COMPOSITIONS COMPRISING SUPRAMOLECULAR NANOFIBER HIV ENVELOPES AND METHODS FOR THEIR USE
20220040290 · 2022-02-10
Inventors
- Sallie PERMAR (Durham, NC, US)
- Joel COLLIER (Durham, NC, US)
- Kevin O. SAUNDERS (Durham, NC, US)
- Chelsea FRIES (Durham, NC, US)
- Fouda Amou'ou Genevieve GINY (Durham, NC, US)
Cpc classification
B82Y5/00
PERFORMING OPERATIONS; TRANSPORTING
A61K2039/64
HUMAN NECESSITIES
A61K39/21
HUMAN NECESSITIES
C12N2740/16134
CHEMISTRY; METALLURGY
A61K47/646
HUMAN NECESSITIES
International classification
Abstract
The technology provides immunogenic compositions comprising HIV-1 envelopes in supramolecular nanofiber complexes, which may also comprise a T-cell helper epitopes, and methods of using these compositions for induction of immune responses.
Claims
1. An immunogenic composition comprising a nanofiber complex composition, wherein the composition comprises a β-sheet nanofiber structure comprising a plurality of β-sheet peptides, and at least one compound linked to at least one of the β-sheet peptides, and wherein the compound is an HIV-1 envelope such as gp120, gp140, or a stabilized trimer.
2. The immunogenic composition of claim 1 wherein the at least one compound is linked to at least one of the β-sheet peptides via any suitable linker.
3. The composition of claim 1 or 2, wherein the compound is gp120 HIV-1 envelope 1086.C.
4. The composition of claim 1 or 2, wherein the compound is an HIV-1 envelope trimer.
5. The composition of any of the preceding claims, wherein the plurality of β-sheet peptides comprises a plurality of self-assembling peptides.
6. The composition of any of the preceding claims, wherein the β-sheet peptide is Q11.
7. The composition of any of the preceding claims, wherein the nanofiber complex composition further comprises a T-cell epitope peptide.
8. The composition of any of the preceding claims, wherein the nanofiber complex composition further comprises the PADRE peptide.
9. The composition of any one of the preceding claims further comprising an adjuvant.
10. A method of inducing an immune response in a subject, comprising administering to the subject any one of the compositions of claim 1-9 in an amount suitable to effect such induction.
11. The method of claim 10 further comprising administering an adjuvant.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0048] The patent or application file contains at least one drawing executed in color.
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
DETAILED DESCRIPTION
[0081] Some of the challenges of development of HIV vaccine include: extended diversity of the HIV-1 population; difficulty at inducing broadly neutralizing antibodies (bnAbs) through vaccination. BnAbs can neutralize most of the HIV strains; where passive immunization with bnAbs protects non-human primates from infection. (R. Shibata et al., 1999); BnAbs are only found in 10-50% HIV+ patients years after infection. (P. Hraber et al., 2014), currently no vaccine has been able to induce bnAbs in human or in animal models.
[0082] A pediatric vaccine against HIV would have a significant clinical impact, because more than 150,000 infants are infected with HIV every year globally, despite the availability of antiretroviral drugs to prevent mother-to-child transmission. Antiretroviral (ARV) interventions fall short via a number of mechanisms, including poor maternal adherence, fetal/infant toxicities, acute maternal infection during pregnancy and breastfeeding, transmission of drug-resistant strains of virus, and an inherent residual risk of transmission even in mothers on optimal ARV regimens. These limitations of ARV strategies have revealed that development of a pediatric vaccine against HIV will be required to eliminate mother-to-child transmission. Moreover, there is also a critical need for preventive measures to reduce adolescent HIV infections that occur following sexual debut. A pediatric HIV vaccine that offers protection in infancy and durable protective immunity through sexual debut could significantly reduce both infant and adolescent HIV infections.
[0083] The infant immune system poses challenges for vaccination but represents an excellent opportunity for developing molecularly engineered vaccines. In particular, the neonatal immune system is limited by a reduced ability to provide T-cell help, which results in poor somatic hypermutation of antibodies and inadequate antibody affinity. In addition, induction of long-term immunity following infant immunization usually requires several vaccine boosts. Surprisingly, recent studies have indicated that HIV gp120 vaccinated children develop higher magnitude and more durable antibody responses compared to the same vaccine regimen in adults. Moreover, HIV-infected children develop neutralization breadth earlier than adults, suggesting that it may be easier for a vaccine to elicit this type of response in children than in adults. Yet, there have been no HIV vaccine approaches specifically developed for the infant immune system. Immunization with native-like HIV envelope constructs constitutes a leading strategy for elicitation of neutralization breadth, but despite advances in stabilization and production of native-like HIV-1 trimers over the last decade, typical vaccination strategies with HIV-1 Envelope SOSIP trimer products have been disappointing in their ability to raise broad and potent virus-neutralizing activity. Novel vaccine approaches are therefore critically needed in order to achieve persistent, effective anti-HIV antibody responses and broad virus neutralization.
[0084] We have recently developed a supramolecular peptide nanofiber-vaccine platform (Q11) that can provide durable antibody responses with tunable titers. To address the limitations of the early life immune system and improve the immunogenicity of HIV envelope trimers, we propose to utilize this novel multivalent supramolecular nanofiber vaccine platform to design an engineered vaccine containing 1) optimized quantities of a synthetic T-helper epitope (PADRE) and 2) multimeric scaffolded SOSIP Env trimers of the HIV-1 transmitted/founder envelope CH505. In certain embodiments, the PADRE-nanofiber conjugated HIV-1 CH505 SOSIP trimer vaccine (P-Q11 CH505 trimer) will enhance the magnitude and potency of tier 2 virus neutralization responses in small animal and infant non-human primate (NHP) models, and will be protective against homologous SHIV challenge in an infant NHP challenge model.
[0085] In certain aspects, the invention provides methods to develop and assess the antigenicity a supramolecular nanofiber-based PADRE-scaffolded CH505 SOSIP HIV-1 Env trimer. In certain embodiments, the antigenicity of CH505 SOSIP HIV Env trimer is preserved in the nanofiber platform.
[0086] In certain aspects, the invention provides methods to define the immunogenicity of the P-Q11CH505 trimer vaccine in neonatal rabbits and infant rhesus macaques in comparison to that of CH505 SOSIP Env trimer alone. In certain embodiments, the P-Q11CH505 trimer vaccine will elicit a higher magnitude of antibodies than CH505 SOSIP Env trimer alone, including tier 2 virus neutralization and non-neutralizing effector antibody responses.
[0087] In certain aspects, the invention provides methods to determine the ability of the P-Q11CH505 trimer vaccine to protect against low dose oral SHIV challenge in an infant nonhuman primate model of late postnatal transmission via breastfeeding. In certain aspects, the invention provides that infant rhesus monkeys immunized with the P-Q11CH505 trimer vaccine will be protected against infection following low dose SHIV oral challenge as compared to unvaccinated animals.
[0088] This novel pediatric HIV vaccine strategy could overcome the challenges of infant vaccination, while taking advantage of the immunologic and practical benefits of early life immunization. Notably, the addition of T-cell epitopes will stimulate neonatal T-cell responses to provide the T cell help require to drive affinity maturation and tier 2 neutralizing antibody development; while the nanofiber platform will yield durable B-cell responses. Importantly, because this vaccine system is fully synthetic and modular, it has manufacturability advantages over other vaccine platforms and it can be systemically optimized for diverse immunization settings.
[0089] Multivalency is critical in activating B cells—because of BCR cross-linking.
[0090] In certain embodiments, multivalent antigen presentation on ferritin-based HIV vaccines increases the neutralization against heterologous strains. (K. Sliepen et al., “Presenting native-like HIV-1 envelope trimers on ferritin nanoparticles improves their immunogenicity” Retrovirology volume 12, Article number: 82 (2015)). In some embodiments, in the ferritin system the number of antigen presented is limited, and it could be difficult to control the stoichiometry of antigens or epitopes. In certain aspects, the invention provides engineered vaccine which overcome the major challenges of HIV vaccine development. In certain aspects, the invention provides nanofiber compositions comprising HIV-1 envelopes.
[0091] In certain aspects the invention provides Q11 based nanofiber compositions comprising HIV-1 envelopes. In certain aspects the invention provides a Q11 nanofiber a vaccine platform that induces more potent humoral responses than unconjugated gp120. In certain aspects the invention provides that a gp120-Q11 immunogen leads to increase anti-gp120 antibody magnitude and breadth of responses. In certain aspects, the invention provides that Q11-conjugated gp120 induces higher antibody magnitude than vaccine with gp120 alone. In certain aspects the invention provides that Q11-conjugated gp120 induces can increase the antibody response in the presence of adjuvant. In certain aspects the invention provides that gp120-Q11 induced even higher antibody magnitude in the presence of STR8S-C adjuvant. In certain aspects, the invention provides that the gp120 density on Q11 affect the antibody response. In certain aspects, the invention provides that higher density of gp120 on Q11 fibers induced higher antibody response. In certain embodiments, the invention provides that CD4 T cell epitopes can be easily added onto gp120-Q11 nanofibers. In certain aspects, the invention provide that additional CD4+ T cell epitopes on gp120-Q11 can increase the magnitude and avidity of anti-gp120 antibodies.
[0092] In certain aspects the invention provides that Q11-conjugated gp120 increases the antibody magnitude and binding breadth; that innate immunity activated by TLR7/8 and TLR9 agonist augments the effect of Q11 nanofibers; recruitment of T cell help by PADRE-Q11 induces rapid humoral response at early stage.
[0093] In certain aspects, the invention provides that multivalency is important for the elevated antibody response induced by gp120-Q11---gp120-Q11 with different gp120 density.
[0094] Nanofiber complex technology is disclosed in U.S. Pat. No. 9,200,082, and references #23 and #24 in Example 1, which contents are herein incorporated by reference in their entirety. Non-limiting embodiments of optimized chemistry and linkers used in the conjugation of the gp120 envelopes are disclosed in Example 1 and 1A, Example 2 and Example 3.
[0095] Self assemblies which can be modular, self-adjuvanating, and/or define are described in the art. These include but are not limited to: beta-sheet nanofibers; peptide polymer gels, helical fibrillar assemblies, assembling proteins, peptide amphiphiles, etc. See e.g. Hudalla et al., Nature Materials 13: 829-36 (2014), Rudra et al., PNAS, 107:622-7 (2010), Wen et al., ACS Nano, in press (2017), Rudra et al., Biomaterials 31:8475 (2010), Chen et al., Biomaterials 34:8776 (2013), Pompano et al., Adv Healthc Mater 3:1898 (2014), Wen et al., Curr Opin Immunol. 35:73 (2015), Trent A et al., AAPS J, 17:380 (2015), Black M et al., Adv Mater 24:3845 (2012), U.S. Pat. No. 9,200,082. Fibrilixing peptides are also known: peptide epitope-QQKFQFQFEQQ. These can form chemically defined nanofibers. Coil29 system is an example of a alpha-helical nanofibers. See e.g. E. H. Egelman et. al, Structure 2015, 23, 280, Y. Wu et al., ACS Biomater Sci&Eng 2017, 3, 3128, which contents are herein incorporated by reference in their entirety
[0096] Supramolecular assemblies are self-adjuvanting. See e.g. Rudra J S et al., PNAS, 107:622-7 (2010), Rudra et al., ACS Nano 6(2) 1557 (2012); Wen et al., ACS Nano, 10(10) 9274-9286 (2017); Rudra et al., Biomaterials, 33(27), 6476 (2012); Chen et al., Biomaterials, 34(34), 8776 (2013); Pompano et al, Adv Healthc Mater 3(11), 1898 (2014); Vigneswaran et al., JBMR A 104, 1853 (2016); U.S. Pat. No. 9,200,082, which contents are herein incorporated by reference in their entirety.
[0097] Peptide nanofibers raise durable antibody responses. See e.g. Y. Wu et al., ACS Biomater Sci & Eng 2017, 3, 3128. Peptide assemblies are non-inflammatory. See e.g. J. Chen, R. Pompano et al. Biomaterials, 2013 34, 8776; Pompano et al, Adv Healthc Mater 2014 3(11), 1898. An example is the use in Anti-TNF immunotherapy. See e.g. Mora Solano et al., Biomaterials 2017 149, 1-11. Adjustable titers could be based on nanofiber content. Mora Solano et al., Biomaterials 2017 149 1-11, which contents are herein incorporated by reference in their entirety.
[0098] The invention is directed to compositions comprising a supramolecular vaccine for HIV, its use and methods of making such.
[0099] Sequences/Clones
[0100] In certain embodiments, the envelope is gp120 envelope 1086.C. See e.g. US Publication 20140248301 which discloses a gp140 design of this sequence. The gp120 design of the envelope 1086.C. In certain embodiments, the envelope is trimer based on CH505 T/F see instant Example 1 and
[0101] Described herein are nucleic and amino acids sequences of HIV-1 envelopes. The sequences for use as immunogens are in any suitable form. In certain embodiments, the described HIV-1 envelope sequences are gp160s. In certain embodiments, the described HIV-1 envelope sequences are gp120s. Other sequences, for example but not limited to stable SOSIP trimer designs, gp145s, gp140s, both cleaved and uncleaved, gp140 Envs with the deletion of the cleavage (C) site, fusion (F) and immunodominant (I) region in gp41—named as gp140ΔCFI (gp140CFI), gp140 Envs with the deletion of only the cleavage (C) site and fusion (F) domain—named as gp140ΔCF (gp140CF), gp140 Envs with the deletion of only the cleavage (C)—named gp140ΔC (gp140C) (See e.g. Liao et al. Virology 2006, 353, 268-282), gp150s, gp41s, which are readily derived from the nucleic acid and amino acid gp160 sequences. In certain embodiments the nucleic acid sequences are codon optimized for optimal expression in a host cell, for example a mammalian cell, a rBCG cell or any other suitable expression system.
[0102] An HIV-1 envelope has various structurally defined fragments/forms: gp160; gp140—including cleaved gp140 and uncleaved gp140 (gp140C), gp140CF, or gp140CFI; gp120 and gp41. A skilled artisan appreciates that these fragments/forms are defined not necessarily by their crystal structure, but by their design and bounds within the full length of the gp160 envelope. While the specific consecutive amino acid sequences of envelopes from different strains are different, the bounds and design of these forms are well known and characterized in the art.
[0103] For example, it is well known in the art that during its transport to the cell surface, the gp160 polypeptide is processed and proteolytically cleaved to gp120 and gp41 proteins. Cleavages of gp160 to gp120 and gp41 occurs at a conserved cleavage site “REKR.” See Chakrabarti et al. Journal of Virology vol. 76, pp. 5357-5368 (2002) see for example
[0104] The role of the furin cleavage site was well understood both in terms of improving cleave efficiency, see Binley et al. supra, and eliminating cleavage, see Bosch and Pawlita, Virology 64 (5):2337-2344 (1990); Guo et al. Virology 174: 217-224 (1990); McCune et al. Cell 53:55-67 (1988); Liao et al. J Virol. April; 87(8):4185-201 (2013).
[0105] Likewise, the design of gp140 envelope forms is also well known in the art, along with the various specific changes which give rise to the gp140C (uncleaved envelope), gp140CF and gp140CFI forms. Envelope gp140 forms are designed by introducing a stop codon within the gp41 sequence. See Chakrabarti et al. at
[0106] Envelope gp140C refers to a gp140 HIV-1 envelope design with a functional deletion of the cleavage (C) site, so that the gp140 envelope is not cleaved at the furin cleavage site. The specification describes cleaved and uncleaved forms, and various furin cleavage site modifications that prevent envelope cleavage are known in the art. In some embodiments of the gp140C form, two of the R residues in and near the furin cleavage site are changed to E, e.g., RRVVEREKR is changed to ERVVEREKE, and is one example of an uncleaved gp140 form. Another example is the gp140C form which has the REKR site changed to SEKS. See supra for references.
[0107] Envelope gp140CF refers to a gp140 HIV-1 envelope design with a deletion of the cleavage (C) site and fusion (F) region. Envelope gp140CFI refers to a gp140 HIV-1 envelope design with a deletion of the cleavage (C) site, fusion (F) and immunodominant (I) region in gp41. See Chakrabarti et al. Journal of Virology vol. 76, pp. 5357-5368 (2002) see for example
[0108] In certain embodiments, the envelope design in accordance with the present invention involves deletion of residues (e.g., 5-11, 5, 6, 7, 8, 9, 10, or 11 amino acids) at the N-terminus. For delta N-terminal design, amino acid residues ranging from 4 residues or even fewer to 14 residues or even more are deleted. These residues are between the maturation (signal peptide, usually ending with CX, X can be any amino acid) and “VPVXXXX . . . ”. In case of CH505 T/F Env as an example, 8 amino acids (italicized and underlined in the below sequence) were deleted: MRVMGIQRNYPQWWIWSMLGFWMLMICNGMWVTVYYGVPVWKEAKTTLFCASDA KAYEKEVHNVWATHACVPTDPNPQE . . . (rest of envelope sequence is indicated as “ . . . ”). In other embodiments, the delta N-design described for CH505 T/F envelope can be used to make delta N-designs of other CH505 envelopes. In certain embodiments, the invention relates generally to an immunogen, gp160, gp120 or gp140, without an N-terminal Herpes Simplex gD tag substituted for amino acids of the N-terminus of gp120, with an HIV leader sequence (or other leader sequence), and without the original about 4 to about 25, for example 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 amino acids of the N-terminus of the envelope (e.g. gp120). See WO2013/006688, e.g. at pages 10-12, the contents of which publication is hereby incorporated by reference in its entirety.
[0109] The general strategy of deletion of N-terminal amino acids of envelopes results in proteins, for example gp120s, expressed in mammalian cells that are primarily monomeric, as opposed to dimeric, and, therefore, solves the production and scalability problem of commercial gp120 Env vaccine production. In other embodiments, the amino acid deletions at the N-terminus result in increased immunogenicity of the envelopes.
[0110] It is readily understood that the envelope glycoproteins referenced in various examples and figures comprise a signal/leader sequence. It is well known in the art that HIV-1 envelope glycoprotein is a secretory protein with a signal or leader peptide sequence that is removed during processing and recombinant expression (without removal of the signal peptide, the protein is not secreted). See for example Li et al. Control of expression, glycosylation, and secretion of HIV-1 gp120 by homologous and heterologous signal sequences. Virology 204(1):266-78 (1994) (“Li et al. 1994”), at first paragraph, and Li et al. Effects of inefficient cleavage of the signal sequence of HIV-1 gp120 on its association with calnexin, folding, and intracellular transport. PNAS 93:9606-9611 (1996) (“Li et al. 1996”), at 9609. Any suitable signal sequence could be used. In some embodiments the leader sequence is the endogenous leader sequence. Most of the gp120 and gp160 amino acid sequences include the endogenous leader sequence. In other non-limiting examples, the leader sequence is human Tissue Plasminogen Activator (TPA) sequence, human CD5 leader sequence (e.g. MPMGSLQPLATLYLLGMLVASVLA). Most of the chimeric designs include CD5 leader sequence. A skilled artisan appreciates that when used as immunogens, and for example when recombinantly produced, the amino acid sequences of these proteins do not comprise the leader peptide sequences.
[0111] Any suitable HIV-1 envelope, in any envelope design, could be conjugated to Q11 fibers. In certain embodiments, the envelope is conjugated using sortase A reaction.
[0112] The immunogenic compositions can be administered in any suitable regiment for prime and boost. Such regimens could comprise administering of any other suitable HIV-1 immunogen. In certain embodiments, the immunogenic compositions are administered to infants or young adults.
[0113] Dosing of proteins and nucleic acids can be readily determined by a skilled artisan. A single dose of nucleic acid can range from a few nanograms (ng) to a few micrograms (g) or milligram of a single immunogenic nucleic acid. Recombinant protein dose can range from a few g micrograms to a few hundred micrograms, or milligrams of a single immunogenic polypeptide.
[0114] Administration: The compositions can be formulated with appropriate carriers using known techniques to yield compositions suitable for various routes of administration. In certain embodiments the compositions are delivered via intramuscular (IM), via subcutaneous, via intravenous, via nasal, via mucosal routes, or any other suitable route of immunization.
[0115] The compositions can be formulated with appropriate carriers and adjuvants using techniques to yield compositions suitable for immunization. The compositions can include an adjuvant, such as, for example but not limited to, alum, poly IC, MF-59 or other squalene-based adjuvant, ASOIB, or other liposomal based adjuvant suitable for protein or nucleic acid immunization. In certain embodiments, the adjuvant is GSK AS01E adjuvant containing MPL and QS21. This adjuvant has been shown by GSK to be as potent as the similar adjuvant AS01B but to be less reactogenic using HBsAg as vaccine antigen. In certain embodiments, TLR agonists are used as adjuvants. In other embodiment, adjuvants which break immune tolerance are included in the immunogenic compositions.
Example 1
[0116] A vaccine is critically needed to eliminate pediatric HIV and generate protective HIV immunity prior to sexual debut. Pediatric HIV continues to be a public health concern in middle and low income countries, and despite the availability of antiretroviral drugs (ARV), more than 150,000 infants become infected through mother-to-child transmission every year (1). ARV interventions fall short via a number of mechanisms, including poor maternal adherence, acute maternal infection during pregnancy and breastfeeding, transmission of drug-resistant strains of virus, and an inherent residual risk of transmission even in mothers who receive ARV (2-5). In addition, the number of new HIV infections among adolescent girls and young women in sub-Saharan Africa remains exceptionally high: in 2015, 450,000 young women (aged 15-24 years) became infected with HIV (1, 6), and young women have three times more infections than their male counterparts. A pediatric HIV vaccine that offers protection in infancy and durable protective immunity prior to sexual debut could significantly reduce infant, adolescent, and life-long HIV infections.
[0117] Immunization in early life has to overcome limitations of the infant immune system including: 1) a reduced ability to provide T-cell help, which results in poor somatic hypermutation (SHM) of antibodies and inadequate antibody affinity, and 2) the need for several vaccine boosts to achieve durable immunity (reviewed in (7)). Because of these known limitations, it is generally thought that infants are not a suitable target population for HIV vaccine development. Nevertheless, in several settings, infants have been reported to develop comparable or higher immune responses than adults following vaccination. Notably, we have recently reported that infants immunized with a MF59 adjuvanted HIV gp120 vaccine developed higher magnitude antibody responses than adults immunized with the same vaccine, whereas comparable responses were observed between adults and infants immunized with an Alum adjuvanted HIV vaccine (8). Thus, our results suggest that adjuvants differently modulate immune responses in adults and infants. Similarly, recent studies have demonstrated that the response of newborn immune cells to most candidate adjuvants is functionally distinct from that of adults (reviewed in (9)). As vaccine strategies will benefit from being tailored to the early-life immune system, young children represent an important population for the development of molecularly engineered HIV vaccine approaches.
[0118] A major goal for HIV immunization is the induction of antibodies capable of neutralizing the majority of circulating viruses. These broadly neutralizing antibodies (bnAbs) emerge in approximately 20 to 30% of HIV-1 infected adults several years after infection (10-12), but have proven difficult to elicit by vaccination. This may be partially due to the fact that antibodies elicited by Env protein vaccination tend to bind poorly to the Env trimer at epitopes associated with bnAbs. It is therefore believed that immunization with native like Env trimers may be required for bnAb induction. Studies investigating the ability of Env trimers to induce neutralizing antibody responses have found that some constructs are able to induce tier 1 and autologous tier 2 neutralization, but infrequent heterologous tier 2 neutralization in rabbits and guinea pigs and to a lesser extend in rhesus macaques (13). Interestingly, our team recently observed infrequent, low to moderate levels of tier 2 neutralization in rabbits immunized with a stabilized CH505 transmitted/founder SOSIP trimer (14). Thus, improvements on the current Env trimer-based immunization strategies are likely to be required in order to achieve neutralization breadth.
[0119] While current knowledge on neutralization breadth development in the setting of natural infection is mostly based on adult studies, recent studies have indicated that HIV-infected children may develop neutralization breadth earlier than adults. Milligan, Overbaugh et al., studied the development of cross-clade neutralization in 28 HIV infected children. They found that 20/28 children developed cross-clade neutralization, some as early as one year post infection (15). Similarly, Muenchhoff et al. reported that the frequency of broad neutralizers is higher among chronically HIV-infected children than in chronically infected adults (16). Interestingly, neutralization breadth in HIV-infected children is mediated by polyclonal antibodies (17), in contrast to adults in whom plasma neutralization is usually predominantly mediated by antibodies of one or two specificities (18). Moreover, pediatric bnAbs may have lower levels of somatic hypermutation than adult bnAbs from the same specificity with comparable breadth (19). Overall these data suggest that it could be easier to elicit neutralization breadth by vaccination in children than in adults and highlight the need to test these vaccine strategies in pediatric populations.
[0120] In certain aspects, the invention provides a multivalent supramolecular nanofiber vaccine platform to enhance vaccine responses. A supramolecular peptide nanofiber vaccine platform, Q11, that can provide durable antibody responses with tunable titers has been developed. We have previously shown that this system can elicit remarkably durable antibody responses of up to one year following a simple prime-boost regimen (20, 21), owing to the material's delayed degradation and extreme multivalency. We have also published strategies for installing and tuning the T-helper epitope content using the modular self-assembly afforded by the platform (22, 23), and have shown that the platform can function in the absence of additional adjuvants (21, 24). Because components of the vaccine spontaneously assemble into higher-order architectures in aqueous solutions, formulations can be readily modified without having to repeat chemical synthesis as is necessary for covalently constructed biomaterials (25). While supramolecular materials are receiving increasing interest for the design of vaccines and other active immunotherapies against infectious diseases such as influenza (24), MRSA (22), and malaria (20), they had not yet been used in the context of HIV vaccination. In preliminary experiments, we assessed the immunogenicity of a nanofiber-conjugated gp120 subunit vaccine in adult C57BL6 mice. The nanofiber subunit vaccine induced higher magnitude Env-specific antibodies than gp120 alone. Moreover, co-expression of gp120 with a synthetic T-Cell epitope (PADRE) on the nanofiber-led to a faster and more robustly binding antibody response. Thus, Q11 constitutes a versatile, potent, and engineerable vaccine platform that can be systematically adapted for specific immunologic settings.
[0121] Therefore, there is a critical need (1) for a pediatric HIV vaccine to protect against both breast milk transmission and adolescent sexual transmission; and (2) HIV Env trimer immunization platforms to achieve broad neutralization. Because the early-life immune system may be more amenable to the development of neutralization breadth than the adult immune system, such strategy should ideally be tested in the setting of early-life immunity. Without being bound by theory, the supramolecular nanofiber vaccine platform presents several advantages including 1) induction of long-lived immune responses; 2) antigenic persistence which could drive the maturation of the immune response through SHM; and 3) incorporation of a dominant T cell epitope that could help overcome the described poor T cell help in infants and contribute to the development of bnAb responses. We therefore propose to design a supramolecular nanofiber conjugated HIV SOSIP trimer vaccine (P-Q11 CH505 trimer) and then test its immunogenicity/efficacy in infant animal models (
[0122] In certain aspects, invention provides a supramolecular nanofiber Q11 vaccine platform for use with HIV immunogens. The vaccine platform itself has recently been developed (22, 24). The Q11 self-assembling peptide system has been explored as the basis for vaccines and immunotherapies in mouse models for a variety of diseases and conditions, including malaria (20), influenza (24, 26), bacterial infections (22), and chronic inflammation (23), and was shown to be capable of raising durable, high-titer antibody responses and T-cell responses against a variety of antigens without requiring additional adjuvant. However, the Q11 platform has not yet been explored for the design of a HIV vaccine.
[0123] In certain aspects, the invention provides the first primate immunogenicity assessment of this vaccine platform. It will be the first time that this supramolecular peptide vaccine will be tested in primates. The proposed work thus represents a critical test of the concept that supramolecular peptide vaccines can be immunogenic in higher order species.
[0124] In certain aspects, the invention provides s scaffolded, multimeric, and self-adjuvanted native-like trimer design to build on the moderate success of native trimer immunogens. A stabilized CH505 TF ch.SOSIP trimer antigen has been developed. In this work will develop bioconjugation techniques to attach this antigen to supramolecular peptide nanofibers, and in some embodiments to deliver it in the context of a global CD4+ T cell epitope (PADRE).
[0125] In certain aspects, the invention provides a modular and tunable nature of the Q11 vaccine platform. Because each of the supramolecular construct's components can be individually synthesized and combined in precise and tunable stoichiometries, and because the supramolecular assemblies are nanofibers hundreds of nanometers long, we will be able to optimize the antigen loading and T-helper epitope content across a wide range, in addition to optimizing the dose, boosting regimen, and adjuvant. Such tunability is not common among vaccine platforms, making the Q11 platform and our approach for optimizing it inventive.
[0126] In certain aspects, the invention provides, design and preclinical development of an HIV vaccine for the early-life immune system. Despite known differences in the adult and the infant immune system, HIV vaccine candidates have been routinely tested in adult preclinical studies and only a handful are eventually tested in pediatric settings. Our approach of designing a vaccine construct to specifically overcome known limitations of the early-life immune system and to first testing this construct preclinically in infants.
[0127] In certain aspects, the invention provides designs of a molecularly engineered pediatric HIV vaccine based on CH505 SOSIP HIV-1 Env trimer.
[0128] In certain aspects, the invention provides methods to develop and assess the antigenicity a supramolecular nanofiber-based PADRE-scaffolded CH505 SOSIP HIV-1 Env trimer.
[0129] In certain embodiments, the invention incorporates the Q11 system of fibrillizing peptides and the optimized envelope designs, including but not limited to CH505 SOSIP HIV-1 Env trimers. Without being bound by theory, the hypothesis is that combining these components will preserve the antigenicity of the CH505 SOSIP trimer and provide a vaccine capable of raising durable antibody responses in infant macaques. Our proposed work will represent the first trial of the Q11 vaccine system in primates, providing not only a critical proof-of-concept that a supramolecular form of the SOSIP trimer can improve antibody titers and durability, but also a demonstration that the Q11 platform is immunogenic in primates, which could be applied to vaccines for other diseases in follow-on work.
[0130] The Q11 system is composed of a short synthetic peptide, one embodiment is QQKFQFQFEQQ. When dissolved in water and subsequently added to buffered saline or fluids such as cell culture media or interstitial fluid, the peptide assembles into nanofibers containing hundreds to thousands of individual peptides (
[0131] We have recently designed a stabilized CH505 TF ch.SOSIP trimer targeting the germline of CH103, a CD4 binding site bnAb identified in an HIV-infected patient that developed broadly-neutralizing activity (32). Initial attempts to express a CH505 TF SOSIP found it to be unstable resulting in very little trimeric envelope protein (33). To improve trimer formation, a chimeric SOSIP (ch.SOSIP) was designed, in which the CH505 TF gp120 was used to replace the gp120 sequence of BG505 SOSIP (
[0132] Previous strategies for multimerizing SOSIP Env trimers have been successful but limited in their multivalency. The B cell receptor recognizes and internalizes low-affinity antigens at a greater magnitude when the low-affinity antigen is presented as a multimeric particle as opposed to monomeric protein in solution (35). In vivo, the multimerization of HIV-1 Env has improved neutralizing antibody titers in rabbits (36) and monkeys (37). We have developed methods for expressing and purifying the CH505 Env trimers as multimers using ferritin nanoparticles. Purification of SOSIP gp140-ferritin fusion proteins can be complicated by the presence of well-folded and poorly-folded trimeric Env on the same nanoparticle, so we developed a two-step ferritin assembly process where we first purified well-folded SOSIP gp140 trimers and separately purified ferritin nanoparticles. We then covalently linked the SOSIP to ferritin via short sortase-A linker peptides (
[0133] In certain aspects, the invention provides method for designing and producing a supramolecular SOSIP trimer vaccine. We will develop a supramolecular nanofiber vaccine by conjugating the previously optimized stabilized SOSIP trimer to self-assembled Q11 peptide nanofibers using sortase-A conjugation (synthesis scheme in
[0134] In certain aspects, the invention provides methods for testing the antigenicity of supramolecular Env vaccines. We have synthesized a simplified version of our proposed multimeric vaccine, tested its antigenicity, and studied its immunogenicity in mice. Briefly, we synthesized Q11, Q11 terminated with a single cysteine residue, and PADRE-Q11; co-assembled them into nanofibers; and conjugated the cysteine thiol side chain to amines in gp120 using SMCC, an amine-reactive and thiol-reactive heterobifunctional crosslinker. We optimized various linker lengths, linker chemistries, and reaction stoichiometries to achieve efficient nanofiber conjugation of the gp120 while preserving its antigenicity. Using the monoclonal antibodies VRC01, B12, CH58, and CH22 we assessed the antigenicity of key sites of the protein by ELISA. We progressively improved protein antigenicity such that the optimized formulation (
[0135] Sortase-A bioconjugation was used to link the SOSIP Env-1 trimer to other nanoparticles such as ferritin. Without being bound by theory, there is a possibility that this process will be hindered by the presence of the peptide nanofiber. If poor conjugation is observed, we have a number of options for recourse. First, given that the Q11 peptide is fully synthetic, we could produce new peptides with longer or more hydrophilic linker sequences between the assembly domain and the sortase A linker peptide. Second, we have already shown that heterobifunctional crosslinkers can be used to attach monomeric gp120 to Q11 nanofibers, and that this strategy retains good immunogenicity of the antigen (
[0136] Provided are studies to define the immunogenicity of the P-Q11CH505 trimer vaccine in neonatal rabbits and infant rhesus macaques in comparison to that of CH505 SOSIP Env trimer alone
[0137] The nanofiber vaccine platform that we propose to use in this study may help overcome some of the limitations of the early-life immune system yet capitalize on some of its advantages towards developing bnAbs. While this platform has been used for different applications in the mouse model, it has not yet been tested for immunogenicity in primates. We therefore propose to first test the modular Q11 vaccine constructs in rabbits and then confirm immunogenicity in infant rhesus macaques. We selected rabbits as the small animal model to down-select vaccine constructs because: 1) Adequate volume of blood can be collected for diverse immune measurement; 2) Rabbits are a well described model in HIV vaccine development, 3) Immunization with native-like Env constructs have been demonstrated to induce autologous tier 2 neutralization in rabbits, but not in mice; 4) our group has previous experience working with infant rabbits (see
[0138] In certain aspects, the invention provides that immunization of adult mice with a gp120 nanofiber conjugated vaccine enhances antibody responses. We immunized C57BL6 adult mice (n=5) subcutaneously at week 0, 2, 5 and 11 with 50 μg of 1086.c gp120 conjugated to Q11 nanofiber (gp120-Q11) or with 1086.c gp120 alone. After the first 3 vaccines doses, gp120-Q11 induced higher antibody responses than gp120 alone (
[0139] This experiment exemplifies the modularity of the Q11 self-assembling peptide nanofiber as a vaccine platform for HIV. As the critical type(s) of immune response required for protection against HIV infection remain elusive, this modular feature renders Q11-nanofibers amenable for shaping the immune response against HIV antigens to target immune correlates as they are identified.
[0140] Elicitation of autologous and tier 2 neutralizing antibodies by CH505 SOSIP immunization in rabbits was reported previously (14). A stabilized CH505 TF SOSIP forms trimers and is antigenic for the UCA antibody of the CD4 binding site (CD4bs) CH103 bnAb lineage. The immunogenicity of the CH505 TF SOSIP trimer was tested in adult rabbits (14). Briefly, rabbits were immunized with either the unstabilized (E64/A316) or the stabilized (E64K/A316W) CH505 TF ch.SOSIP 4 weeks apart for a total of 6 vaccine doses. None of the rabbits immunized with the unstabilized CH505 TF ch.SOSIP developed autologous tier 2 neutralizing antibodies whereas 6 of 8 (75%) rabbits immunized with the stabilized SOSIP neutralized the autologous tier 2 CH505 TF virus (
[0141] Contemplated are various immunogenicity studies in any suitable animal model. In non-limiting embodiments, the animals are rabbits.
[0142] Rabbit immunization schedule: Three groups of 8 neonatal rabbits will be immunized at 1, 4, 7, 10 and 13 weeks (
[0143] Adjuvant and protein dose selection. STR8-SC is a squalene-based adjuvant containing oligoCpG as well as the TLR 7/8 agonist R848 (39). This adjuvant was selected because 1) previous work has demonstrated that TLR 7/8 and to a lesser extend other TLR agonists enhance immune responses in human and non-human primate neonates (9, 40); and 2) Previous data has indicated that while rabbit poorly respond to TLR7/8 agonists (41), they respond well to other TLR agonists; 3) the squalene-based MF59 adjuvant induced stronger Env-specific antibody responses than Alum following gp120 infant immunization (42) and 4) comparison of TLR agonist adjuvants in rhesus monkeys showed that STR8-SC induced the highest titers of binding and functional antibodies following HIV Env immunization (39). Animals will be immunized with a dose of 15 μg of protein. This dose was selected because 1) this dose was found to be optimal to induce Env-specific antibody responses in infants immunized with a MF59-adjuvanted HIV vaccine (42) and immunization of infant rabbits (
[0144] Binding antibody responses to CH505 SOSIP trimer immunization in rabbits. The magnitude of the binding antibody response will be measured in the vaccine groups by capture ELISA as previously described (44). A polyclonal HIV-specific rabbit IgG reagent purified from a pool of plasma from HIV vaccinated rabbits (BIVIG) will be used as positive control. The avidity of the Env-specific antibodies will be measured as a surrogate for affinity maturation two weeks after each immunization. A single dilution of plasma selected based on the results from the titration experiment will be tested for binding to CH505 Env in the presence or in the absence of urea. The avidity index will then be calculated using the equation
Finally, we will use a binding antibody multiplex assay (BAMA) to define the breadth and epitope specificity of the vaccine elicited antibodies. The breadth will be assessed using a panel of cross-clade HIV Env glycoproteins whereas the epitope specificity will be assessed using peptide and Env constructs. In addition, we will measure the ability of the rabbit sera to inhibit the binding of bnAbs of known specificity (including bnAbs against the CD4 binding site, and against V1V2/V3 glycan-dependent epitopes) in a blocking ELISA.
[0145] Measurement of functional antibody responses. One goal with this immunization strategy is to induce tier 2 neutralizing antibodies. We will therefore assess neutralizing antibodies using the TZM-bl assay against a panel of tier 2 viruses including the autologous HIV CH505 T/F virus and 4 heterologous tier 2 viruses. Neutralization of a control virus (SVA. MLV) will also be assessed to define non-specific neutralization activity. The primary time point for assessment of neutralizing antibody responses will be at necropsy because 1) the full immunization regimen may be required to induce the neutralizing antibodies and 2) we will have sufficient volume of blood to test activity against multiple virus strains. If neutralization is detected at the necropsy time point, we will assess previous timepoints to define when these neutralizing antibodies first developed. The epitope specificity of the autologous and heterologous neutralizing antibodies will be mapped using virus with mutations that abrogate the activity of known bnAbs using methods and assays known in the art. In addition to neutralization, we will also measure non-neutralizing antibodies because these responses have been linked to protection in the RV144 vaccine trial (45, 46) and NHP vaccine studies (47-49). Moreover, although sequential immunization with a DNA prime/CH505 gp120 boost vaccine did not induce broad neutralizing antibody responses in rhesus monkeys, this regimen was able to protect 67% of adult monkeys SHIV mucosal challenge, suggesting that protection was mediated by non-neutralizing antibodies. We will measure the ability of the vaccine-elicited antibodies to bind to HIV infected cells and mediate antibody dependent cell-mediated cytotoxicity (ADCC). In addition, we will assess the binding of vaccine-elicited antibodies to FcRs using a previously described multiplex assay (50). Our group has recently used this assay to compare effector function responses in rabbits and rhesus macaques immunized with the same HIV vaccine (
[0146] Immunogenicity study in infant rhesus macaques. We will conduct a pilot study in infant rhesus macaques to evaluate the immunogenicity of the best vaccine regimen from the rabbit immunization study. Selection of the P-Q11 trimer immunization regimen in rabbit studies will be based on primary criterion: P-Q11-CH505 trimer construct that induces the highest frequency/magnitude of tier 2 (autologous and heterologous neutralization) in rabbits, and secondary criteria 1-Highest magnitude of binding antibody responses, 2-Elicitation of non-neutralizing functional antibodies. In certain embodiments, a regimen will be defined as the P-Q11 CH505 trimer formulation that elicits the highest frequency/magnitude of tier 2 neutralization in rabbits. If there is no difference in the ability to elicit tier 2 neutralization between the regimens, additional criteria including magnitude of binding response and elicitation of non-neutralizing functional antibodies will also be taken into account. Six dam-reared infant macaques will be immunized at week 0, 6, 12, 18 and 24 (
[0147] Measurement of binding and functional antibody responses in infant rhesus macaques. We will assess the ability of the nanofiber vaccine to induce HIV Env specific binding antibodies by capture ELISA using an HRP conjugated anti-monkey secondary antibody. A polyclonal preparation of IgG purified from HIV vaccinated rhesus monkeys (RIVIG) will be used as standard. We will also map the epitope specificity and define the breadth of the vaccine-elicited antibodies by BAMA. In addition, we assess the binding of the vaccine-elicited antibodies to FcRs and measure non-neutralizing antibodies responses including binding to HIV infected cells and ADCC. Finally, to assess the induction of bnAb B cell lineage, we will measure plasma neutralization against autologous and heterologous tier 2 viruses after completion of the vaccine regimen and map the specificity of the detected neutralizing antibodies. We will also evaluate the ability of plasma from vaccinated animals to block the binding of bnAbs to the CH505 trimer by ELISA and measure HIV Env-specific B cells by flow cytometry.
[0148] Measurement of vaccine-elicited T follicular helper (Tfh) cells. As T cell help is critical for the induction of durable HIV-specific antibody responses, and for the affinity maturation required for neutralization breadth development, we will assess the ability of the CH505-Q11 PADRE vaccine to elicit robust T cell responses. The frequency of Tfh cells will be measured in the lymph nodes of the vaccinated infant rhesus macaque one week after the third and fifth immunization. Env-specific T follicular helper (Tfh) cell responses will be assessed using the Activation-Induced Marker (AIM) assay, in which antigen-specific Tfh cells upregulate surface markers, including OX40, CD25, and CD137 following incubation with antigen proteins and/or peptide pools (52). Additionally, we will characterize the phenotype of Tfh cells by flow cytometry using specific markers that indicate their underlying function. For example FoxP3 expression identifies Tfh, the regulatory subset of Tfh cells (53), whereas CXCR3.sup.+ CCR6.sup.− Tfh cells exhibit a Th1 phenotype, CXCR3.sup.− CCR6.sup.+ Tfh exhibit a Th17 phenotype, and CXCR3.sup.− CCR6.sup.− Tfh cells exhibit a Th2 phenotype (54). We will also measure vaccine-induced CD4+ and CD8+ T cell responses in peripheral blood and lymphoid tissues by intracellular cytokine staining.
[0149] Statistical analysis and power calculation. The statistical analysis will be done by the DHVI biostatistical unit. Our primary outcome in the rabbit study will be to compare vaccine-elicited immune responses between each of the P-Q11 CH505 trimer constructs and CH505 trimer alone. Based on previous data, with a sample size of 8 subjects and a standard deviation of log 2 titer of 1.3, a one tailed Wilcoxon test will provide 83.8% power to detect a 4.5-fold difference in autologous neutralization titers between the groups. The type-I error rate used is 0.0167, which includes a multiplicity adjustment of the nominal value of a 0.05 to allow for three multiple simultaneous hypothesis testing. Wilcoxon rank tests will be used to compare the three vaccine groups with the control group using Benjamini-Hochberg procedure to control the false discover rate. The pilot study in infant rhesus macaques is descriptive and is not powered for statistical analysis. Both female and male rabbits and rhesus macaque infants will be included in the immunogenicity studies. Rabbit studies will be performed with 4 animals per group per experiment, and then repeated once to make groups of 8, to avoid batch effects and assess repeatability. All assays will be conducted in duplicate, and generated data will be quality controlled using assay-specific criteria developed within each laboratory by lab staff that are blinded to the vaccination groups. Assays that fail pre-established QC will be repeated, and QC summaries will be generated to include data about potential repeats and the reason for repeat. Only data that pass QC will be reported. All materials will come from primary vendors or tested prior to use.
[0150] We expect that the immunogenicity of CH505 SOSIP-Q11 will superior to that of the CH505 SOSIP alone in rabbits and that we will be able to select a PADRE concentration for maximal elicitation of robust binding antibody responses and tier 2 neutralization. We also expect that P-Q11 CH 505 trimer will be immunogenic in infant rhesus macaques. These were defined taking into account previous results from immunization of adult rabbits with the stabilized CH505 SOSIP trimer (14).
[0151] The described assays are used in our laboratories and we do not anticipate difficulties in performing the proposed work. We propose to immunize the animals with five vaccine doses as rabbits demonstrated tier 2 neutralization after 2 to 4 immunizations in previous studies (14). If we do not achieve tier 2 neutralization titers, we will consider adding an additional boost. Finally, our study is limited by the lack of available reagents to define Tfh cells in rabbits. Thus, we will only be able to measure Tfh responses in non-human primates, but we will consider measuring T cell responses in rabbits by ELISPOT.
[0152] In certain aspects, the invention provides methods to determine the ability of the P-Q11CH505 trimer vaccine to protect against low dose oral SHIV challenge in an infant nonhuman primate model of late postnatal transmission via breastfeeding.
[0153] The ultimate approach to define if a vaccine strategy is potentially protective is to do a challenge study. Because our primary goal is to protect pediatric populations against breast milk transmission shortly after birth, but also elicit immunity that could be protective against sexual transmission at sexual debut, we propose to use an infant rhesus macaque oral challenge model using the recently engineered autologous SHIV CH505 (55). Our group has extensive experience with infant oral SHIV challenge models including with SHIV CH505 ((56), and
[0154] Development of the SHIV CH505 infant macaque oral challenge model. In order to model breast milk transmission, six infant rhesus macaques were challenged orally with SHIV CH505, beginning at 4 weeks of age. Initially, infants were challenged three times per day with a bottle feeding for 5 days with SHIV.C.CH505 at a dose of 5.1×10.sup.5 TCID.sub.50/day until infected. After three weeks, only one infant became infected, and the remaining five infants were subsequently challenged weekly under sedation at a dose of 6.8×10.sup.5 TCID.sub.50 until infected. After three weekly challenges, only one infant remained uninfected and thus was subsequently challenged at increasing doses of 1.3×10.sup.6, followed by 3.4×10.sup.6 TCID.sub.50 until infected (
[0155] Infant Rhesus Macaque Challenge Study Design
[0156] Two groups of 10 infant rhesus macaques will be utilized in this study with equal numbers of male and female animals included in each group. See
[0157] Measurement of immune responses pre- and post-virus exposure. Binding and functional antibody responses will be measured in the vaccinated animals at time points prior to virus exposure (week 2, 8, 14, 20 and 26) as described herein. In addition, we will assess the same antibody responses time points after challenge in vaccinated and controls animals who became infected as well as in protected vaccinated animals. Similarly, antigen-specific CD4+ and CD8+ T cell responses will be measured in peripheral blood and lymph nodes of vaccinated animals prior to virus exposure. We will also measure antigen-specific Tfh cells in lymph nodes as described in section C.2.3.2.2. In addition, we will define the activation phenotype of total CD4+ T cell in vaccinated and control animals at different time points prior to and following virus exposure as we previously observed an association between levels of activated CD4+ T cells prior to challenge and number of challenges required to infect infant rhesus macaques following oral SHIV exposure (56), (
[0158] Statistical analysis and power calculation. Our primary outcome in this aim will be to assess the efficacy of P-Q11 CH505 trimer vaccine in infant macaques. We calculated the power for a Kaplan-Meier logrank test difference between the control and vaccine group under the following assumptions: the number of challenges to infection was assumed to be between 3-5 for the control group and between 6-15 for the vaccine group, at one side α=0.05 and N=10 per group. There is 80.8% power to detect a logrank difference when the median number of challenges to get infection in the control group is 3 and that in the treatment group is 11. Kaplan Meyer curves will be used to compare SHIV acquisition between the groups. We will use log rank test to compare the vaccine effect on number of challenges to infection at significance level of 0.05. In addition, we will do exploratory analysis using Benjamini-Hochberg procedure controlling the false discover rate. Moreover, we will fit a cox model using the proportion of activated CD4+ T cells as a predictor to predict the number of challenges to infection, and as a covariate to compare the vaccine effect.
[0159] Expected outcomes and potential future studies. If our hypothesis is correct, the number of vaccinated infant macaques who become infected will be significantly lower than the number of uninfected infant macaques who acquire infection. If it is the case, we will conduct an immune correlate analysis to identify immune factors that contributed to vaccine protection. In addition, if our strategy is able to induce tier 2 neutralizing antibodies, we will considered evaluating the B cell repertoire of the vaccinated animals to understand how neutralization breadth developed (57).
[0160] SHIV CH505 was selected as the challenge virus because 1) in this proof of concept study, we want to test the vaccine in an autologous virus challenge model. If successful, the vaccine strategy could subsequently be tested in a heterologous SHIV challenge model; and 2) we have previous experience working with this virus. Nevertheless, it is worth noting that while SHIV CH505 challenge results in a high peak virus load, some animals are able to control the virus spontaneously (see
REFERENCES FOR EXAMPLE 1
[0161] 1. World Health Organization. Global health sector strategy on HIV/AIDS 2000-2015: focus on innovations in Africa: progress report. Geneva, Switzerland: World Health Organization; 2015. Available from: apps.who.int/iris/bitstream/10665/198065/1/9789241509824_eng.pdf?ua=1. [0162] 2. Kesho Bora Study G, de Vincenzi I. Triple antiretroviral compared with zidovudine and single-dose nevirapine prophylaxis during pregnancy and breastfeeding for prevention of mother-to-child transmission of HIV-1 (Kesho Bora study): a randomised controlled trial. Lancet Infect Dis. 2011; 11(3):171-80. [0163] 3. Shapiro R L, Hughes M D, Ogwu A, Kitch D, Lockman S, Moffat C, et al. Antiretroviral regimens in pregnancy and breast-feeding in Botswana. N Engl J Med. 2010; 362(24):2282-94. [0164] 4. Lehman D A, Chung M H, John-Stewart G C, Richardson B A, Kiarie J, Kinuthia J, et al. HIV-1 persists in breast milk cells despite antiretroviral treatment to prevent mother-to-child transmission. AIDS. 2008; 22(12):1475-85. [0165] 5. Slyker J A, Chung M H, Lehman D A, Kiarie J, Kinuthia J, Holte S, et al. Incidence and correlates of HIV-1 RNA detection in the breast milk of women receiving HAART for the prevention of HIV-1 transmission. PLoS One. 2012; 7(1):e29777. [0166] 6. UNAIDS. HIV prevention among adolescent girls and young women. 2016. [0167] 7. PrabhuDas M, Adkins B, Gans H, King C, Levy O, Ramilo O, et al. Challenges in infant immunity: implications for responses to infection and vaccines. Nat Immunol. 2011; 12(3):189-94. [0168] 8. McGuire E P, Fong Y, Toote C, Cunningham C K, McFarland E J, Borkowsky W, et al. HIV-Exposed Infants Vaccinated with an MF59/Recombinant gp120 Vaccine Have Higher-Magnitude Anti-V1V2 IgG Responses than Adults Immunized with the Same Vaccine. J Virol. 2018; 92(1). [0169] 9. Dowling D J, Levy O. Ontogeny of early life immunity. Trends Immunol. 2014; 35(7):299-310. [0170] 10. Gray E S, Madiga M C, Hermanus T, Moore P L, Wibmer C K, Tumba N L, et al. The neutralization breadth of HIV-1 develops incrementally over four years and is associated with CD4+ T cell decline and high viral load during acute infection. J Virol. 2011; 85(10):4828-40. [0171] 11. Hraber P, Seaman M S, Bailer R T, Mascola J R, Montefiori D C, Korber B T. Prevalence of broadly neutralizing antibody responses during chronic HIV-1 infection. AIDS. 2014; 28(2):163-9. [0172] 12. Mikell I, Sather D N, Kalams S A, Altfeld M, Alter G, Stamatatos L. Characteristics of the earliest cross-neutralizing antibody response to HIV-1. PLoS Pathog. 2011; 7(1):e1001251. [0173] 13. Sanders R W, Moore J P. Native-like Env trimers as a platform for HIV-1 vaccine design. Immunol Rev. 2017; 275(1):161-82. [0174] 14. Saunders K O, Verkoczy L K, Jiang C, Zhang J, Parks R, Chen H, et al. Vaccine Induction of Heterologous Tier 2 HIV-1 Neutralizing Antibodies in Animal Models. Cell Rep. 2017; 21(13):3681-90. [0175] 15. Goo L, Chohan V, Nduati R, Overbaugh J. Early development of broadly neutralizing antibodies in HIV-1-infected infants. Nat Med. 2014; 20(6):655-8. [0176] 16. Muenchhoff M, Adland E, Karimanzira O, Crowther C, Pace M, Csala A, et al. Nonprogressing HIV-infected children share fundamental immunological features of nonpathogenic SIV infection. Sci Transl Med. 2016; 8(358):358ra125. [0177] 17. Ditse Z, Muenchhoff M, Adland E, Jooste P, Goulder P, Moore P L, et al. Hiv-1 Subtype C Infected Children with Exceptional Neutralization Breadth Exhibit Polyclonal Responses Targeting Known Epitopes. J Virol. 2018. [0178] 18. Walker L M, Simek M D, Priddy F, Gach J S, Wagner D, Zwick M B, et al. A limited number of antibody specificities mediate broad and potent serum neutralization in selected HIV-1 infected individuals. PLoS Pathog. 2010; 6(8):e1001028. [0179] 19. Simonich C A, Williams K L, Verkerke H P, Williams J A, Nduati R, Lee K K, et al. HIV-1 Neutralizing Antibodies with Limited Hypermutation from an Infant. Cell. 2016; 166(1):77-87. [0180] 20. Rudra J S, Sun T, Bird K C, Daniels M D, Gasiorowski J Z, Chong A S, et al. Modulating adaptive immune responses to peptide self-assemblies. ACS Nano. 2012; 6(2):1557-64. [0181] 21. Rudra J S, Tian Y F, Jung J P, Collier J H. A self-assembling peptide acting as an immune adjuvant. Proc Natl Acad Sci USA. 2010; 107(2):622-7. [0182] 22. Pompano R R, Chen J, Verbus E A, Han H, Fridman A, McNeely T, et al. Titrating T-cell epitopes within self-assembled vaccines optimizes CD4+ helper T cell and antibody outputs. Adv Healthc Mater. 2014; 3(11):1898-908. [0183] 23. Mora-Solano C, Wen Y, Han H, Chen J, Chong A S, Miller M L, et al. Active immunotherapy for TNF-mediated inflammation using self-assembled peptide nanofibers. Biomaterials. 2017; 149:1-11. [0184] 24. Chen J, Pompano R R, Santiago F W, Maillat L, Sciammas R, Sun T, et al. The use of self-adjuvanting nanofiber vaccines to elicit high-affinity B cell responses to peptide antigens without inflammation. Biomaterials. 2013; 34(34):8776-85. [0185] 25. Wen Y, Waltman A, Han H, Collier J H. Switching the Immunogenicity of Peptide Assemblies Using Surface Properties. ACS Nano. 2016. [0186] 26. Si Y, Wen Y, Kelly S H, Chong A S, Collier J H. Intranasal delivery of adjuvant-free peptide nanofibers elicits resident CD8(+) T cell responses. J Control Release. 2018; 282:120-30. [0187] 27. Jung J P M J, Collier J H. Multifactorial optimization of endothelial cell growth using modular synthetic extracellular matrices. Integr Biol (Camb) 2011 March; 3(3):185-96 doi: 101039/c0ib00112k Epub 2011 Jan. 19, 2011. [0188] 28. Jung J P N A, Fox E K, Rudra J S, Devgun J M, Collier J H. Co-assembling peptides as defined matrices for endothelial cells. Biomaterials 2009; April; 30(12):2400-10. doi: 10.1016/j.biomaterials.2009.01.033. Epub 2009 Feb. 8. [0189] 29. Hudalla G A, Sun T, Gasiorowski J Z, Han H, Tian Y F, Chong A S, et al. Gradated assembly of multiple proteins into supramolecular nanomaterials. Nat Mater. 2014; 13(8):829-36. [0190] 30. Hudalla G A M J, Tian Y F, Rudra J S, Chong A S, Sun T, Mrksich M, Collier J H. A self-adjuvanting supramolecular vaccine carrying a folded protein antigen. Adv Healthc Mater. 2013; 2(8:1114-9. doi: 10.002/adhm.201200435. Epub 2013 Feb. 25. [0191] 31. Mora-Solano C W Y, Han H, Chen J, Chong A S, Miller M L, Pompano R R, Collier J H. Active immunotherapy for TNF-mediated inflammation using self-assembled peptide nanofibers. Biomaterials 149:1-11 doi: 101016/jbiomaterials201709031 Epub 2017 Sep. 26 2017. [0192] 32. Gao F, Bonsignori M, Liao H X, Kumar A, Xia S M, Lu X, et al. Cooperation of B cell lineages in induction of HIV-1-broadly neutralizing antibodies. Cell. 2014; 158(3):481-91. [0193] 33. Zhou T, Doria-Rose N A, Cheng C, Stewart-Jones G B E, Chuang G Y, Chambers M, et al. Quantification of the Impact of the HIV-1-Glycan Shield on Antibody Elicitation. Cell Rep. 2017; 19(4):719-32. [0194] 34. de Taeye S W, Ozorowski G, Torrents de la Pena A, Guttman M, Julien J P, van den Kerkhof T L, et al. Immunogenicity of Stabilized HIV-1 Envelope Trimers with Reduced Exposure of Non-neutralizing Epitopes. Cell. 2015; 163(7):1702-15. [0195] 35. Batista F D, Neuberger M S. B cells extract and present immobilized antigen: implications for affinity discrimination. EMBO J. 2000; 19(4):513-20. [0196] 36. Ingale J, Stano A, Guenaga J, Sharma S K, Nemazee D, Zwick M B, et al. High-Density Array of Well-Ordered HIV-1 Spikes on Synthetic Liposomal Nanoparticles Efficiently Activate B Cells. Cell Rep. 2016; 15(9):1986-99. [0197] 37. Martinez-Murillo P, Tran K, Guenaga J, Lindgren G, Adori M, Feng Y, et al. Particulate Array of Well-Ordered HIV Clade C Env Trimers Elicits Neutralizing Antibodies that Display a Unique V2 Cap Approach. Immunity. 2017; 46(5):804-17 e7. [0198] 38. Solano C M, Wen Y, Han H, Collier J H. Practical Considerations in the Design and Use of Immunologically Active Fibrillar Peptide Assemblies. Methods Mol Biol. 2018; 1777:233-48. [0199] 39. Moody M A, Santra S, Vandergrift N A, Sutherland L L, Gurley T C, Drinker M S, et al. Toll-like receptor 7/8 (TLR7/8) and TLR9 agonists cooperate to enhance HIV-1 envelope antibody responses in rhesus macaques. J Virol. 2014; 88(6):3329-39. [0200] 40. Phillips B, Van Rompay, K., Rodriguez-Nieves, J., Lorin, C., Koutsoukos, M., Tomai, M., r Fox, C., Eudailey, J., Dennis, M., Alam, S M., Hudgens, M., Fouda, G., Pollara, J., Moody, M A., Shen, X., Ferrari, G., Permar, S., and K. De Paris. Adjuvant-dependent enhancement of HIV Env-specific antibody responses in infant rhesus macaques. in press, JVI01051-18. [0201] 41. Lai C Y, Liu Y L, Yu G Y, Maa M C, Leu T H, Xu C, et al. TLR7/8 agonists activate a mild immune response in rabbits through TLR8 but not TLR7. Vaccine. 2014; 32(43):5593-9. [0202] 42. Fouda G G, Cunningham C K, McFarland E J, Borkowsky W, Muresan P, Pollara J, et al. Infant HIV type 1 gp120 vaccination elicits robust and durable anti-V1V2 immunoglobulin G responses and only rare envelope-specific immunoglobulin A responses. J Infect Dis. 2015; 211(4):508-17. [0203] 43. Phillips B, Fouda G G, Eudailey J, Pollara J, Curtis A D, 2nd, Kunz E, et al. Impact of Poxvirus Vector Priming, Protein Coadministration, and Vaccine Intervals on HIV gp120 Vaccine-Elicited Antibody Magnitude and Function in Infant Macaques. Clin Vaccine Immunol. 2017; 24(10). [0204] 44. Sanders R W, Derking R, Cupo A, Julien J P, Yasmeen A, de Val N, et al. A next-generation cleaved, soluble HIV-1 Env trimer, BG505 SOSIP.664 gp140, expresses multiple epitopes for broadly neutralizing but not non-neutralizing antibodies.
[0205] PLoS Pathog. 2013; 9(9):e1003618. [0206] 45. Chung A W, Ghebremichael M, Robinson H, Brown E, Choi I, Lane S, et al. Polyfunctional Fc-effector profiles mediated by IgG subclass selection distinguish RV144 and VAX003 vaccines. Sci Transl Med. 2014; 6(228):228ra38. [0207] 46. Haynes B F, Gilbert P B, McElrath M J, Zolla-Pazner S, Tomaras G D, Alam S M, et al. Immune-correlates analysis of an HIV-1 vaccine efficacy trial. N Engl J Med. 2012; 366(14):1275-86. [0208] 47. Bradley T, Pollara J, Santra S, Vandergrift N, Pittala S, Bailey-Kellogg C, et al. Pentavalent HIV-1 vaccine protects against simian-human immunodeficiency virus challenge. Nat Commun. 2017; 8:15711. [0209] 48. Gordon S N, Liyanage N P, Doster M N, Vaccari M, Vargas-Inchaustegui D A, Pegu P, et al. Boosting of ALVAC-SIV Vaccine-Primed Macaques with the CD4-SIVgp120 Fusion Protein Elicits Antibodies to V2 Associated with a Decreased Risk of SIVmac251 Acquisition. J Immunol. 2016; 197(7):2726-37. [0210] 49. Barouch D H, Alter G, Broge T, Linde C, Ackerman M E, Brown E P, et al. Protective efficacy of adenovirus/protein vaccines against SIV challenges in rhesus monkeys. Science. 2015; 349(6245):320-4. [0211] 50. Brown E P, Dowell K G, Boesch A W, Normandin E, Mahan A E, Chu T, et al. Multiplexed Fc array for evaluation of antigen-specific antibody effector profiles. J Immunol Methods. 2017; 443:33-44. [0212] 51. Rojas J M, Knight K, Wang L, Clark R E. Clinical evaluation of BCR-ABL peptide immunisation in chronic myeloid leukaemia: results of the EPIC study. Leukemia. 2007; 21(11):2287-95. [0213] 52. Reiss S, Baxter A E, Cirelli K M, Dan J M, Morou A, Daigneault A, et al. Comparative analysis of activation induced marker (AIM) assays for sensitive identification of antigen-specific CD4 T cells. PLoS One. 2017; 12(10):e0186998. [0214] 53. Chung Y, Tanaka S, Chu F, Nurieva R I, Martinez G J, Rawal S, et al. Follicular regulatory T cells expressing Foxp3 and Bcl-6 suppress germinal center reactions. Nat Med. 2011; 17(8):983-8. [0215] 54. Morita R, Schmitt N, Bentebibel S E, Ranganathan R, Bourdery L, Zurawski G, et al. Human blood CXCR5(+)CD4(+) T cells are counterparts of T follicular cells and contain specific subsets that differentially support antibody secretion. Immunity. 2011; 34(1):108-21. [0216] 55. Li H, Wang S, Kong R, Ding W, Lee F H, Parker Z, et al. Envelope residue 375 substitutions in simian-human immunodeficiency viruses enhance CD4 binding and replication in rhesus macaques. Proc Natl Acad Sci USA. 2016; 113(24):E3413-22. [0217] 56. Eudailey J A, Dennis M L, Parker M E, Phillips B L, Huffman T N, Bay C P, et al. Maternal HIV-1 Env Vaccination for Systemic and Breast Milk Immunity To Prevent Oral SHIV Acquisition in Infant Macaques. mSphere. 2018; 3(1). [0218] 57. Williams W B, Zhang J, Jiang C, Nicely N I, Fera D, Luo K, et al. Initiation of HIV neutralizing B cell lineages with sequential envelope immunizations. Nat Commun. 2017; 8(1):1732.
[0219]
[0220] Direct ELISA was adopted to probe the anti-1086c gp120 antibody response in C57BL/6 mice vaccinated with 2 doses of 15 μg Q11 nanofiber-conjugated 1086c gp120 or plain 1086c gp120 in the presence of 10% (v/v) STR8S-C(Slide13). The same method was used to test the antibody response elicited by 2 doses of 15 g 1086c gp120 with or without PADRE-Q11 incorporation and 2 doses of 50 g 1086c gp120 with PADRE-Q11 conjugation in mice (Slide 14). The total peptide concentration in each formulation is 2 mM (cQ11 plus Q11). In PADRE-containing formulations, there is 0.1 mM PADRE-Q11 included, with 1.9 mM cQ11+Q11.
[0221] Immunization schedule: C57BL/6 mice were subcutaneously immunized with 2 doses of 15 g 1086c gp120 (n=5) or 15 g 1086c gp120 conjugated to Q11 nanofibers (n=5) in the presence of 10% STR8S-C adjuvant in week0 and week11 (Slide13). Another cohort received 2 doses of 15 g 1086c gp120 with or without PADRE-Q11 included in the nanofibers (n=10 for each) or 2 doses of 50 g 1086c gp120 with PADRE-Q11 included (n=10) in week0 and week7.
[0222] The studies in
Example 2
[0223] Conjugation of Envelope to Nanofiber
[0224] Linkage of 1086.c gp120 proteins to Q11 nanofibers is mediated by a two-step reaction in which proteins are modified with a heterobifunctional cross linker with amine- and thiol-reactive groups and subsequently linked to cysteine decorated nanofibers. Sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate (Sulfo-SMCC) and succinimidyl-[(N-maleimidopropionamido)-octaethyleneglycol] ester (SM-PEG8) were both used to successfully link nanofibers to proteins (see structures below). When developing the synthesis, both cross linkers were tested in parallel and the solvent composition, reaction temperature and stoichiometry were varied to optimize reaction efficiency and binding of gp120-specific antibodies to conjugated products. Additionally, processing of the modified proteins and preparation of nanofibers was systematically varied to increase protein loading on nanofibers and preserve their structure. To achieve this, the reduction of thiol groups on nanofibers was tested using soluble and particle-bound (tris(2-carboxyethyl)phosphine) (TCEP). Particle bound TCEP was found to be minimally damaging to proteins while soluble TCEP reduced antibody binding after synthesis. After modifying proteins with SMCC or SM-PEG8, dialysis in PBS at 4° C. was found to preserve protein structure most effectively, as measured by antibody binding. Finally, nanofiber morphology was preserved by decreasing centrifugation speed in the final step of product purification. Each of the aforementioned conditions was optimized by testing constructs with direct ELISA, SDS PAGE, and biolayer interferometry.
##STR00001##
Example 3
[0225] This example provides experiments on several aspects of the invention. The example shows that multivalency is important for the elevated antibody response induced by gp120-Q11 compared with different gp120 density. See e.g.
[0226] See
[0227] The antigenicity of the Q11-sortase conjugated gp120 was evaluated by ELISA by comparing the binding of a panel of mAbs to the unmodified gp120 and β-tail tagged gp120 incorporated into Q11 nanofibers. The binding of all the tested mAbs was comparable between the conjugated and unconjugated gp120 for all the HIV-specific mAbs including the CD4 binding site mAb Ch31 and CH235.12, the V2 glycan dependent mAbs PG9 and PG16, the V3 glycan dependent mAb PGT126, and the V3-specific mAb Ch22. Nanofiber morphology was assessed by TEM.
[0228] The sortase-based approach was also used to conjugate CH505 SOSIP trimers to Q11. In
[0229] The SOSIP HIV antigen that induced antibodies that neutralize HIV was conjugated to Q11 nanofiber. For one embodiment, see