ROQ1 provides resistance to both xanthomonas and pseudomonas in plants
11236355 · 2022-02-01
Assignee
Inventors
Cpc classification
C12N15/87
CHEMISTRY; METALLURGY
International classification
Abstract
Provided herein is a non-Nicotiana transgenic plant comprising an exogenous polynucleotide encoding Nicotiana benthamiana Roq1 or a variant thereof. These plants have enhanced resistance to at least one species of Xanthomonas, Pseudomonas, Ralstonia, and/or another pathogen containing a homolog of XopQ whose recognition is mediated by Roq1.
Claims
1. A transgenic plant comprising an exogenous polynucleotide encoding a polypeptide that is identical to SEQ ID NO: 1, wherein the plant is not a Nicotiana plant.
2. The transgenic plant of claim 1, wherein the exogenous polynucleotide is operably linked to a promoter.
3. The transgenic plant of claim 2, wherein the promoter is exogenous to the plant.
4. The transgenic plant of claim 2, wherein the promoter is endogenous to the plant.
5. A seed of a transgenic plant of claim 1, wherein the seed comprises the exogenous polynucleotide.
6. A population of at least 100 plants of claim 1, growing in a field.
7. A method for enhancing the resistance of a non-Nicotiana plant to at least one species of Xanthomonas, Pseudomonas and/or Ralstonia, comprising: (a) introducing an exogenous polynucleotide encoding a polypeptide that is at least 90% identical to SEQ ID NO: 1 into a non-Nicotiana plant cell; (b) regenerating a transgenic non-Nicotiana plant from the non-Nicotiana plant cell; and (c) selecting said transgenic non-Nicotiana plant or a progeny of the same that contains the exogenous polynucleotide for resistance to Xanthomonas, Pseudomonas, and/or Ralstonia.
8. The method of claim 7, wherein the amino acid sequence of the polypeptide is at least 95% identical to the amino acid sequence of SEQ ID NO:1.
9. The method of claim 7, further comprising collecting seed from said transgenic non-Nicotiana plant or a progeny of the same that contains the exogenous polynucleotide.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The skilled artisan will understand that the drawings, described below, are for illustration purposes only. The drawings are not intended to limit the scope of the present teachings in any way.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
DEFINITIONS
(14) Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are described.
(15) All patents and publications, including all sequences disclosed within such patents and publications, referred to herein are expressly incorporated by reference.
(16) Numeric ranges are inclusive of the numbers defining the range. Unless otherwise indicated, nucleic acids are written left to right in 5′ to 3′ orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
(17) The headings provided herein are not limitations of the various aspects or embodiments of the invention. Accordingly, the terms defined immediately below are more fully defined by reference to the specification as a whole.
(18) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Singleton, et al., DICTIONARY OF MICROBIOLOGY AND MOLECULAR BIOLOGY, 2D ED., John Wiley and Sons, New York (1994), and Hale & Markham, THE HARPER COLLINS DICTIONARY OF BIOLOGY, Harper Perennial, N.Y. (1991) provide one of skill with the general meaning of many of the terms used herein. Still, certain terms are defined below for the sake of clarity and ease of reference.
(19) It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as “solely”, “only” and the like in connection with the recitation of claim elements, or the use of a “negative” limitation.
(20) As used herein, “resistance” is a relative term in that the presence of a polypeptide of the invention (i) reduces the disease symptoms of a plant comprising the gene (R (resistance) gene) that confers resistance, relative to a plant lacking the R gene, and/or (ii) reduces pathogen reproduction or spread on a plant or within a population of plants comprising the R gene and/or (iii) would act to confer resistance to a particular pathogen in the absence of other resistance mechanism(s). Resistance as used herein is relative to the “susceptible” response of a plant to the same pathogen. Typically, the presence of the R gene improves at least one production trait of a plant comprising the R gene when infected with the pathogen, such as grain yield, when compared to an isogenic plant infected with the pathogen but lacking the R gene. The isogenic plant may have some level of resistance to the pathogen, or may be classified as susceptible. Thus, the terms “resistance” and “enhanced resistance” are generally used herein interchangeably. Furthermore, a polypeptide of the invention does not necessarily confer complete pathogen resistance, for example when some symptoms still occur or there is some pathogen reproduction on infection but at a reduced amount within a plant or a population of plants. Resistance may occur at only some stages of growth of the plant, for example in adult plants (fully grown in size) and less so, or not at all, in seedlings, or at all stages of plant growth. By using a transgenic strategy to express an polypeptide in a plant, the plant of the invention can be provided with resistance throughout its growth and development Enhanced resistance can be determined by a number of methods known in the art such as analysing the plants for the amount of pathogen and/or analysing plant growth or the amount of damage or disease symptoms to a plant in the presence of the pathogen, and comparing one or more of these parameters to an isogenic plant lacking an exogenous gene encoding a polypeptide of the invention.
(21) The terms “non-Nicotiana plant” and “not a Nicotiana plant” refer to a plant that is not a member of the Nicotiana genus of herbaceous plants and shrubs also referred to as “tobacco” plants.
(22) Other definitions of terms may appear throughout the specification.
DETAILED DESCRIPTION
(23) Before the present invention is described, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
(24) Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
(25) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, some potential and preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. It is understood that the present disclosure supersedes any disclosure of an incorporated publication to the extent there is a contradiction.
(26) It must be noted that as used herein and in the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “a nucleic acid” includes a plurality of such nucleic acids and reference to “the compound” includes reference to one or more compounds and equivalents thereof known to those skilled in the art, and so forth.
(27) The practice of the present invention may employ, unless otherwise indicated, conventional techniques and descriptions of organic chemistry, polymer technology, molecular biology (including recombinant techniques), cell biology, biochemistry, and immunology, which are within the skill of the art. Such conventional techniques include polymer array synthesis, hybridization, ligation, and detection of hybridization using a label. Specific illustrations of suitable techniques can be had by reference to the example herein below. However, other equivalent conventional procedures can, of course, also be used. Such conventional techniques and descriptions can be found in standard laboratory manuals such as Genome Analysis: A Laboratory Manual Series (Vols. I-IV), Using Antibodies: A Laboratory Manual, Cells: A Laboratory Manual, PCR Primer: A Laboratory Manual, and Molecular Cloning: A Laboratory Manual (all from Cold Spring Harbor Laboratory Press), Stryer, L. (1995) Biochemistry (4th Ed.) Freeman, New York, Gait, “Oligonucleotide Synthesis: A Practical Approach” 1984, IRL Press, London, Nelson and Cox (2000), Lehninger, A., Principles of Biochemistry 3.sup.rd Ed., W. H. Freeman Pub., New York, N.Y. and Berg et al. (2002) Biochemistry, 5.sup.th Ed., W. H. Freeman Pub., New York, N.Y., all of which are herein incorporated in their entirety by reference for all purposes.
(28) The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.
(29) Provided herein is a transgenic plant comprising an exogenous polynucleotide encoding a polypeptide that is at least 80% identical to (e.g., at least 90% identical to, at least 94% identical to, at least 95% identical to, at least 98% identical to or the same as) the Nicotiana benthamiana Roq1 sequence of SEQ ID NO: 1, wherein the plant is not a Nicotiana plant.
(30) SEQ ID NO:1 provides the amino acid sequence of the Roq1 protein from Nicotiana benthamiana and is shown below. Roq1 orthologs may be found in other species and utilized herein.
(31) TABLE-US-00001 MLTSSSHHGRSYDVFLSFRGEDTRKTFVGHLFNALIEKGIHTFMDDKELK RGKSISSELMKAIGESRFAVVVFSKNYASSTWCLEELVKILEIHEKFELI VVPVFYDVDPSTVRKQNGEYAVCFTKFEANLVDDRDKVLRWREALTKVAN ISGHDLRNTYNGDESKCIQQILKDIFDKFCFSISITNRDLVGIESQIKKL SSLLRMDLKGVRLVGIWGMGGVGKTTAARALFNRYYQNFESACFLEDVKE YLQHHTLLYLQKTLLSKLLKVEFVDCTDTEEMCVILKRRLCSKKVLVVLD DVNHNDQLDKLVGAEDWFGSGSRIVITTRDMKLLKNHDVHETYEIKVLEK DEAIELFNLHAFKRSSPEKEFKELLNLVVDYTGGLPLALKVLGSLLYKED LDVWISTIDRLKDNPEGEIMATLKISFDGLRDYEKSIFLDIACFFRGYNQ RDMTALFHASGFHPVLGVKTLVEKSLIFILEDKIQMHDLMQEMGRQIAVQ ESPMRRIYRPEDVKDACIGDMRKEAIEGLLLTEPEQFEEGELEYMYSAEA LKKTRRLRILVKEYYNRGFDEPVAYLPNSLLWLEWRNYSSNSFPSNFEPS KLVYLTMKGSSIIELWNGAKRLAFLTTLDLSYCHKLIQTPDFRMITNLER LILSSCDALVEVHPSVGFLKNLILLNMDHCISLERLPAIIQSECLEVLDL NYCFNLKMFPEVERNMTHLKKLDLTSTGIRELPASIEHLSSLENLQMHSC NQLVSLPSSIWRFRNLKISECEKLGSLPEIHGNSNCTRELILKLVSIKEL PTSIGNLTSLNFLEICNCKTISSLSSSIWGLTSLTTLKLLDCRKLKNLPG IPNAINHLSGHGLQLLLTLEQPTIYERLDLLRIIDMSWCSCISSLPHNIW MLKFLRILCISYCSRLEYLPENLGHLEHLEELLADGTGILRLPSSVARLN KLEVLSERKKFAIGPKVQYSSSMLNLPDDVEGSLGSLGSVVKLNLSGNGF CNLPETMNQLFCLEYLDITFCQRLEALPELPPSIKELYVDEHLALRIMED LVIKCKELNLIAVTKIEYQNFYRWLDSIWSDVSELLENSQKQQLDDMLQL IPFSYLSTAKREEVLKIVIHGTRIPEWFRWQDRSATTMSVNLPEYWYTEN FLGFAICCSCCFYHSARSYDVEFEGSMHHYNYDSSYWKEYEEPSYDFYER DSIFITAKLTPRHKGMRTEELKKVCSFSMNVLRRATAVPNMCFAFFPFNS LCHISNLQANNPNDYGIFETCLSPGDIRHRGKQWGFNLVYKDETGGSVTH EMLINR*
(32) The transgenic plant may be monocotyledonous or dicotyledonous. Target plants include, but are not limited to, the following: cereals (for example, wheat, barley, rye, oats, rice, maize, sorghum and related crops); grapes; beet (sugar beet and fodder beet); pomes, stone fruit and soft fruit (mango, kiwi, apples, pears, plums, peaches, almonds, cherries, strawberries, raspberries and black-berries); leguminous plants (beans, lentils, peas, soybeans); oil plants (rape or other Brassicas, mustard, poppy, olives, sunflowers, safflower, flax, coconut, castor oil plants, cocoa beans, groundnuts); cucumber plants (marrows, cucumbers, melons); fibre plants (cotton, flax, hemp, jute); citrus fruit (oranges, lemons, grapefruit, mandarins); vegetables (spinach, lettuce, asparagus, cabbages, carrots, onions, tomatoes, peppers, potatoes, paprika); lauraceae (avocados, cinnamon, camphor); or plants such as maize, cassava, nuts (walnut), coffee, sugar cane, tea, vines, hops, turf, bananas and natural rubber plants, as well as ornamentals (flowers, shrubs, broad-leaved trees and evergreens, such as conifers). In many embodiments, the plant may be susceptible to infection by one or more species of Xanthomonas, Pseudomonas, Ralstonia, or another pathogen containing an effector with homology to XopQ recognized by Roq1 (e.g., one or more species of Xanthomonas and one or more species of Pseudomonas) without the exogenous polynucleotide. In some cases the plant may be a hybrid.
(33) As would be apparent, the transgenic plant has enhanced resistance to at least one species of Xanthomonas, Pseudomonas, Ralstonia, or another pathogen containing an effector with homology to XopQ which is recognized by Roq1 (e.g., one or more species of Xanthomonas and one or more species of Pseudomonas), relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide. Xanthomonas/Pseudomonas species to which the Roq1 provide resistance to include those that encode a XopQ/HopQ1 polypeptide. These polypeptides appear to be present in many pathogenic strains of Xanthomonas/Pseudomonas and, as such, Roq1 is believed to provide resistance to one or more of the bacteria listed in
(34) In some embodiments, the amino acid sequence of the polypeptide may be at least 80% identical to (e.g., 90% identical to, 94% identical to, at least 95% identical to, at least 96% identical to, at least 97% identical to, at least 98% identical to, at least 99% identical to, or 100% identical to) the amino acid sequence of a wild type Roq1 polypeptide from tobacco, e.g., a Roq1 polypeptide from N. benthamiana, N. tabacum, N. attenuata, or N. tomentosiformis (the sequences for which are available in Genbank as accession numbers ATD14363.1, XP_019226668.1, XP_009615050.1, and XP_016467297.1).
(35) Methods for making transgenic plants are very well known in the art, as are the choices for promoters and other regulatory regions (see, e.g., US20160076050, US20170218386 and US20160208279). As such, the present plants may be readily implemented by adapting any suitable method. In some embodiments, the exogenous polynucleotide is operably linked to a promoter. The promoter can be exogenous to the plant or endogenous to the plant. In some embodiments, the plant may be made by replacing a coding sequence in the genome of the plant with the exogenous polynucleotide.
(36) Also provided is a seed of a transgenic plant described above. These seeds may be made by selfing the plant or crossing the plant with another plant of the same species to produce, e.g., hybrid seed.
(37) Also provided is a population of at least 100 of the transgenic plants, e.g., at least 1,000, or at least 10,000 of the transgenic plants, growing in a field.
(38) Also provided is a method for enhancing the resistance of a non-Nicotiana plant to at least one species of Xanthomonas or Pseudomonas (e.g., one or more species of Xanthomonas and one or more species of Pseudomonas). In some embodiments, this method may comprise: (a) introducing an exogenous polynucleotide encoding a polypeptide that is at least 90% identical (e.g., at least 95%, at least 98%, or 100% identical) to the Roq1 sequence of SEQ ID NO: 1 into a plant cell that is from a plant that is susceptible to infection by Xanthomonas and/or Pseudomonas; and (b) regenerating a transgenic plant from the plant cell.
(39) In some embodiments, the amino acid sequence of the polypeptide may be at least 80% identical to (e.g., at least 90% identical to, at least 95% identical to, at least 95% identical to, at least 96% identical to, at least 97% identical to, at least 98% identical to, at least 99% identical to, or 100% identical to) the amino acid sequence of a tobacco Roq1 polypeptide, e.g., a Roq1 polypeptide from N. benthamiana, N. tabacum, N. attenuata, or N. tomentosiformis. (the sequences for which are available in Genbank as accession numbers ATD14363.1, XP_019226668.1, XP_009615050.1, and XP_016467297.1).
(40) Roq1 activity appears to require a functional and compatible NRG1 and/or EDS1 gene. As such, a functional NRG1 and/or EDS1 gene can be added to plants that do not already have a functional NRG1 and/or EDS1 gene or that contain a version of these genes which is not compatible with Roq1, in order for Roq1 to be active in immune activation.
(41) As noted above, methods for making transgenic plants are very well known in the art, as are the choices for promoters and other regulatory regions (see, e.g., US20160076050, US20170218386 and US20160208279). As such, the present plants may be readily implemented by adapting any suitable method.
EMBODIMENTS
(42) A transgenic plant comprising an exogenous polynucleotide encoding a polypeptide that is at least 80% identical to the Nicotiana benthamiana Roq1 sequence of SEQ ID NO: 1, wherein the plant is not a Nicotiana plant.
(43) The transgenic plant of any prior embodiment, wherein the plant has enhanced resistance to at least one species of Xanthomonas, Pseudomonas, Ralstonia, or another pathogen containing an effector with homology to XopQ which is recognized by Roq1 relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide.
(44) The transgenic plant of any prior embodiment, wherein the plant has enhanced resistance to at least one species of Xanthomonas and at least one species of Pseudomonas relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide.
(45) The transgenic plant of any prior embodiment, wherein the plant is a monocot.
(46) The transgenic plant of any prior embodiment, wherein the plant is a dicot.
(47) The transgenic plant of any prior embodiment, wherein the amino acid sequence of the polypeptide is at least 90% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1
(48) The transgenic plant of any prior embodiment, wherein the amino acid sequence of the polypeptide is at least 94% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1
(49) The transgenic plant of any prior embodiment, wherein the amino acid sequence of the polypeptide is at least 95% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1
(50) The transgenic plant of any prior embodiment, wherein the amino acid sequence of the polypeptide is identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1.
(51) The transgenic plant of any prior embodiment, wherein the exogenous polynucleotide is operably linked to a promoter.
(52) The transgenic plant of any prior embodiment, wherein the promoter is exogenous to the plant or wherein the promoter is endogenous to the plant.
(53) A seed of a transgenic plant of any prior embodiment.
(54) A population of at least 100 plants of any prior embodiment, growing in a field.
(55) A method for enhancing the resistance of a non-Nicotiana tobacco plant to at least one species of Xanthomonas, Pseudomonas, Ralstonia, or another pathogen containing an effector with homology to XopQ which is recognized by Roq1 (e.g., enhancing the resistance to at least one species of Xanthomonas and at least one species of Pseudomonas), comprising: (a) introducing an exogenous polynucleotide encoding a polypeptide that is at least 80% identical to the Nicotiana benthamiana Roq1 sequence of SEQ ID NO: 1 into the plant cell, wherein the plant cell is from a plant that is susceptible to infection by Xanthomonas, Pseudomonas, Ralstonia, or another pathogen containing an effector with homology to XopQ which is recognized by Roq1; and (b) regenerating a transgenic plant from the plant cell.
(56) The method of any prior method embodiment, wherein the plant has enhanced resistance to at least one species of Xanthomonas or Pseudomonas relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide.
(57) The method of any prior method embodiment, wherein the plant has enhanced resistance to at least one species of Xanthomonas and at least one species of Pseudomonas) relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide.
(58) The method of any prior method embodiment, wherein the plant is a monocot.
(59) The method of any prior method embodiment, wherein the plant is a dicot.
(60) The method of any prior method embodiment, wherein the amino acid sequence of the polypeptide is at least 90% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1.
(61) The method of any prior method embodiment, wherein the amino acid sequence of the polypeptide is at least 94% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1.
(62) The method of any prior method embodiment, wherein the amino acid sequence of the polypeptide is at least 95% identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1
(63) The method of any prior method embodiment, wherein the amino acid sequence of the polypeptide is identical to the amino acid sequence of the Nicotiana benthamiana Roq1 sequence of SEQ ID NO:1.
(64) The method of any prior method embodiment, wherein the exogenous polynucleotide is operably linked to a promoter.
(65) The method of any prior method embodiment, wherein the promoter is exogenous to the plant or wherein the promoter is endogenous to the plant.
(66) The transgenic plant, seed, or method of any prior embodiment, wherein the plant is a cereal (for example, wheat, barley, rye, oats, rice, maize, sorghum and related crops); a grape; a beet (sugar beet and fodder beet); a pome, a stone fruit and a soft fruit (mango, kiwi, apple, pear, plum, peach, almond, cherry, strawberry, raspberry and black-berry); leguminous plant (bean, lentil, pea, soybean); oil plant (rape or other Brassicas, mustard, poppy, olive, sunflower, safflower, flax, coconut, castor oil plant, cocoa bean, groundnut); cucumber plant (marrow, cucumber, melon); fibre plant (cotton, flax, hemp, jute); citrus fruit (orange, lemon, grapefruit, mandarin); a vegetable (spinach, lettuce, asparagus, cabbage, carrot, onion, tomato, pepper, potato, paprika); a lauraceae (avocado, cinnamon, camphor); or a plant such as maize, cassava, nuts (walnut), coffee, sugar cane, tea, vines, hops, turf, banana or a natural rubber plant, or an ornamental (flower, shrub, broad-leaved tree or evergreen).
(67) In any embodiment, the exogenous polynucleotide may additionally provide resistance to other pathogen species containing an effector with homology to XopQ which is recognized by Roq1, such as species of the genus Ralstonia, e.g, Ralstonia solanacearum. As such, in transgenic plant embodiments, the plant may have enhanced resistance to at least one species of Xanthomonas, at least one species of Pseudomonas and at least one species of Ralstonia, relative to a control plant that is otherwise identical to the transgenic plant but does not contain the exogenous polynucleotide
EXAMPLES
(68) Aspects of the present teachings can be further understood in light of the following examples, which should not be construed as limiting the scope of the present teachings in any way.
(69) In this study the perception pathway of XopQ in N. benthamiana was investigated. Using the CRISPR/CAS9 system (Jinek et al., 2012), a stable eds1 mutants of N. benthamiana was created which were unable to perceive XopQ/HopQ1, thereby implicating a TLR in the perception of these effectors as was recently reported (Adlung and Bonas, 2016). A reverse genetic screen was conducted using Viral Induced Gene Silencing (VIGS) of the TLRs in N. benthamiana. A single TLR was identified which is required for the perception of XopQ. Biochemical experiments suggest that this protein, named Recognition of XopQ (Roq1), directly interacts with XopQ and HopQ1. Expression of Roq1 in other plant species is sufficient to enable the perception of diverse XopQ/HopQ1/RipB alleles, suggesting this gene may be useful for engineering resistance against Xanthomonas, Pseudomonas, Ralstonia and other pathogens containing a Roq1-recognized homolog of XopQ in many different crop species.
Results
(70) Perception of XopQ depends on EDS1. The Xanthomonas effector protein XopQ and the close homolog HopQ1 from Pseudomonas have previously been shown to trigger an avirulence response in N. benthamiana, indicating the presence of an immune perception pathway capable of detecting XopQ. To test if this pathway is dependent on eds1, a growth assay using wild type Xanthomonas euvesicatoria and the XopQ knockout was performed on both N. benthamiana wild type and eds1 mutant plants. Wild type X. euvesicatoria grew approximately 100-fold more on the eds1 mutant than the wild type plants, whereas the XopQ knockout grew to similarly high levels on both the wild type and eds1 plant (
(71) Development of a fluorescence-based assay for XopQ perception. Unlike some recognized effector proteins that give a strong visible cell death response when transiently expressed, expression of XopQ in wild type N. benthamiana typically gives a mild chlorotic phenotype not well suited for a screen (
(72) Identification of a TLR required for XopQ perception. VIGS constructs were designed to target all TLR genes in N. benthamiana. Nine VIGS constructs were cloned with fragments of up to four TLRs each. In this initial screen one of the nine constructs, targeting three distinct TLRs, was found to consistently prevent perception of XopQ and allow for expression of the GFP reporter. Individual VIGS constructs were made for these three candidate genes and one was found to prevent XopQ perception (
(73) Roq1 is sufficient to allow perception of XopQ in Nicotiana sylvestris and Beta vulgaris. While highly conserved orthologs of Roq1 were identified in several other Nicotiana species including N. tabacum, N. attenuata, and N. tomentosiformis, the copy of Roq1 from N. sylvestris was found to contain an aberrant sequence disrupting the first and second exons, as well as a stop codon in a conserved part of the second exon (
(74) Roq1 co-immunoprecipitates with XopQ. The recognition of HopQ1 in N. tabacum has previously been shown to be independent of HopQ1 activity (Li et al., 2013b). It was hypothesized that Roq1 may directly interact with XopQ instead of “Guarding” a protein or molecule that is modified by this effector. To test this, a series of co-immunoprecipitation experiments in eds1-1 N. benthamiana were performed. Roq1-6×HA was found to be pulled down by both XopQ-3×Flag and HopQ1-3×Flag, but not by ATR1-3×Flag, an effector known to interact with the TLR RPP1 (
(75) Roq1 can mediate the perception of diverse proteins with homology to XopQ. Homologous alleles of XopQ, HopQ1 and RipB are widely distributed among Xanthomonas, Pseudomonas and Ralstonia species that are pathogenic on various crops. This suggests that Roq1 may be useful to engineer resistance into these crops species, but depends on Roq1 being able to recognize these diverse alleles. To sample the diversity of XopQ proteins a phylogenetic tree was generated and select XopQ and HopQ1 alleles for transient expression. Out of thirteen XopQ/HopQ1 alleles cloned, all elicited a with a Roq1-dependent immune response in N. benthamiana or N. sylvestris (
(76) Expression of Roq1 confers disease resistance against Pseudomonas syringae. With reference to
(77) Roq1 confers resistance to pathogens containing a recognized homolog of XopQ. With reference to
(78) Roq1 activity depends on EDS1 and NRG1. With reference to
Methods
(79) CAS9 mediated knockout of EDS1 and Roq1. Guides to target the N. benthamiana EDS1 and Roq1 genes were designed and cloned into entry plasmids containing the CAS9 gene and the Arabidopsis thaliana U6-26 promoter to drive guide expression. LR reactions were performed to move the guide and CAS9 cassette into a binary vector which was used for stable transformation into N. benthamiana by Agrobacterium co-cultivation. Transformed plants were genotyped by PCR and Sanger sequencing, and homozygous knockout lines were obtained from the T1 generation
(80) Viral Induced Gene Silencing. Target TLR genes from N. benthamaiana were identified using a BLAST search of a transcript database (Nakasugi et al., 2013). The predicted protein sequences of identified genes were aligned and manually curated to remove gene fragments and pseudogenes. Candidate TLRs were targeted for silencing by cloning approximately 300 bp into the TRV2 VIGS vector (Liu et al., 2002) using restriction ligation cloning with the enzyme BsaI. The plasmids were transformed into Agrobacterium tumefaciens strain GV3101 and infiltrated into N. benthamiana plants along with TRV1 at an OD.sub.600 of 0.2 each. The plants were infiltrated at 4-6 weeks of age and phenotyped 2-4 weeks after infiltration.
(81) GFP-reporter assay for XopQ perception. Agrobacterium harboring the vectors pICH2011, pICH14011, and pICH7410 (Marillonnet et al., 2005) was mixed to a final OD.sub.600 of 0.05 each along with an Agrobacterium strain for transient expression of XopQ at an OD.sub.600 of 0.3. The mixture was infiltrated into leaf tissue and imaged under long-wave UV light to visualize GFP expression.
(82) Growth assay. To assay bacterial growth, Xanthomonas was grown overnight in NYG (0.5% peptone, 0.3% yeast extract, 2% glycerol) with 100 μg/mL rifampcin on a shaker at 30° C. The cultures were spun down at 10,000 g, washed once with 10 mM MgCl.sub.2, and infiltrated into leaf tissue at OD.sub.600=0.0001. Leaf punches were collected at 6 days post infiltration, homogenized, and serially diluted before plating on NYG agar plates with 100 μg/mL rifampcin and 50 μg/mL cycloheximide Colonies were counted 3-4 days after plating.
(83) Transient expression using Agrobacterium. Agrobacterium cultures were grown overnight in LB with selection at 30° C. on a shaker. Cells were pelleted by centrifugation at 10,000 g and resuspended in infiltration buffer (10 mM MgCl.sub.2, 10 mM MES pH 5.6). The cells were diluted to the appropriate OD.sub.600 and infiltrated into leaf tissue using a needleless syringe.
(84) Plant material and bacteria strains. Nicotiana sylvestris was obtained from Select Seeds Co. in Union, Conn. USA (“Woodland Tobacco 346”). Nicotiana tabacum and Beta vulgaris “Detroit Dark Red, Morse's Strain” (Plantation Products, Norton Mass., USA) were used for transient expression. X. euvesicatoria 85-10 and X. gardneri 153 were used for pathogen assays. The X. euvesicatoria 85-10 ΔXopQ knockout was constructed previously (Schwartz et al., 2015). Agrobacterium tumefaciens strains GV3101 and C58C1 were used for transient expression and VIGS.
(85) XopQ knockout in X. gardneri. 1000 bp regions upstream and downstream of the XopQ coding sequence were cloned into the pLVC18 plasmid (Lindgren et al., 1986) containing a SacB counter-selectable marker. This plasmid was conjugated into X. gardneri and single crossover events were selected for by tetracycline resistance (10 μg/mL) and PCR. Colonies were plated onto NYG media containing 5% sucrose to select for a second crossover event and screened by PCR to identify XopQ deletion strains.
(86) Co-immunoprecipitation assay. Each tissue sample (0.5 g) was ground with mortar and pestle to a homogeneous powder in liquid nitrogen. The samples were suspended in 1 mL of the protein extraction buffer (50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 0.1% Triton X-100, 0.2% Nonidet P-40, 6 mM β-mercaptoethanol, 1× protease inhibitor cocktail). Samples were centrifuged twice (10 min, 14,000 rpm, 4° C.). The supernatant was then transferred to a new tube with 10 μL Flag beads (A2220, Sigma) and incubated at 4° C. for 3 hours. The samples were centrifuged (1 min, 1,000 g) then washed three times with 1 mL of the protein extraction buffer. The protein was eluted by boiling for 5 min in 50 μl of 3× Laemmli buffer, centrifuged and loaded for Western blot. For the anti-Flag Western, the primary antibody was F7425 (Sigma) and the secondary antibody was A0545 (Sigma).
DISCUSSION
(87) Mechanism of Roq1 recognition of XopQ. Co-immunoprecipitation experiments showed that Roq1 can interact with either XopQ/HopQ1 as determined by immunoprecipitation after transient co-expression in N. benthamiana (
(88) Distribution and specificity of Roq1. The Roq1 gene is highly conserved in several Nicotiana species but was not detected in any species outside this genus. This suggests that Roq1 evolved within the Nicotiana lineage and is consistent with the previous observation that XopQ failed to elicit an immune response when expressed in non-Nicotiana species (Adlung and Bonas, 2016). The wide distribution and high conservation of XopQ homologs in Xanthomonas, Pseudomonas and other pathogens may be a consequence of the narrow distribution of the Roq1 gene. The observation that co-expression of Roq1 with various XopQ homologs can elicit a Roq1-dependent immune response indicates that Roq1 is able to recognize the different homologs despite the various amino acid differences (
(89) Use of Roq1 to confer resistance against pathogens with homologs of XopQ. Because Roq1 is able to recognize diverse XopQ homologs (
REFERENCES
(90) Adlung, N., and Bonas, U. (2016). Non-host Resistance Induced by the Xanthomonas Effector XopQ Is Widespread within the Genus Nicotiana and Functionally Depends on EDS1. Front. Plant Sci. 7. Adlung, N., and Bonas, U. (2017). Dissecting virulence function from recognition—cell death suppression in Nicotiana benthamiana by XopQ/HopQ1-family effectors relies on EDS1-dependent immunity. Plant J. 38:42-49. Alfano, J. R., and Collmer, A. (2004). Type III secretion system effector proteins: double agents in bacterial disease and plant defense. Annu. Rev. Phytopathol. 42:385-414. Block, A., Li, G., Fu, Z. Q., and Alfano, J. R. (2008). Phytopathogen type III effector weaponry and their plant targets. Curr. Opin. Plant Biol. 11:396-403. Chisholm, S. T., Coaker, G., Day, B., and Staskawicz, B. J. (2006). Host-microbe interactions: Shaping the evolution of the plant immune response. Cell 124:803-814. Dangl, J. L., Horvath, D. M., and Staskawicz, B. J. (2013). Pivoting the Plant Immune System from Dissection to Deployment 563:7931-7935. Gupta, M. K., Nathawat, R., Sinha, D., Hague, A. S., Sankaranarayanan, R., and Sonti, R. V (2015). Mutations in the Predicted Active Site of Xanthomonas oryzae pv. oryzae XopQ Differentially Affect Virulence, Suppression of Host Innate Immunity, and Induction of the HR in a Nonhost Plant. Mol Plant-Microbe Interact. 28:195-206. Gürlebeck, D., Thieme, F., and Bonas, U. (2006). Type III effector proteins from the plant pathogen Xanthomonas and their role in the interaction with the host plant. J. Plant Physiol. 163:233-55. Hann, D. R., Dominguez-Ferreras, A., Motyka, V., Dobrev, P. I., Schornack, S., Jehle, A., Felix, G., Chinchilla, D., Rathjen, J. P., and Boller, T. (2014). The Pseudomonas type III effector HopQ1 activates cytokinin signaling and interferes with plant innate immunity. New Phytol. 201:585-598. Jinek, M., Chylinski, K., Fonfara, I., Hauer, M., Doudna, J. A., and Charpentier, E. (2012). A Programmable Dual-RNA—Guided 337:816-822. Jones, J. D. G., and Dangl, J. L. (2006). The plant immune system. Nature 444:323-329. Jones, J. D. G., Witek, K., Verweij, W., Jupe, F., Cooke, D., Dorling, S., Tomlinson, L., Smoker, M., Perkins, S., and Foster, S. (2014). Elevating crop disease resistance with cloned genes. Philos. Trans. R. Soc. B Biol. Sci. 369:20130087-20130087. Jones, J. D. G., Vance, R. E., and Dangl, J. L. (2016). Intracellular innate immune surveillance devices in plants and animals. Science (80-.). 354:aaf6395. Krasileva, K. V., Dahlbeck, D., and Staskawicz, B. J. (2010). Activation of an Arabidopsis Resistance Protein Is Specified by the in Planta Association of Its Leucine-Rich Repeat Domain with the Cognate Oomycete Effector. Plant Cell 22:2444-2458. Li, W., Yadeta, K. A., Elmore, J. M., and Coaker, G. (2013a). The Pseudomonas syringae effector HopQ1 promotes bacterial virulence and interacts with tomato 14-3-3 proteins in a phosphorylation-dependent manner. Plant Physiol. 161:2062-74. Li, W., Chiang, Y. H., and Coaker, G. (2013b). The HopQ1 Effector's Nucleoside Hydrolase-Like Domain Is Required for Bacterial Virulence in Arabidopsis and Tomato, but Not Host Recognition in Tobacco. PLoS One 8:1-9. Lindgren, P. B., Peet, R. C., and Panopoulos, N. J. (1986). Gene cluster of Pseudomonas syringae pv. “phaseolicola” controls pathogenicity of bean plants and hypersensitivity of nonhost plants. J. Bacteriol. 168:512-522. Liu, Y., Schiff, M., Marathe, R., and Dinesh-Kumar, S. P. (2002). Tobacco Rar1, EDS1 and NPR1/NIM1 like genes are required for N-mediated resistance to tobacco mosaic virus. Plant J. 30:415-429. Marillonnet, S., Thoeringer, C., Kandzia, R., Klimyuk, V., and Gleba, Y. (2005). Systemic Agrobacterium tumefaciens-mediated transfection of viral replicons for efficient transient expression in plants. Nat. Biotechnol. 23:718-23. Nakasugi, K., Crowhurst, R. N., Bally, J., Wood, C. C., Hellens, R. P., and Waterhouse, P. M. (2013). De Novo Transcriptome Sequence Assembly and Analysis of RNA Silencing Genes of Nicotiana benthamiana. PLoS One 8:e59534. Oerke, E.-C. (2005). Crop losses to pests. J. Agric. Sci. 144:31. Oh, C.-S., Pedley, K. F., and Martin, G. B. (2010). Tomato 14-3-3 protein 7 positively regulates immunity-associated programmed cell death by enhancing protein abundance and signaling ability of MAPKKKα. Plant Cell 22:260-272. Peart, J. R., Mestre, P., Lu, R., Malcuit, I., and Baulcombe, D. C. (2005). NRG1, a CC-NB-LRR protein, together with N, a TIR-NB-LRR protein, mediates resistance against tobacco mosaic virus. Curr. Biol. 15:968-973. Qi, T., Schultink, A., Pham, J., Cho, M.-J., and Staskawicz, B. (2018). NRG1 is required for the function of the TIR-NLR immune receptors Roq1 and RPP1 in Nicotiana benthamiana. Biorxiv Advance Access published 2018, doi:10.1101/284471. Rodriguez-Moreno, L., Song, Y., and Thomma, B. P. (2017). Transfer and engineering of immune receptors to improve recognition capacities in crops. Curr. Opin. Plant Biol. 38:42-49. Rossier, O., Wengelnik, K., Hahn, K., and Bonas, U. (1999). The Xanthomonas Hrp type III system secretes proteins from plant and mammalian bacterial pathogens. Pnas 96:9368-9373. Schwartz, A. R., Potnis, N., Timilsina, S., Wilson, M., Patane, J., Martins, J., Minsavage, G. V., Dahlbeck, D., Akhunova, A., Almeida, N., et al. (2015). Phylogenomics of Xanthomonas field strains infecting pepper and tomato reveals diversity in effector repertoires and identifies determinants of host specificity. Front. Microbiol. 6:535. Shirasu, K. (2009). The HSP90-SGT1 chaperone complex for NLR immune sensors. Annu. Rev. Plant Biol. 60:139-164. Sinha, D., Gupta, M. K., Patel, H. K., Ranjan, A., and Sonti, R. V. (2013). Cell Wall Degrading Enzyme Induced Rice Innate Immune Responses Are Suppressed by the Type 3 Secretion System Effectors XopN, XopQ, XopX and XopZ of Xanthomonas oryzae pv. oryzae. PLoS One 8:1-19. Teper, D., Salomon, D., Sunitha, S., Kim, J. G., Mudgett, M. B., and Sessa, G. (2014). Xanthomonas euvesicatoria type III effector XopQ interacts with tomato and pepper 14-3-3 isoforms to suppress effector-triggered immunity. Plant J. 77:297-309. Toruño, T. Y., Stergiopoulos, I., and Coaker, G. (2016). Plant-Pathogen Effectors: Cellular Probes Interfering with Plant Defenses in Spatial and Temporal Manners. Annu. Rev. Phytopathol. 54:419-441. Vincelli, P. (2016). Genetic engineering and sustainable crop disease management: Opportunities for case-by-case decision-making Sustain. 8. Wei, C.-F., Kvitko, B. H., Shimizu, R., Crabill, E., Alfano, J. R., Lin, N.-C., Martin, G. B., Huang, H.-C., and Collmer, A. (2007). A Pseudomonas syringae pv. tomato DC3000 mutant lacking the type III effector HopQ1-1 is able to cause disease in the model plant Nicotiana benthamiana. Plant J. 51:32-46. Wiermer, M., Feys, B. J., and Parker, J. E. (2005). Plant immunity: The EDS1 regulatory node. Curr. Opin. Plant Biol. 8:383-389. Wu, C.-H., Belhaj, K., Bozkurt, T. O., and Kamoun, S. (2016). The NLR helper protein NRC3 but not NRC1 is required for Pto-mediated cell death in Nicotiana benthamiana. New Phytol. 209:1344-1352. Wulff, B. B. H., Horvath, D. M., and Ward, E. R. (2011). Improving immunity in crops: New tactics in an old game. Curr. Opin. Plant Biol. 14:468-476. Yu, S., Hwang, I., and Rhee, S. (2014). The crystal structure of type III effector protein XopQ from Xanthomonas oryzae complexed with adenosine diphosphate ribose. Proteins 82:2910-4.
(91) Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it is readily apparent to those of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.