and pICH7410 (Marillonnet et al., 2005) was mixed to a final OD.sub.600 of 0.05 each along with an Agrobacterium strain for transient expression of XopQ at an OD.sub.600 of 0.3. The mixture was infiltrated into leaf tissue and imaged under long-wave UV light to visualize GFP expression.

(82) Growth assay. To assay bacterial growth, Xanthomonas was grown overnight in NYG (0.5% peptone, 0.3% yeast extract, 2% glycerol) with 100 μg/mL rifampcin on a shaker at 30° C. The cultures were spun down at 10,000 g, washed once with 10 mM MgCl.sub.2, and infiltrated into leaf tissue at OD.sub.600=0.0001. Leaf punches were collected at 6 days post infiltration, homogenized, and serially diluted before plating on NYG agar plates with 100 μg/mL rifampcin and 50 μg/mL cycloheximide Colonies were counted 3-4 days after plating.

(83) Transient expression using Agrobacterium. Agrobacterium cultures were grown overnight in LB with selection at 30° C. on a shaker. Cells were pelleted by centrifugation at 10,000 g and resuspended in infiltration buffer (10 mM MgCl.sub.2, 10 mM MES pH 5.6). The cells were diluted to the appropriate OD.sub.600 and infiltrated into leaf tissue using a needleless syringe.

(84) Plant material and bacteria strains. Nicotiana sylvestris was obtained from Select Seeds Co. in Union, Conn. USA (“Woodland Tobacco 346”). Nicotiana tabacum and Beta vulgaris “Detroit Dark Red, Morse's Strain” (Plantation Products, Norton Mass., USA) were used for transient expression. X. euvesicatoria 85-10 and X. gardneri 153 were used for pathogen assays. The X. euvesicatoria 85-10 ΔXopQ knockout was constructed previously (Schwartz et al., 2015). Agrobacterium tumefaciens strains GV3101 and C58C1 were used for transient expression and VIGS.

(85) XopQ knockout in X. gardneri. 1000 bp regions upstream and downstream of the XopQ coding sequence were cloned into the pLVC18 plasmid (Lindgren et al., 1986) containing a SacB counter-selectable marker. This plasmid was conjugated into X. gardneri and single crossover events were selected for by tetracycline resistance (10 μg/mL) and PCR. Colonies were plated onto NYG media containing 5% sucrose to select for a second crossover event and screened by PCR to identify XopQ deletion strains.

(86) Co-immunoprecipitation assay. Each tissue sample (0.5 g) was ground with mortar and pestle to a homogeneous powder in liquid nitrogen. The samples were suspended in 1 mL of the protein extraction buffer (50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 0.1% Triton X-100, 0.2% Nonidet P-40, 6 mM β-mercaptoethanol, 1× protease inhibitor cocktail). Samples were centrifuged twice (10 min, 14,000 rpm, 4° C.). The supernatant was then transferred to a new tube with 10 μL Flag beads (A2220, Sigma) and incubated at 4° C. for 3 hours. The samples were centrifuged (1 min, 1,000 g) then washed three times with 1 mL of the protein extraction buffer. The protein was eluted by boiling for 5 min in 50 μl of 3× Laemmli buffer, centrifuged and loaded for Western blot. For the anti-Flag Western, the primary antibody was F7425 (Sigma) and the secondary antibody was A0545 (Sigma).

DISCUSSION

(87) Mechanism of Roq1 recognition of XopQ. Co-immunoprecipitation experiments showed that Roq1 can interact with either XopQ/HopQ1 as determined by immunoprecipitation after transient co-expression in N. benthamiana (FIG. 5). Roq1 did not interact with ATR1, indicating that there is specificity and that Roq1 is not interacting with the beads during the procedure. Furthermore, XopQ and HopQ1 did not interact with the TLR protein RPP1, indicating these proteins have some specificity to Roq1 and are not able to pull down all TLR proteins. This data is consistent with the model that Roq1 directly interacts with XopQ during activation. While the various XopQ/HopQ1 alleles have significant amino acid variation, especially at the N terminus, there are highly conserved regions which could mediate Roq1 recognition (data not shown). X. euvesicatoria XopQ and P. syringae pv. tomato HopQ1 share 65% amino acid identity with the variable N terminal region removed. While the EDS1 protein is required for perception of XopQ, it is not required for interaction between Roq1 and XopQ or RPP1 and ATR1. This data supports a model in which EDS1 is involved in the signaling process downstream of the TLR proteins and is not required for expression or proper folding of TLRs. NRG1 has been demonstrated to be required for the function of other TLRs and is believed to be a downstream signaling component (Peart et al., 2005; Qi et al., 2018).

(88) Distribution and specificity of Roq1. The Roq1 gene is highly conserved in several Nicotiana species but was not detected in any species outside this genus. This suggests that Roq1 evolved within the Nicotiana lineage and is consistent with the previous observation that XopQ failed to elicit an immune response when expressed in non-Nicotiana species (Adlung and Bonas, 2016). The wide distribution and high conservation of XopQ homologs in Xanthomonas, Pseudomonas and other pathogens may be a consequence of the narrow distribution of the Roq1 gene. The observation that co-expression of Roq1 with various XopQ homologs can elicit a Roq1-dependent immune response indicates that Roq1 is able to recognize the different homologs despite the various amino acid differences (FIG. 6, FIG. 8).

(89) Use of Roq1 to confer resistance against pathogens with homologs of XopQ. Because Roq1 is able to recognize diverse XopQ homologs (FIG. 6, FIG. 8), this gene likely can be used in many crop species to confer resistance against pathogens containing these or similar effector genes. Because Roq1 likely directly interacts with XopQ, Roq1 may be able to function in a distantly related plant species without the requirement for the transfer of additional signaling components (Wulff et al., 2011). This is supported by the observation that co-expression of Roq1 and XopQ triggers a visible reaction, presumably an immune response, in Beta vulgaris (FIG. 6). Roq1 activity does depend on the downstream signaling components such as EDS1 (FIG. 1, FIG. 2, FIG. 12) and SGT1, and NRG1 (FIG. 12). These genes are found in many plant species and therefore in some cases, including tomato, the endogenous EDS1 and NRG1 genes are sufficient for Roq1 function. In other species, particularly in plants more distantly related from the Solanaceous plants, exogenous copies of EDS1 and/or NRG1 may be required to enable Roq1 function.

REFERENCES

(90) Adlung, N., and Bonas, U. (2016). Non-host Resistance Induced by the Xanthomonas Effector XopQ Is Widespread within the Genus Nicotiana and Functionally Depends on EDS1. Front. Plant Sci. 7. Adlung, N., and Bonas, U. (2017). Dissecting virulence function from recognition—cell death suppression in Nicotiana benthamiana by XopQ/HopQ1-family effectors relies on EDS1-dependent immunity. Plant J. 38:42-49. Alfano, J. R., and Collmer, A. (2004). Type III secretion system effector proteins: double agents in bacterial disease and plant defense. Annu. Rev. Phytopathol. 42:385-414. Block, A., Li, G., Fu, Z. Q., and Alfano, J. R. (2008). Phytopathogen type III effector weaponry and their plant targets. Curr. Opin. Plant Biol. 11:396-403. Chisholm, S. T., Coaker, G., Day, B., and Staskawicz, B. J. (2006). Host-microbe interactions: Shaping the evolution of the plant immune response. Cell 124:803-814. Dangl, J. L., Horvath, D. M., and Staskawicz, B. J. (2013). Pivoting the Plant Immune System from Dissection to Deployment 563:7931-7935. Gupta, M. K., Nathawat, R., Sinha, D., Hague, A. S., Sankaranarayanan, R., and Sonti, R. V (2015). Mutations in the Predicted Active Site of Xanthomonas oryzae pv. oryzae XopQ Differentially Affect Virulence, Suppression of Host Innate Immunity, and Induction of the HR in a Nonhost Plant. Mol Plant-Microbe Interact. 28:195-206. Gürlebeck, D., Thieme, F., and Bonas, U. (2006). Type III effector proteins from the plant pathogen Xanthomonas and their role in the interaction with the host plant. J. Plant Physiol. 163:233-55. Hann, D. R., Dominguez-Ferreras, A., Motyka, V., Dobrev, P. I., Schornack, S., Jehle, A., Felix, G., Chinchilla, D., Rathjen, J. P., and Boller, T. (2014). The Pseudomonas type III effector HopQ1 activates cytokinin signaling and interferes with plant innate immunity. New Phytol. 201:585-598. Jinek, M., Chylinski, K., Fonfara, I., Hauer, M., Doudna, J. A., and Charpentier, E. (2012). A Programmable Dual-RNA—Guided 337:816-822. Jones, J. D. G., and Dangl, J. L. (2006). The plant immune system. Nature 444:323-329. Jones, J. D. G., Witek, K., Verweij, W., Jupe, F., Cooke, D., Dorling, S., Tomlinson, L., Smoker, M., Perkins, S., and Foster, S. (2014). Elevating crop disease resistance with cloned genes. Philos. Trans. R. Soc. B Biol. Sci. 369:20130087-20130087. Jones, J. D. G., Vance, R. E., and Dangl, J. L. (2016). Intracellular innate immune surveillance devices in plants and animals. Science (80-.). 354:aaf6395. Krasileva, K. V., Dahlbeck, D., and Staskawicz, B. J. (2010). Activation of an Arabidopsis Resistance Protein Is Specified by the in Planta Association of Its Leucine-Rich Repeat Domain with the Cognate Oomycete Effector. Plant Cell 22:2444-2458. Li, W., Yadeta, K. A., Elmore, J. M., and Coaker, G. (2013a). The Pseudomonas syringae effector HopQ1 promotes bacterial virulence and interacts with tomato 14-3-3 proteins in a phosphorylation-dependent manner. Plant Physiol. 161:2062-74. Li, W., Chiang, Y. H., and Coaker, G. (2013b). The HopQ1 Effector's Nucleoside Hydrolase-Like Domain Is Required for Bacterial Virulence in Arabidopsis and Tomato, but Not Host Recognition in Tobacco. PLoS One 8:1-9. Lindgren, P. B., Peet, R. C., and Panopoulos, N. J. (1986). Gene cluster of Pseudomonas syringae pv. “phaseolicola” controls pathogenicity of bean plants and hypersensitivity of nonhost plants. J. Bacteriol. 168:512-522. Liu, Y., Schiff, M., Marathe, R., and Dinesh-Kumar, S. P. (2002). Tobacco Rar1, EDS1 and NPR1/NIM1 like genes are required for N-mediated resistance to tobacco mosaic virus. Plant J. 30:415-429. Marillonnet, S., Thoeringer, C., Kandzia, R., Klimyuk, V., and Gleba, Y. (2005). Systemic Agrobacterium tumefaciens-mediated transfection of viral replicons for efficient transient expression in plants. Nat. Biotechnol. 23:718-23. Nakasugi, K., Crowhurst, R. N., Bally, J., Wood, C. C., Hellens, R. P., and Waterhouse, P. M. (2013). De Novo Transcriptome Sequence Assembly and Analysis of RNA Silencing Genes of Nicotiana benthamiana. PLoS One 8:e59534. Oerke, E.-C. (2005). Crop losses to pests. J. Agric. Sci. 144:31. Oh, C.-S., Pedley, K. F., and Martin, G. B. (2010). Tomato 14-3-3 protein 7 positively regulates immunity-associated programmed cell death by enhancing protein abundance and signaling ability of MAPKKKα. Plant Cell 22:260-272. Peart, J. R., Mestre, P., Lu, R., Malcuit, I., and Baulcombe, D. C. (2005). NRG1, a CC-NB-LRR protein, together with N, a TIR-NB-LRR protein, mediates resistance against tobacco mosaic virus. Curr. Biol. 15:968-973. Qi, T., Schultink, A., Pham, J., Cho, M.-J., and Staskawicz, B. (2018). NRG1 is required for the function of the TIR-NLR immune receptors Roq1 and RPP1 in Nicotiana benthamiana. Biorxiv Advance Access published 2018, doi:10.1101/284471. Rodriguez-Moreno, L., Song, Y., and Thomma, B. P. (2017). Transfer and engineering of immune receptors to improve recognition capacities in crops. Curr. Opin. Plant Biol. 38:42-49. Rossier, O., Wengelnik, K., Hahn, K., and Bonas, U. (1999). The Xanthomonas Hrp type III system secretes proteins from plant and mammalian bacterial pathogens. Pnas 96:9368-9373. Schwartz, A. R., Potnis, N., Timilsina, S., Wilson, M., Patane, J., Martins, J., Minsavage, G. V., Dahlbeck, D., Akhunova, A., Almeida, N., et al. (2015). Phylogenomics of Xanthomonas field strains infecting pepper and tomato reveals diversity in effector repertoires and identifies determinants of host specificity. Front. Microbiol. 6:535. Shirasu, K. (2009). The HSP90-SGT1 chaperone complex for NLR immune sensors. Annu. Rev. Plant Biol. 60:139-164. Sinha, D., Gupta, M. K., Patel, H. K., Ranjan, A., and Sonti, R. V. (2013). Cell Wall Degrading Enzyme Induced Rice Innate Immune Responses Are Suppressed by the Type 3 Secretion System Effectors XopN, XopQ, XopX and XopZ of Xanthomonas oryzae pv. oryzae. PLoS One 8:1-19. Teper, D., Salomon, D., Sunitha, S., Kim, J. G., Mudgett, M. B., and Sessa, G. (2014). Xanthomonas euvesicatoria type III effector XopQ interacts with tomato and pepper 14-3-3 isoforms to suppress effector-triggered immunity. Plant J. 77:297-309. Toruño, T. Y., Stergiopoulos, I., and Coaker, G. (2016). Plant-Pathogen Effectors: Cellular Probes Interfering with Plant Defenses in Spatial and Temporal Manners. Annu. Rev. Phytopathol. 54:419-441. Vincelli, P. (2016). Genetic engineering and sustainable crop disease management: Opportunities for case-by-case decision-making Sustain. 8. Wei, C.-F., Kvitko, B. H., Shimizu, R., Crabill, E., Alfano, J. R., Lin, N.-C., Martin, G. B., Huang, H.-C., and Collmer, A. (2007). A Pseudomonas syringae pv. tomato DC3000 mutant lacking the type III effector HopQ1-1 is able to cause disease in the model plant Nicotiana benthamiana. Plant J. 51:32-46. Wiermer, M., Feys, B. J., and Parker, J. E. (2005). Plant immunity: The EDS1 regulatory node. Curr. Opin. Plant Biol. 8:383-389. Wu, C.-H., Belhaj, K., Bozkurt, T. O., and Kamoun, S. (2016). The NLR helper protein NRC3 but not NRC1 is required for Pto-mediated cell death in Nicotiana benthamiana. New Phytol. 209:1344-1352. Wulff, B. B. H., Horvath, D. M., and Ward, E. R. (2011). Improving immunity in crops: New tactics in an old game. Curr. Opin. Plant Biol. 14:468-476. Yu, S., Hwang, I., and Rhee, S. (2014). The crystal structure of type III effector protein XopQ from Xanthomonas oryzae complexed with adenosine diphosphate ribose. Proteins 82:2910-4.

(91) Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it is readily apparent to those of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.