METHODS AND COMPOSITIONS FOR TREATING RETINAL DISORDERS

20170252403 · 2017-09-07

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided are methods and compositions for protecting treating ischemic events in the retina. The methods include administering a MANF family protein (e.g., MANF, CDNF, or fragments thereof) to a subject and performing another treatment to resolve the blockage underlying the ischemic event. The methods also include administering a MANF family protein to extend the therapeutic window for treatment of a retinal artery occlusion.

    Claims

    1. A method of increasing retinal tolerance time, reducing cell death during an ischemic event in the retina, reducing cell death following an ischemic event in the retina, treating an ischemic event in the retina, or a combination thereof, the method comprising: (a) administering a dose of a pharmaceutical composition comprising an effective amount of a MANF family protein to a subject in need thereof; (b) performing a treatment to resolve a blockage causing the ischemic event.

    2. The method of claim 1, wherein the MANF family protein is a mesencephalic astrocyte derived neurotrophic factor (MANF) protein, or a fragment thereof.

    3. The method of claim 1, wherein the MANF family protein comprises a sequence that has at least about 80% identity with SEQ ID NO:3.

    4. The method of claim 1, wherein the MANF family protein comprises a sequence that has 95% identity with SEQ ID NO:3.

    5. The method of claim 1, wherein the MANE family protein is a conserved dopamine neurotrophic factor (CDNF) protein, or a fragment thereof.

    6. The method of claim 1, wherein the MANF family protein comprises a sequence that has at least about 80% identity with SEQ ID NO:6.

    7. The method of claim 1, wherein the MANF family protein comprises a sequence that has 95% identity with SEQ ID NO:6.

    8. The method of any one of claims 1-7, wherein the pharmaceutical composition is administered to an eye of the subject.

    9. The method of claim 8, wherein the pharmaceutical composition is administered by topical administration, intravitreal injection, intracameral administration, subconjunctival administration, subtenon administration, retrobulbar administration, posterior juxtascleral administration, or a combination thereof.

    10. The method of claim 8, wherein the pharmaceutical composition is administered by intravitreal injection.

    11. The method of any one of claims 1-10, wherein the dose has a volume of about 25 μL to about 150 μL.

    12. The method of any one of claims 1-11, wherein the dose has a concentration of the MANF family protein that is from about 1 mg/mL to about 20 mg/mL.

    13. The method of any one of claims 1-1, wherein the dose has a concentration of the MANF family protein that is from about 2.7 mg/mL to about 5.4 mg/mL.

    14. The method of any one of claims 1-13, wherein the effective amount of the MANF family protein is from about 50 μg to about 1000 μg.

    15. The method of any one of claims 1-13, wherein the effective amount of the MANF family protein is from about 250 μg to about 300 μg.

    16. The method of any one of claims 1-15, wherein the dose is administered once every 2 to 8 weeks.

    17. The method of any one of claims 1-15, wherein the dose is administered once every 2 to 4 hours.

    18. The method of any one of claims 1-15, wherein the dose is only administered once.

    19. The method of any one of claims 1-18, wherein the ischemic event is a retinal artery occlusion.

    20. The method of any one of claims 1-18, wherein the ischemic event is an acute retinal artery occlusion.

    21. The method of any one of claims 1-20, wherein the treatment to resolve the blockage comprises administration of a vasodilator.

    22. The method of any one of claims 1-21, wherein the treatment to resolve the blockage comprises ocular massage, intravenous acetazolamide, intravenous mannitol, topical antiglaucoma drops, anterior chamber paracentisis, or a combination thereof.

    23. The method of any one of claims 1-22, wherein the treatment to resolve the blockage comprises intravenous methylprednisolone.

    24. The method of any one of claims 1-23, wherein the treatment to resolve the blockage comprises Nd YAG laser treatment, pars plana vitrectomy, or a combination thereof.

    25. The method of any one of claims 1-24, wherein the treatment to resolve the blockage comprises intravenous tissue plasminogen activator, intra-arterial tissue plasminogen activator, or a combination thereof.

    26. The method of any one of claims 1-25, wherein the treatment to resolve the blockage comprises panretinal photocoagulation.

    27. The method of any one of claims 1-26, wherein the treatment to resolve the blockage comprises administration of a steroid.

    28. The method of any one of claims 1-27, further comprising diagnosing the ischemic event.

    29. A method of increasing retinal tolerance time, reducing cell death during a retinal artery occlusion, reducing cell death following a retinal artery occlusion, treating a retinal artery occlusion, or a combination thereof, the method comprising administering a dose of a pharmaceutical composition comprising an effective amount of a MANE family protein to a subject exhibiting one or more symptoms of a retinal artery occlusion.

    30. The method of claim 29, wherein the MANF family protein is a mesencephalic astrocyte derived neurotrophic factor (MANF) protein, or a fragment thereof.

    31. The method of claim 29, wherein the MANF family protein comprises a sequence that has at least about 80% identity with SEQ ID NO:3.

    32. The method of claim 29, wherein the MANF family protein comprises a sequence that has 95% identity with SEQ ID NO:3.

    33. The method of claim 29, wherein the MANF family protein is a conserved dopamine neurotrophic factor (CDNF) protein, or a fragment thereof.

    34. The method of claim 29, wherein the MANF family protein comprises a sequence that has at least about 80% identity with SEQ ID NO:6.

    35. The method of claim 29, wherein the MANE family protein comprises a sequence that has 95% identity with SEQ ID NO:6.

    36. The method of any one of claims 29-35, wherein the pharmaceutical composition is administered to an eye of the subject.

    37. The method of claim 36, wherein the pharmaceutical composition is administered by topical administration, intravitreal injection, intracameral administration, subconjunctival administration, subtenon administration, retrobulbar administration, posterior juxtascleral administration, or a combination thereof.

    38. The method of claim 36, wherein the pharmaceutical composition is administered by intravitreal injection.

    39. The method of any one of claims 29-38, wherein the dose has a volume of about 25 μL to about 150 μL.

    40. The method of any one of claims 29-39, wherein the dose has a concentration of the MANE family protein that is from about 1 mg/mL to about 20 mg/mL.

    41. The method of any one of claims 29-39, wherein the dose has a concentration of the MANF family protein that is from about 2.7 mg/mL to about 5.4 mg/mL.

    42. The method of any one of claims 29-41, wherein the effective amount of the MANE family protein is from about 50 μg to about 1000 μg.

    43. The method of any one of claims 29-41, wherein the effective amount of the MANF family protein is from about 250 μg to about 300 μg.

    44. The method of any one of claims 29-43, wherein the dose is administered once every 2 to 4 hours.

    45. The method of any one of claims 29-43, wherein the dose is only administered once.

    46. The method of any one of claims 29-45, wherein the retinal artery occlusion is an acute retinal artery occlusion.

    47. The method of any one of claims 29-46, wherein the retinal artery occlusion is a central retinal artery occlusion.

    48. The method of any one of claims 29-46, wherein the retinal artery occlusion is a branch retinal artery occlusion.

    49. A method of treating a retinal disorder, the method comprising administering to a subject in need thereof an effective amount of a MANF family protein and another active agent.

    50. The method of claim 49, wherein the MANF family protein and the another active agent have a synergistic effect upon retinal ganglion cell survival.

    51. The method of any one of claims 49-50, wherein the MANF family protein and the another active agent exhibit therapeutic synergy.

    52. The method of any one of claims 49-51, wherein the MANF family protein is MANF, or a fragment thereof.

    53. The method of any one of claims 49-52, wherein the MANF family protein is CDNF, or a fragment thereof.

    54. The method of any one of claims 49-53, wherein the another active agent is a prostaglandin analog, a beta-adrenergic receptor antagonist, an alpha adrenergic agonist, a miotic agent, a carbonic anhydrase inhibitor, or a combination thereof.

    55. The method of any one of claims 49-54, wherein the another active agent is brimonidine or a pharmaceutical salt thereof.

    56. The method of any one of claims 49-55, wherein the retinal disorder is an acute retinal artery occlusion.

    57. The method of any one of claims 49-55, wherein the retinal disorder is a central retinal artery occlusion or a branch retinal artery occlusion.

    58. The method of any one of claims 49-55, wherein the retinal disorder is retinal ischemia.

    59. The method of any one of claims 49-55, wherein the retinal disorder is macular degeneration, diabetic eye disease, age-related macular degeneration, branch retinal vein occlusion, central retinal vein occlusion, central retinal artery occlusion, central serous retinopathy, diabetic retinopathy, Fuchs' dystrophy, giant cell arteritis, glaucoma, hypertensive retinopathy, thyroid eye disease, iridocorneal endothelial syndrome, ischemic optic neuropathy, juvenile macular degeneration, macular edema, macular telangioctasia, marfan syndrome, optic neuritis, photokeratitis, retinitis pigmentosa, retinopathy of prematurity, stargardt disease, usher syndrome, or any combination thereof.

    60. The method of any one of claims 49-59, wherein administration of the MANF family protein is topical, subconjunctival, intravitreal, retrobulbar, intracameral, systemic, or a combination thereof.

    61. The method of any one of claims 49-60, wherein the effective amount of the MANF family protein is at least about: 0.5 μg, 2.5 μg, 5 μg, 7.5 μg, 12.5 μg, 25 μg, 50 μg, 75 μg, 100 μg, 150 μg, 250 μg, 500 μg, 1000 μg, 1250 μg, or 2500 μg per eye.

    62. The method of any one of claims 49-61, wherein the MANF family protein is administered once every 2 to 8 weeks.

    63. The method of any one of claims 49-61, wherein the MANF family protein is administered only once.

    64. A pharmaceutical composition comprising an amount of a MANF family protein and another active agent that is effective for treating a retinal disorder.

    65. The pharmaceutical composition of claim 64, wherein the MANF family protein and the another active agent have a synergistic effect upon retinal ganglion cell survival.

    66. The pharmaceutical composition of any one of claims 64-65, wherein the MANF family protein and the another active agent exhibit therapeutic synergy.

    67. The pharmaceutical composition of any one of claims 64-66, wherein the MANF family protein is MANF, or a fragment thereof.

    68. The pharmaceutical composition of any one of claims 64-67, wherein the MANF family protein is CDNF, or a fragment thereof.

    69. The pharmaceutical composition of any one of claims 64-68, wherein the another active agent is a prostaglandin analog, a beta-adrenergic receptor antagonist, an alpha adrenergic agonist, a miotic agent, a carbonic anhydrase inhibitor, or a combination thereof.

    70. The pharmaceutical composition of any one of claims 64-69, wherein the another active agent is brimonidine or a pharmaceutical salt thereof.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0048] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:

    [0049] FIG. 1 illustrates the three-dimensional structure of MANF as determined using multidimensional NMR spectroscopy. N- and C-terminal domains are connected with a flexible linker region. The MANF protein is almost completely helical within the two folded domains. The helices are numbered from α1 to α8. The N-terminal (N) and C-terminal (C) of the protein are indicated.

    [0050] FIG. 2 illustrates Coomassie-stained SDS-PAGE (A) and Western Blot (B) analysis of purified human MANF protein. 2 μg of purified hrMANF was loaded per lane. Line 1. hrMANF; Line 2. Prestained Protein Ladder, Naxo, 8003. For Western Blot testing, anti-MANF polyclonal antibody (Icosagen AS Cat. No 310-100) was used.

    [0051] FIG. 3 illustrates right eye b-wave amplitudes seven (7) days after optic nerve clamping, normalized to baseline. The treatment conditions were, from left to right, MANF 0.15 mg/mL, MANF 0.5 mg/mL, MANF 1.5 mg/mL, PBS, or Alphagan®; ** p<0.05 vs PBS (ANOVA, followed by Dunn's multiple comparisons test against PBS control); N=10 (Alphagan), N=11 (PBS), N==11 (MANF 0.15 mg/mL), N=12 (MANF 0.5 mg/ml), N:=12 (MANF 1.5 mg/mL).

    [0052] FIG. 4 illustrates surviving retinal ganglion cell density seven (7) days after optic nerve clamping. The treatment conditions were, from left to right, MANF 0.15 mg/mL, MANF 0.5 mg/mL, MANF 1.5 mg/mL, PBS, or Alphagan®; * p<0.05 vs. PBS (ANOVA, followed by Dunn's multiple comparisons test against PBS control). N=11 (Alphagan, PBS), N=12 (MANF 0.15 mg/mL, MANF 0.5 mg/mL, MANF 1.5 mg/mL).

    DETAILED DESCRIPTION OF THE INVENTION

    [0053] Retinal ischemia can cause visual impairment or blindness. A number of clinical conditions, including central retinal artery or vein occlusion (CRAO, CRVO), diabetes, or glaucoma make themselves manifest by a reduction of retinal blood supply. Retinal ischemia can initiate a self-reinforcing destructive cascade involving neuronal depolarization, calcium influx and oxidative stress initiated by energy failure and increased glutamatergic stimulation. The initial ischemic insult can result in cellular perturbations that continue to progress despite or perhaps because of, reperfusion of the ischemic tissue. Ultimately, the retinal ganglion cells (RGC) die via apoptosis.

    [0054] Mesencephalic astrocyte-derived neurotrophic factor (MANF) and conserved dopamine neurotrophic factor (CDNF) are two known members of a novel evolutionarily conserved protein family with neurotrophic capabilities, the MANF family proteins. The first member of the family, MANF, was identified from the conditional medium of a rat type-1 astrocyte cell line, namely, the ventral mesencephalic cell line 1 (VMCL1), as a factor that promotes the survival of cultured embryonic dopaminergic neurons. MANF can also reduce infarction in the ischemic cortex in a rat model of stroke and promote the survival of cultured heart muscle cells. CDNF, on the other hand, was first identified in silico and then biochemically characterized. Structural analysis showed that both MANF and CDNF have an N-terminal saposin-like lipid-binding domain and a C-terminal domain that may be responsible for the endoplasmic reticulum (ER) stress response.

    [0055] Provided are methods and compositions for protecting, stimulating the growth of, or regenerating retinal neurons and for treating retinal disorders comprising administering an effective amount of a MANF family protein and another active agent to a subject in need thereof. Retinal neurons can include visual cells (e.g., rod or cone cells), bipolar cells, ganglion cells (e.g., retinal ganglion cells), amacrine cells, horizontal cells, or any combination thereof.

    [0056] Unless otherwise defined, all terms of art, notations and other scientific terms or terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art. It will be further understood that terms, such as those defined in commonly used dictionaries, should be interpreted as having a meaning that is consistent with their meaning in the context of the relevant art and/or as otherwise defined herein.

    [0057] The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting of the invention. As used herein, the indefinite articles “a”, “an” and “the” should be understood to include plural reference unless the context clearly indicates otherwise.

    [0058] The phrase “and/or,” as used herein, should be understood to mean “either or both” of the elements so conjoined, i.e., elements that are conjunctively present in some cases and disjunctively present in other cases.

    [0059] As used herein, “or” should be understood to have the same meaning as “and/or” as defined above. For example, when separating a listing of items, “and/or” or “or” shall be interpreted as being inclusive, i.e., the inclusion of at least one, but also including more than one, of a number of items, and, optionally, additional unlisted items. Only terms clearly indicated to the contrary, such as “only one of” or “exactly one of,” or, when used in the claims, “consisting of,” will refer to the inclusion of exactly one element of a number or list of elements. In general, the term “or” as used herein shall only be interpreted as indicating exclusive alternatives (i.e., “one or the other but not both”) when preceded by terms of exclusivity, such as “either,” “one of,” “only one of,” or “exactly one of.”

    [0060] As used herein, the terms “including”, “includes”, “having”, “has”, “with”, or variants thereof, are intended to be inclusive similar to the term “comprising.”

    [0061] As used herein, the term “about” means plus or minus 10% of the indicated value. For example, about 100 means from 90 to 110.

    [0062] All genes and gene products (including RNA and proteins), and their respective names, disclosed herein are intended to correspond to homologs from any species for which the compositions and methods disclosed herein are applicable. When a gene or gene product from a particular species is disclosed, it is understood that this disclosure is intended to be exemplary only and is not to be interpreted as a limitation unless the context in which it appears clearly indicates otherwise. For example, the genes and gene products disclosed herein, which in some embodiments relate to mammalian (including human) nucleic acid and/or amino acid sequences, are intended to encompass homologous and/or orthologous and/or paralogous genes and gene products from other animals including, but not limited to, other mammals, fish, reptiles, amphibians, birds, and other vertebrates.

    [0063] As used herein, the terms “polypeptide,” “peptide,” and “protein” are equivalent and mutually interchangeable. They refer to any amino acid chain, including native peptides, degradation products, synthetically synthesized peptides, or recombinant peptides; and include any post-translational modifications thereto (for example phosphorylation or glycosylation). Polypeptides include modified peptides, which may have, for example, modifications rendering the peptides more stable or less immunogenic. Such modifications can include, but are not limited to, cyclization, N-terminus modification, C-terminus modification, peptide bond modification, backbone modification and residue modification. Acetylation—amidation of the termini of the peptide (e.g., N-terminal acetylation and C-terminal amidation) can increase the stability and cell permeability of the peptides.

    [0064] As used herein, the term “fragment” refers to a portion of a compound. For example, when referring to a protein, a fragment is a plurality of consecutive amino acids comprising less than the entire length of the polypeptide.

    [0065] The disclosure of a particular sequence should be understood as disclosure of all fragments of a sequence. A fragment of a sequence can be defined according to a percent length of a reference sequence (e.g., a reference protein or peptide sequence). For example, a fragment of a sequence (e.g., protein or peptide sequence) can have a length that is at least about 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% of the length of the reference sequence. In another example, a fragment of a sequence (e.g., protein or peptide sequence) can have a length that is at most about 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% of the length of the reference sequence. In another example, a fragment of a sequence (e.g., protein or peptide sequence) can have a length that is about 1-99%, 2-99%, 5-99%, 10-99%, 20-99%, 30-99%, 40-99%, 50-99%, 60-99%, 70-99%, 80-99%, 90-99%, 2-90%, 5-90%, 10-90%, 20-90%, 30-90%, 40-90%, 50-90%, 60-90%, 70-90%, 80-90%, 5-80%, 10-80%, 20-80%, 30-80%, 40-80%, 50-80%, 60-80%, 70-80%, 10-70%, 20-70%, 30-70%, 40-70%, 50-70%, 60-70%, 20-60%, 30-60%, 40-60%, 50-60%, 30-50%, 40-50%, or 30-40% of the length of the reference sequence. Fragments can also be defined as have a percent identity to a reference sequence; for example a fragment can have length that is less than the reference sequence and a percent identity of the reference sequence.

    [0066] The term “identity” refers to a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences. “Percent identity” means the percent of identical residues between the amino acids or nucleotides in the compared molecules and is calculated based on the size of the smallest of the molecules being compared. For these calculations, gaps in alignments (if any) are preferably addressed by a particular mathematical model or computer program (i.e., an “algorithm”). Methods that can be used to calculate the identity of the aligned nucleic acids or polypeptides include those described in Computational Molecular Biology, (Lesk, A. M., ed.), 1988, New York: Oxford University Press; Biocomputing Informatics and Genome Projects, (Smith, D. W., ed.), 1993, New York: Academic Press; Computer Analysis of Sequence Data, Part I, (Griffin, A. M., and Griffin, H. G, eds.), 1994, New Jersey: Humana Press; von Heinje, G., 1987, Sequence Analysis in Molecular Biology, New York: Academic Press; Sequence Analysis Primer, (Gribskov, M. and Devereux, J., eds.), 1991, New York: M. Stockton Press; and Carillo et al, 1988, SUM J. Applied Math. 48: 1073.

    [0067] The disclosure of any particular sequence herein should be interpreted as the disclosure of all sequences sharing a percent identity with the sequence. A sequence can be defined herein according to a percent identity with a reference sequence. For example, the sequence can have at least about: 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the reference sequence. In another example, the sequence can have about: 50-60%, 50-75%, 50-80%, 50-85%, 50-90%, 50-95%, 50-97%, 50-99%, 50-100%, 60-75%, 60-80%, 60-85%, 60-90%, 60-95%, 60-97%, 60-99%, 60-100%, 75-80%, 75-85%, 75-90%, 75-95%, 75-97%, 75-99%, 75-100%, 80-85%, 80-90%, 80-95%, 80-97%, 80-99%, 80-100%, 85-90%, 85-95%, 85-97%, 85-99%, 85-100%, 90-95%, 90-97%, 90-99%, 90-100%, 95-97%, 95-99%, 95-100%, 97-99%, 97-100%, or 99-100% identity with the reference sequence. Such sequences can be called variants of the reference sequence.

    [0068] A “variant” of a polypeptide comprises an amino acid sequence wherein one or more amino acid residues are inserted into, deleted from and/or substituted into the amino acid sequence relative to another polypeptide sequence. The substituted amino acid(s) can be conservative substitutions or non-conservative substitutions, depending upon the context.

    [0069] Variants include fusion proteins.

    [0070] Conservative substitutions are substitutions of one amino acid with a chemically similar amino acid. The following six groups each contain amino acids that are conservative substitutions for one another: (1) Alanine (A), Serine (S), Threonine (T); (2) Aspartic acid (D), Glutamic acid (E); (3) Asparagine (N), Glutamnine (Q); (4) Arginine (R), Lysine (K); (5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and (6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).

    [0071] In making changes to the peptides and proteins disclosed herein, the hydropathic index of amino acids can be considered. Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics. They are: isoleucine (−4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine (−0.4); threonine (−0.7); serine (−0.8); tryptophan (−0.9); tyrosine (−1.3); proline (−1.6); histidine (−3.2); glutamate (−3.5); glutamine (−3.5); aspartate (−3.5); asparagine (−3.5); lysine (−3.9); and arginine (−4.5).

    [0072] The importance of the hydropathic amino acid index in conferring interactive biological function on a protein or peptide can be considered in designing variants of a protein or peptide. Certain amino acids can be substituted for other amino acids having a similar hydropathic index or score and still retain a similar biological activity. In making changes based upon the hydropathic index, the substitution of amino acids whose hydropathic indices are within ±2, ±1, or ±0.5 are included.

    [0073] The substitution of like amino acids can also be made effectively on the basis of hydrophilicity. In certain embodiments, the greatest local average hydrophilicity of a protein or peptide, as governed by the hydrophilicity of its adjacent amino acids, correlates with a biological property of the protein or peptide.

    [0074] The following hydrophilicity values have been assigned to these amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0±1); glutamate (+3.0±1); serine (+0.3); asparagine (+0.2); glutamine (±0.2); glycine (0); threonine (−0.4); proline (−0.5±1); alanine (−0.5); histidine (−0.5); cysteine (−1.0); methionine (−1.3); valine (−1.5); leucine (−1.8); isoleucine (−1.8); tyrosine (−2.3); phenylalanine (−2.5) and tryptophan (−3.4). In making changes based upon similar hydrophilicity values, the substitution of amino acids whose hydrophilicity values are within ±2, ±1, ±0.5 are included.

    [0075] As used herein, the term “subject” refers to any animal (e.g., mammals, birds, reptiles, amphibians, fish), including, but not limited to, humans, non-human primates, rodents, and the like, which is to be the recipient of a particular treatment. Typically, the terms “subject” and “patient” may be used interchangeably herein in reference to a subject.

    [0076] As used herein, the term “administering” refers to providing a therapeutically effective amount of a chemical or biological compound or pharmaceutical composition to a subject, using intravitreal, intraocular, ocular, subretinal, intrathecal, intravenous, subcutaneous, transcutaneous, intracutaneous, intracranial, topical and the like administration. The chemical or biological compound of the present invention can be administered alone, but may be administered with other compounds, excipients, fillers, binders, carriers or other vehicles selected based upon the chosen route of administration and standard pharmaceutical practice. Administration may be by way of carriers or vehicles, such as injectable solutions, including sterile aqueous or non-aqueous solutions, or saline solutions; creams; lotions; capsules; tablets; granules; pellets; powders; suspensions, emulsions, or microemulsions; patches; micelles; liposomes; vesicles; implants, including microimplants; eye drops; other proteins and peptides; synthetic polymers; microspheres; nanoparticles; and the like.

    [0077] The active ingredients (e.g., chemical or biological compound or pharmaceutical composition) disclosed herein may also be included, or packaged, with other non-toxic compounds, such as pharmaceutically acceptable carriers, excipients, binders and fillers including, but not limited to, glucose, lactose, gum acacia, gelatin, mannitol, xanthan gum, locust bean gum, galactose, oligosaccharides and/or polysaccharides, starch paste, magnesium trisilicate, talc, corn starch, starch fragments, keratin, colloidal silica, potato starch, urea, dextrans, dextrins, and the like. Specifically, the pharmaceutically acceptable carriers, excipients, binders, and fillers contemplated for use in the practice of the present invention are those which render the compounds of the invention amenable to intravitreal delivery, intraocular delivery, ocular delivery, subretinal delivery, intrathecal delivery, intravenous delivery, subcutaneous delivery, transcutaneous delivery, intracutaneous delivery, intracranial delivery, topical delivery and the like. Moreover, the packaging material may be biologically inert or lack bioactivity, such as plastic polymers, silicone, etc. and may be processed internally by the subject without affecting the effectiveness of the neurotrophic factor packaged and/or delivered therewith.

    [0078] The term “effective amount,” as applied to the compound(s), biologics and pharmaceutical compositions described herein, means the quantity necessary to render the desired therapeutic result. For example, an effective amount is a level effective to treat, cure, or alleviate the symptoms of a disorder for which the therapeutic compound, biologic or composition is being administered. Amounts effective for the particular therapeutic goal sought will depend upon a variety of factors including the disorder being treated and its severity and/or stage of development/progression; the bioavailability, and activity of the specific compound, biologic or pharmaceutical composition used; the route or method of administration and introduction site on the subject; the rate of clearance of the specific compound or biologic and other pharmacokinetic properties; the duration of treatment; inoculation regimen; drugs used in combination or coincident with the specific compound, biologic or composition; the age, body weight, sex, diet, physiology and general health of the subject being treated; and like factors well known to one of skill in the relevant scientific art. Some variation in dosage can occur depending upon the condition of the subject being treated, and the physician or other individual administering treatment will, in any event, determine the appropriate dose for an individual patient.

    [0079] As used herein, “disorder” refers to a disorder, disease or condition, or other departure from healthy or normal biological activity, and the terms can be used interchangeably. The terms would refer to any condition that impairs normal function. The condition may be caused by sporadic or heritable genetic abnormalities. The condition may also be caused by non-genetic abnormalities. The condition may also be caused by injuries to a subject from environmental factors, such as, but not limited to, cutting, crushing, burning, piercing, stretching, shearing, injecting, or otherwise modifying a subject's cell(s), tissue(s), organ(s), system(s), or the like.

    [0080] As used herein, “treatment” or “treating” refers to arresting or inhibiting, or attempting to arrest or inhibit, the development or progression of a disorder and/or causing, or attempting to cause, the reduction, suppression, regression, or remission of a disorder and/or a symptom thereof. As would be understood by those skilled in the art, various clinical and scientific methodologies and assays may be used to assess the development or progression of a disorder, and similarly, various clinical and scientific methodologies and assays may be used to assess the reduction, regression, or remission of a disorder or its symptoms. Additionally, treatment can be applied to a subject or to a cell culture.

    [0081] Retinal Artery Occlusion

    [0082] Acute retinal artery occlusion (RAO) represents an acute ophthalmologic emergency. A case of central retinal artery occlusion (CRAO) was first described by von Graefe in 1859.

    [0083] RAO is a rare condition caused by the sudden occlusion of the central retinal artery, usually by emboli or thrombi, leading to an abrupt loss of blood supply to the inner layer of the retina and resulting in acute and often irreversible, severe vision loss. The estimated prevalence of RAO in the United States of America (USA) population is 10,450 individuals affected in 2014. Vision loss is often permanent if reperfusion of the retinal artery is not achieved within a few hours.

    [0084] RAO can be classified based on where the occlusion is located. Central RAO (CRAO) affects the retinal artery at the optic nerve and accounts for 58% of RAO cases. Branch retinal artery occlusion (BRAO) results in an obstruction distal to the lamina cribrosa of the optic nerve and accounts for about 38% of RAO cases. The central retinal artery is an end artery supplying the only source of arterial blood to the inner retinal layer of the eye, the end organ. CRAO and BRAO can be readily diagnosed by direct visualization, unlike other vascular occlusive disease.

    [0085] An estimated 49.5% of humans anatomically have a cilioretinal artery. The cilioretinal artery, when present, is a branch of the short posterior artery that supplies the maculopapular bundle, an area that contains the maximum amount of photoreceptors for central vision. This cilioretinal artery may become occluded (CLRAO) or it may provide some sparing effect in cases of CRAO, though the size of the area the cilioretinal artery may supply can vary from individual to individual. CLRAO is seen in about 5% of RAO cases.

    [0086] RAO generally presents as acute, painless, monocular vision loss. It can be rare for RAO to occur simultaneously in both eyes, however multiple emboli have been observed in the affected eye in about ⅓rd of cases. In the case of CRAO and CLRAO, central vision loss can be quite severe. BRAO typically affects an area of the peripheral vision and may even go unnoticed by the affected individual. The incidence of RAO increases with age and can be seen more often in men compared to women. Recovery of any degree of visual acuity can depend on the removal of the occlusion within the retinal tolerance time, that is, the time before the retinal ganglion cells are irreversibly damaged. Previous studies in elderly atherosclerotic and hypertensive rhesus monkeys using central retinal artery clamping for 97, 105-120, 150-165 and ≧180 minutes, complete recovery of vision based on electroretinographic measurements and histologic findings was seen if the clamp was removed within 97 minutes, but there was increasing loss of vision and more severe histologic findings of necrosis of the inner layer of the retina the longer the occlusion lasted. This retinal tolerance time may be dependent on the duration of intracellular glycogen conversion to glucose prior to reperfusion to allow for cellular survival.

    [0087] A common cause of RAO can be an embolism caused by plaque in the carotid artery. Emboli may also originate from certain diseases of the heart (e.g., aortic mitral valve lesions, tumor, myxoma, etc.), but this can be less common. These emboli have been reported to be of 3 types: 74% consisted of cholesterol, 15.5% were cholesterol and platelet fibrin, and 10.5% were calcific in nature. Rarely, acute CRAO and BRAO can be caused by various hypercoagulable states such as, for example, Protein C, Protein S, or prothrombin deficiencies; sickle cell anemia (acute sickle crisis); and anti-phospholipid antibodies. Acute CRAO and BRAO can be caused by acute and transient vasospasm (transient ischemic attack [TIA]) or by more generalized arteritis conditions, especially giant cell arteritis, which can affect the central retinal artery, though not branch retinal arteries (which are arterioles rather than arteries and thus not affected by the arteritic inflammation). Giant cell arteritis can be diagnosed as the cause of CRAO in <5% of cases, but it can be important to consider in the initial differential diagnosis as it is a treatable disease with very high dose intravenous steroid. An even less common cause of acute CRAO or BRAO may be acute serotonin release from platelet thrombi leading to vasospasm.

    [0088] Many or most emboli arise from underlying cardiovascular disease. The presence of carotid artery plaque can be of greater importance than the degree of stenosis when it comes to RAO risk. Many of the embolic/thrombotic causes of CRAO and BRAO can be associated with generalized systemic disorders such as hypertension, diabetes mellitus, and tobacco smoking which can cause generalized atherosclerotic disease. Therefore, it can be important for a patient presenting with RAO to be further evaluated for other vascular risk factors and treated appropriately. Findings from a single-center, randomized audit found that 64% of patients with CRAO had at least one undiagnosed vascular risk such as hyperlipidemia (36%), hypertension (27%) and diabetes (12%) as the most prominent.

    [0089] The retinal artery is the sole source of blood to the inner retina, an end organ, and acute occlusion can result in the immediate onset of symptoms. This can be unlike the case of retinal vein occlusion and chronic carotid artery/LAO hypoperfusion, where the time to onset is usually long and the symptoms can be chronic with many of the adverse end events taking a prolonged time to manifest. To achieve immediate and sufficient concentrations of mesencephalic, astrocyte-derived neurotrophic factor (MANF) to be effective, MANF can be delivered directly into the eye.

    [0090] Central Retinal Artery Occlusion

    [0091] The ophthalmic artery originates from the internal carotid artery. The central retinal artery is the first branch of the ophthalmic artery and supplies blood to the surface layer of the optic disc. Acute CRAO causes a sudden drop in oxygen and nutrient supply to the retina which can lead to a death of retinal ganglion cells and loss of the entire field of vision unless vascular flow is restored quickly. The retina consumes oxygen and glucose more rapidly than other tissues in the body and therefore can be at very high risk of suffering permanent damage unless the arterial vascular supply can be quickly restored. The most common location for an occlusion can be where the artery pierces the dural sheath of the optic nerve immediately posterior to the lamina cribrosa.

    [0092] The inner layer of the retina can have greater sensitivity to hypoxic challenge than the outer layer of the retina. The retinal ganglion cells (RGCs) of the inner part of the retina can be sensitive to acute, transient and even mild systemic hypoxic stress. During RAO, inner retinal layer edema and pyknosis of the ganglion cell nuclei can occur very rapidly. If reperfusion is not restored quickly, RGCs can be lost through both apoptosis and necrosis and blindness can become permanent.

    [0093] RGCs are the neurons that transfer visual information from the eye to the brain. The axons of the RGCs bundle to make up the optic nerve. The optic disc is the point where the optic nerve emerges from the retina and it is also the entry point of the major blood vessels that supply the retina. Retinal bipolar cells release glutamate that binds to glutamate receptors on RGCs.

    [0094] When the proper threshold is reached, RGCs will depolarize. RGCs can be the only retinal cells that can produce an action potential and it is by this action potential that visual information is transmitted to the brain through the optic nerve. Under hypoxic stress, excess glutamate can be produced. Hyperexcitability of the RGCs can cause a cascade of biochemical effects, such as neuronal nitric oxide synthase (NOS) activation and increases in Ca.sup.2+, which have been shown to be contributing factors for RGC loss. Vision loss from RAO can result from acute loss of the arterial blood supply to the inner layer of the retina.

    [0095] CRAO generally presents as acute, painless, monocular vision loss. In the case of CRAO and CLRAO, central vision loss can be quite severe. BRAG affects an area of the peripheral vision and may even go unnoticed by the affected individual. The incidence of RAO increases with age and can be seen more often in men compared to women. Recovering any degree of visual acuity can depend on the rapid removal of the occlusion in conjunction with an optimization of the retinal ischemic tolerance time.

    [0096] The diagnosis of CRAO/BRAO can be a medical emergency, and can require a rapid and thorough evaluation of the underlying cause of the occlusion and institution of potential treatment to restore arterial blood flow. Identifying the source of microthrombi/emboli and immediate treatment to prevent further thrombi/emboli or dissolve intact thrombi can be indicated. Monocular and binocular CRAO and blindness also can occur with giant cell arteritis (at a reported rate of <5%) and the immediate institution of high dose corticosteroid therapy can be indicated. As a secondary part of the initial evaluation, a survey of the rest of the body can also be indicated because most thrombi/emboli arise from underlying cardiovascular disease and RAO patients are typically over 50 and are reported to have an increased mortality rate. Therefore, it can be important for a patient presenting with RAO to be evaluated for other vascular risk factors and treated appropriately while emergency treatment to restore retinal artery flow is put into place. Findings from a single-center, randomized audit found that 64% of patients with CRAO had at least one undiagnosed vascular risk such as hyperlipidaemia (36%), hypertension (27%) and diabetes (12%) as the most prominent.

    [0097] RAO is an acute ophthalmologic emergency. The retinal artery is an end artery and the inner retina is an end organ because there is no other arterial supply to the inner retina. As such, RAO can be considered the ocular analogue of cerebral stroke, but without the possibility of ancillary arterial supply and backflow. As a result, in permanent CRAO, final visual acuity is be reduced to counting fingers or worse (20/200-20/400) in a reported 80% of patients. If a cilioretinal artery is present anatomically, some visual acuity may be preserved to 20/50 with only peripheral vision loss.

    [0098] The time frame to significant visual loss after acute arterial occlusion call be distinctly different from that for chronic retinal vein stasis, which can result in local edema (especially of the macula), and glaucoma, all of which usually result in chronic changes to the retina.

    [0099] This is in significant contradistinction to the effects of central retinal vein occlusion (CRVO). Though acute CRAO and CRVO can share a common end pathway of hypoxia and loss of nutrients, which can lead to apoptosis and death of the various retinal cell layers and ganglia, the time to blindness can be measured in hours to days with arterial occlusion as opposed to months and years with chronic retinal vein occlusion. The most common causes of chronic CRVO can be macular edema, vitreous haemorrhage, neovascularization and neovascular glaucoma.

    [0100] The visual problems caused by CRVO can be slowly progressive and are often secondary to intra-ocular pathology. Treatment is often focused on the inciting pathology rather than the CRVO. While it appears that CRVO and CRAO leading to blindness have a common final pathway to retinal cell apoptosis and death, the speed to retinal ganglion death can be significantly faster with CRAO than CRVO because of the acute loss of oxygenation and nutrients from the blood that can occur in CRAO. The treatments for retinal vein occlusion (RVO) and macular oedema can include the long term use of anti-VEGF (vascular endothelial growth factor) drugs (for example, ranibizumab and aflibercept) or intraocular corticosteroids such as triamcinolone, which have not been indicated for the treatment of RAO. If there is acute combined CRAO and central retinal venous occlusion caused, for example, by physical trauma or head placement during spinal surgery procedures, the most significant problem can be the acute loss of oxygen and especially nutrients supplied to the retina as the end organ.

    [0101] There is a need in the art to extend the survival of the entire retina and especially RGCs after acute RAO in that relatively short period until retinal artery flow can be restored.

    [0102] Categories of Central Retinal Artery Occlusion

    [0103] CRAO can be classified into 4 categories, depending on the location of the occlusion: [0104] 1) Non-arteritic permanent CRAO: This type is the most common and can account for ⅔.sup.rds of CRAO cases. The occlusion is typically caused by thrombi/emboli. Vision loss can often be severe with little recovery in visual acuity. [0105] 2) Transient non-arteritic: About a reported 15-17% of CRAO cases are of this category. This type can have the best visual prognosis and, according to what was seen in animal models, is thought to be caused by transient vasospasm due to serotonin release from platelets on plaques. Treatment may not be necessary because the condition often resolves without intervention. [0106] 3) ion-arteritic CRAO with cilioretinal sparing: Perfusion of the macula region can be preserved by the cilioretinal artery, allowing for a better central visual acuity prognosis.

    [0107] The size of the cilioretinal artery and the area of the macular region can vary from individual to individual. Not all individuals affected with CRAO will have a cilioretinal artery. [0108] 4) Arteritic CRAO with giant cell arteritis: This type can be less common and has been reported to include less than about 5% of CRAO cases. It can, however cause bilateral, severe and permanent vision loss. The patient can be assessed for presence of inflammatory markers and treatment with systemic corticosteroids may give the best chance of regaining visual acuity.

    [0109] Diagnosis of Central Retinal Artery Occlusion

    [0110] Acute CRAO can be Diagnosed Using the Following Criteria: [0111] 1. Sudden vision loss in one eye [0112] 2. Evidence of acute retinal ischemia: [0113] retinal opacity: the ischemic area of the retina can appear white because retinal ganglion cells can swell due to the ischemia. This whitening of the retina generally lasts about 4-6 weeks. When present, no whitening of the retina supplied by the cilioretinal artery is typically seen. [0114] cherry red spot: foveal center (center of the macula) can appear red because this area may not be obscured by swelling of the ganglion cells, which can allow the visualization of red blood in the choroid below. [0115] transient CRAO: multiple scattered patches of retinal opacity all over the posterior pole with or without intervening retina showing whitening or even a faint cherry red spot. [0116] 3. Presence of “box-carring” (“cattle trucking”) of the blood column in retinal vessels. [0117] 4. Fluorescein fundus angiography: evidence of absence or marked stasis of the retinal arterial circulation.

    [0118] The presence of “box-carring” or fluorescein fundus angiography findings may not be seen in patients with transient CRAO.

    [0119] Disc pallor and retinal vascular narrowing are typically seen in late stage CRAO.

    [0120] Current Management of Central Retinal Artery Occlusion

    [0121] One of the main goals during the initial treatment of acute CRAO and BRAO can be to relieve the ischemia as rapidly as possible. Currently available treatment options (e.g., reduction of intraocular pressure, ocular massage, use of vasodilators, hemodilution, or hyperbaric oxygen) can be used in order to dislodge the occlusion and bring more oxygen to the area. Unfortunately, many of these therapeutic maneuvers may offer limited success in comparison to natural history observations.

    [0122] The use of MANF family proteins and peptides in the treatment of acute CRAO or BRAO is novel and independent of any current therapeutic maneuver. Without being limited by theory, these proteins and peptides can prolong the survival of retinal ganglion cells under stress conditions until arterial flow can be restored by the aforementioned means.

    [0123] Branch Retinal Artery Occlusion

    [0124] After the central retinal artery, the retinal artery has further branches that supply different quadrants of the retina. BRAO can occur when an embolus lodges in one of these distal branches, and can cause a sudden but focal loss of the field of vision.

    [0125] CLRAO can be included under the general category of BRAO.

    [0126] Categories of Branch Retinal Artery Occlusion

    [0127] BRAO can be classified into the following categories based on the site of occlusion: [0128] 1. BRAO: BRAO can be permanent or transient. Visual prognosis following BRAO can be correlated with the site of the obstruction and the portion of the visual field affected. It has been reported that visual acuity of 20/40 or better is seen initially in 74% of permanent BRAO and 97% of transient BRAO; and finally on follow-up, in 89% and 100 respectively; [0129] 2. CLRAO: similar to CRAO, CLRAO can be further broken down into 3 distinct sub-types: [0130] a. Non-arteritic-CLRAO, [0131] b. Arteritic CLRAO associated with giant cell arteritis, [0132] c. CLRAO associated with central retina vein occlusion (CRVO).

    [0133] Diagnosis of Branch Retinal Artery Occlusion

    [0134] Acute BRAO can be diagnosed with the following criteria: [0135] 1. Sudden onset of visual deterioration; [0136] 2. Evidence of acute retinal ischemia in the distribution of the occluded branch retinal artery; [0137] 3. Evidence of retinal edema in the distribution of the affected vessel only; or [0138] 4. Fluorescein fundus angiography: evidence or absence or marked stasis of circulation in the involved branch retinal artery (except in transient BRAO).

    [0139] Current Management of Branch Retinal Artery Occlusion

    [0140] Permanent BRAO currently may not be treated if the perifoveolar vessels are not threatened. Transient BRAO may not require treatment, because it often does not cause noticeable visual changes and the occlusion resolves on its own. Treatments similar to those used to restore vascular flow in CRAO have been reported, but have not been shown to be more effective than natural history. Additionally, more invasive treatments to remove the emboli can carry significant complications and risk that may be out of proportion to the usually minor visual field defects.

    [0141] Treatment of non-arteritic CLRAO can follow that of CRAO treatment. However, it has been reported that the available treatment options may not be better than natural history.

    [0142] In a similar fashion to arteritic-CRAO, arteritic-CLRAO can be treated with systemic steroids.

    [0143] Loss of Retinal Ganglion Cells

    [0144] It has been reported that the inner layer of the retina consumes oxygen and glucose more rapidly than almost any other tissue and the inner layer of the retina has the greatest sensitivity to hypoxic challenges compared to the outer layer of the retina. The central retinal artery is the sole source of blood to the retinal ganglion cells (ROGCs) in the inner layer of the retina. RGCs can be highly sensitive to acute, transient and even mild local and systemic hypoxic stress. Acute occlusion of the central retinal artery can result in an acute loss of oxygen and nutrients. During RAO, inner retinal layer edema and pyknosis of the ganglion cell nuclei can be seen. If reperfusion is not restored quickly, RGCs can be lost through both apoptosis and necrosis.

    [0145] RGCs are the neurons that transfer visual information from the eye to the brain. The axons of the RGCs bundle to make up the optic nerve. The optic disc is the point where the optic nerve emerges from the retina and it is also where the major blood vessels enter that supply the retina.

    [0146] Biopolar retinal cells can release glutamate to bind to glutamate receptors on RGCs. When the proper threshold is reached, RGCs can depolarize. Interestingly, RGCs are reported to be the only retinal cells that can produce an action potential, and it is via this action potential that visual information can be transmitted to the brain through the optic nerve. Under hypoxic stress however, excess glutamate can be produced. Hyperexcitability of the RGCs results, which can cause a cascade of biochemical effects such as neuronal nitric oxide synthase (NOS) activation and increases in Ca.sup.2+. These have been shown to be contributing factors for RGC loss.

    [0147] Natural History of Untreated Retinal Artery Occlusion

    [0148] The prognosis for future visual acuity in acute RAO can be dependent on the duration of occlusion. The prognosis for visual acuity recovery can be good for acute CRAO if blood flow is restored expeditiously. Permanent CRAO can have a poor prognosis and little if any improvement typically occurs over time. For example, even though about 22% of cases have reported spontaneous improvements in permanent non-arteritic CRAO, less than 10% have been reported to have had any meaningful recovery of vision.

    [0149] Difficulty in Diagnosis and Treatment

    [0150] In a study, transient CRAO in elderly, atherosclerotic, hypertensive rhesus monkeys has been evaluated by clamping the CRA in four groups of animals for the durations of 97, 105-120, 150-165, and ≧180 mins respectively. The results of this study showed that irreversible damage begins about 97 minutes following CRAO. Additionally, the damage increased in magnitude the longer the duration of the CRAO. Based on this study and other data evaluated, the ideal therapeutic window may be less than 3 hours but up to no more than 6.5 hours in cases of complete occlusion. Therapy may work beyond 6.5 hours if the occlusion is incomplete.

    [0151] Unfortunately patients are not always seen in this rather short, ideal treatment window for treatments to be the most effective in recovering visual acuity by restoring perfusion.

    [0152] Additionally, in the case of BRAO, current standard treatments may not be better than the natural history of untreated BRAO. Furthermore, invasive treatments aimed at emboli removal can carry significant complications.

    [0153] Debilitating Nature of Monocular Vision Loss

    [0154] In permanent CRAO, reported final visual acuity for 80% of patients can be counting fingers or worse (20/200-20/400) in the affected eye. The resulting blindness in one eye can have significant impact on the patient's activities of daily living and initial quality of life following the acute monocular blindness. The brain uses kinesthetic cues arising from the convergence (binocular—eye aiming) and accommodation (focusing) to assist with orientation in space. Therefore, loss of vision in one eye can cause impairment in spatial orientation. This can have further impact on depth perception, balance, eye-hand coordination, and other visual based motor skills resulting in clumsiness, difficulty in maneuvering around objects when walking, driving, sports, and ability to do hobbies. Not surprisingly those individuals with sudden monocular vision loss can be at an increased risk of accidents in comparison to binocular sighted individuals.

    [0155] These changes may render an individual unable to perform in occupations that require close work or involve vehicle operation. They may additionally have challenges or be required to give up certain hobbies and sports activities. Further, self-image may be affected.

    [0156] It can be additionally important for the patient to take steps to protect the one good eye such as wearing protective eyewear.

    [0157] Current Approached to Treatment

    [0158] The goal of current treatment approaches can be to reperfuse the ischemic tissue as quickly as possible by removing the occlusion and then to institute secondary prevention early. Therefore management can be broken down to 3 stages. The focus of acute CRAO treatment can be to restore ocular perfusion. In the subacute stage treatment can be focused on preventing secondary neovascular glaucoma complications. Long-term management can be focused on preventing other vascular ischemic events to the eye or other end organs.

    [0159] Standard treatments can include reducing intraocular pressure, ocular massage, vasodilators, hemodilution, hyperbaric oxygen, steroids, and use of anticoagulants such as heparin and aspirin. Arteritic CRAO and BRAO types can be treated with steroids.

    [0160] Cases of BRAO are not usually treated since current treatment options have not proven to be better than natural history and more invasive treatments carry significant potential complications. Table 22 outlines the most common treatments for permanent non-arteritic CRAO.

    TABLE-US-00001 TABLE 22 Current Treatment Options for Permanent Non-Arteritic CRAO Treatment Goal Treatment Options Increase blood oxygen Vasodilators: Pentoxyphyline, inhalation of carbogen, hyperbaric oxygen, sublingual isosorbide dinitrite Reduce intraocular pressure Ocular massage (increase retinal artery Intravenous acetazolamide perfusion or dislodge the Intravenous mannitol occlusion) Topical antiglaucoma drops Anterior chamber paracentisis Reduce retinal edema Intravenous methylprednisolone Lyse or dislodge clot Nd YAG laser Pars plana vitrectomy Thrombolysis of embolus Tissue plasminogen activator (tPA) (intravenous or intra-arterial) Neovascularization Panretinal photocoagulation

    [0161] The above treatment options can also be used in non-arteritic CLRAO cases.

    [0162] The currently available treatments are aimed at opening the occluded artery before irreversible damage occurs to the RGCs. The therapeutic maneuvers may not be effective and may not result in improved visual acuity above that seen in natural history studies. Part of the problem can be the long time it may take for patients to be seen after the time of onset. However, even when seen promptly, most therapy may not be highly effective. For example, the use of very aggressive anti-thrombotic therapy, such as intra-arterial injection with tPA, can have a very narrow treatment initiation window that may be missed by many patients and invasive treatments aimed at emboli removal can carry significant complications. For BRAO, current standard treatments have not been shown to be any better than natural history.

    [0163] However, it is also clear that the occlusions can resolve spontaneously over time and the ability to support the prolonged survival of RGCs in the face of acute CRAO may result in the restoration of vision. Currently there is no effective neuroprotective agent available for the treatment of acute retinal ischemia. Furthermore, there is no effective treatment available to increase the retinal tolerance time. The use of MANF Family Proteins (e.g., MANF, CDNF, and fragments thereof) may offer a novel approach to this problem. MANF family proteins can also be used prophylactically.

    [0164] MANF Family Proteins

    [0165] Neurotrophic factors are small proteins that are synthesized and released predominantly by glial cells that induce neurons to up-regulate survival programs that help protect the cells from apoptosis. One of these neurotrophic factors, mesencephalic astrocyte-derived neurotrophic factor (MANF (NM_006010 (mRNA); NP_006001 (protein); US Pub Appln No. 20090282495)), is an 18 kDa secreted protein. Conserved dopaninergic neurotrophic factor (CDNF (NM_001029954 (mRNA); NP_001025125 (protein)) is the second member of the MANF family of proteins to be discovered.

    [0166] The endoplasmic reticulum (ER) can be a key site of protein synthesis, folding, and export. Additionally, the ER can be important for intracellular calcium homeostasis and cell death signaling activation. ER quality control mechanisms monitor protein folding and can prevent the transport and secretion of immature proteins.

    [0167] Misfolded proteins can be discarded by ER-associated degradation. When ER stress overwhelms the capacity of the quality control system, unfolded or misfolded proteins can accumulate in the ER. Various stimuli, including hypoxia can cause accumulation of unfolded or misfolded proteins triggering ER stress. ER stress sensor proteins can activate an intracellular signal transduction pathway called the unfolded protein response (UPR). The UPR can increase the expression of several target genes to attempt to restore ER homeostasis. The functions of UPR target genes can vary broadly, and can include protein folding helpers (e.g., chaperones); or proteins involved in glycosylation, oxidative stress response, protein trafficking, lipid biosynthesis or ER-associated degradation. However, the apoptotic signaling pathway can be initiated if the UPR is unable to restore homeostasis in order to remove an unhealthy cell.

    [0168] MANF was initially described as a member of a new class of neurotrophic factors that selectively promote survival and sprouting of cultured dopaminergic neurons. Anti-apoptotic and neurotrotrophic activities of MANF have been demonstrated in vitro, in the developing brain of Drosophila and Zebrafish, in several rodent models of Parkinson's disease and ischemic brain injury, as well as in other tissues outside the central nervous system. MANF can be expressed in the retina during early post-natal development, and has been observed to peak at post-natal day 10 and then steadily decreases as the retina matures.

    [0169] MANF was initially isolated from a cell-line that constitutively expressed and secreted MANF, but regulation of expression and secretion of MANF was mostly studied in the context of the cellular stress response. MANF has also been identified as an UPR target gene. In a subsequent microarray study of genes induced by the UPR, MANF was reported to be one of twelve regulated proteins. The MANE promoter contains an ER stress response element, ERSE-II, that can be activated by known ER stressors like tunicamycin and thapsigargin. Induction of MANF expression by ER stressors has been demonstrated in several independent studies in numerous cell lines.

    [0170] Recombinant MANF has been reported to have fully protected primary mixed cortical/hippocampal neuronal cultures that were exposed to the ER stressor tunicamycin. This was shown by quantification of terminal deoxynucleotidyl transferase mediated dUTP nick-end labeling (TUNEL)-positive cells as a marker of apoptosis. Hence, MANF can not only be expressed in response to ER stress, but also, recombinant MANF can counteract apoptosis induced by an ER stressor.

    [0171] Ischemia can lead to ER stress. MANF expression can be induced by ischemic conditions, including ischemia of the heart and the brain.

    [0172] A commonly used model to investigate ischemia of the brain is transient middle-cerebral artery occlusion (tMCAO), representing the acute, transient nature of the disruption of arterial blood supply to the brain. Administration of MANF in a tMCAO model reduced infract size on day 2 (50%) and enhanced functional recovery on day 7 compared to vehicle treated animals. The anti-apoptotic effects of MANF were shown through significantly reduced TUNEL pixel density at the site proximal to MANF injection. In an experimental stroke study, MANF was expressed in the cortex using an AAV-based vector and animals were subjected to tMCAO. Infarct size was reduced by 40% and again early effects on functional recovery were observed.

    [0173] Presented herein are the results of a study using MANF in an animal model of acute retinal ischemia-induced ganglion cell degeneration in the rat eye. The results presented herein support the idea that MANF can preserve inner retinal function and can protect retinal ganglion cells against apoptosis

    [0174] Mature, secreted human MANF is a helical protein with a length of 158 amino acid residues. See Table I (SEQ ID NO:3) and FIG. 2 for MANF's protein sequence and three dimensional structure, respectively. The N-terminal domain (N-domain) of MANF (encompassing residues L20-L120) is entirely helical, with four ca-helices and a rare structural element, a π helix, immediately followed by a 3.sub.10 helix.

    [0175] The C-terminal domain (C-domain) of MANF encompasses residues T126-L158. This domain is also entirely helical and contains one disulfide bond between conserved cysteines in the CXXC motif between α-helices 5 and 6. The CXXC motif is a consensus sequence of proteins of the thiol-protein oxidoreductase superfamily, other members of which include thioredoxins, glutaredoxins, and peroxiredoxins. Common to this enzyme superfamily is that all members are involved in disulfide mediated redox reactions and glutathione metabolism in which the CXXC domain takes center stage. The MANF C-domain is structurally similar to SAP-domains (SAF-A/B, Acinus, PLAS) and most similar to the SAP-domain of Ku70. Ku70 is a cytoplasmic protein with anti-apoptotic activity. Ku70 is associated with Bax, keeping the latter in an inactive conformation. Once Bax dissociates from Ku70 the mitochondrial cell death pathway can be activated.

    [0176] MANF also refers to any MANF family protein or active fragments thereof. The MANF family protein can be MANF, CDNF, or a fragment thereof. As used herein, MANEF or CNDF peptide comprises a protein having 70, 80, 85, 90, 95, 96, 97, 98, 99, or 100% homology (or identity) with the sequence of human: MANF or CDNF. In some embodiments, fragments of these proteins can include peptides with a length of about 4-40 amino acids; for example, about: 4-40, 4-35, 4-30, 4-25, 4-20, 4-15, 4-10, 5-40, 6-40, 7-40, 8-40, 5-35, 5-30, 5-25, 5-20, 5-15, 5-10, 6-35, 6-30, 6-30, 6-25, 6-20, 6-15, 6-10, 7-35, 7-30, 7-25, 7-20, 7-15, 7-10, 8-35, 8-30, 8-25, 8-20, or 8-15 amino acids. For example, the peptide can consist of 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 amino acids.

    [0177] MANF family proteins can be glycosylated. MANF family proteins can be non-glycosylated.

    [0178] Either MANE or CDNF can be the pro-form, which contains a signal sequence, or the mature, secreted form in which the signal sequence is cleaved off.

    [0179] MANF family proteins can be a pro-form of MANF or an active fragment thereof. For example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 80% identity with SEQ ID NO: 1. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 90% identity with SEQ ID NO: 1. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 95% identity with SEQ ID NO: 1. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 97% identity with SEQ ID NO: 1. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has 100% identity with SEQ ID NO: 1. In any of these examples, the MANF family protein can have a length that is at least about 5% the length of SEQ ID NO: 1. In any of these examples, the MANF family protein can have a length that is at least about 50% the length of SEQ ID NO: 1. In any of these examples, the MANF family protein can have a length that is at least about 80% the length of SEQ ID NO: 1. In any of these examples, the MANF family protein can have a length that is at least about 90% the length of SEQ ID NO: 1. In any of these examples, the MANF family protein can have a length that is the same length as SEQ ID NO: 1. The MANF family protein, in any of these examples can also have a maximum length. The maximum length can be, e.g., 100%, 90%, 80%, 70%, 60%, 50%, or 25% the length of SEQ ID NO: 1.

    [0180] MANF family proteins can be a pro-form of MANF or an active fragment thereof. For example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 80% identity with SEQ ID NO: 2. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 90% identity with SEQ ID NO: 2. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 95% identity with SEQ ID NO: 2. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 97% identity with SEQ ID NO: 2. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has 100% identity with SEQ ID NO: 2. In any of these examples, the MANF family protein can have a length that is at least about 5% the length of SEQ ID NO: 2. In any of these examples, the MANF family protein can have a length that is at least about 50% the length of SEQ ID NO: 2. In any of these examples, the MANF family protein can have a length that is at least about 80% the length of SEQ ID NO: 2. In any of these examples, the MANE family protein can have a length that is at least about 90% the length of SEQ ID NO: 2. In any of these examples, the MANF family protein can have a length that is the same length as SEQ ID NO: 2. The MANF family protein, in any of these examples can also have a maximum length. The maximum length can be, e.g., 100%, 90%, 80%, 70%, 60%, 50%, or 25% the length of SEQ ID NO: 2.

    [0181] MANF family proteins can be a mature or secreted form of MANE, or an active fragment thereof. For example, the peptide sequence of the MANE family protein can comprise or consist of a sequence that has at least about 80% identity with SEQ ID NO: 3. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 90% identity with SEQ ID NO: 3. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 95% identity with SEQ ID NO: 3. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 97% identity with SEQ ID NO: 3. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has 100% identity with SEQ ID NO: 3. In any of these examples, the MANF family protein can have a length that is at least about 5% the length of SEQ ID NO: 3. In any of these examples, the MANF family protein can have a length that is at least about 50% the length of SEQ ID NO: 3. In any of these examples, the MANF family protein can have a length that is at least about 80% the length of SEQ ID NO: 3. In any of these examples, the MANEF family protein can have a length that is at least about 90% the length of SEQ ID NO: 3. In any of these examples, the MANF family protein can have a length that is the same length as SEQ ID NO: 3. The MANF family protein, in any of these examples can also have a maximum length. The maximum length can be, e.g., 100%, 90%, 80%, 70%, 60%, 50%, or 25% the length of SEQ ID NO: 3.

    [0182] MANF family proteins can be a synthetic form of MANF, or an active fragment thereof. The synthetic form of MANF contains a non-natural N-terminal methionine. The N-terminal methionine can enable production of the synthetic form of MANF in cell lines lacking the post-translational modification machinery to process the pro-form of MANF to the secreted or mature form of MANF. For example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 80% identity with SEQ ID NO: 4. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 90% identity with SEQ ID NO: 4. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 95% identity with SEQ ID NO: 4. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 97% identity with SEQ ID NO: 4. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has 100% identity with SEQ ID NO: 4. In any of these examples, the MANF family protein can have a length that is at least about 5% the length of SEQ ID NO: 4. In any of these examples, the MANF family protein can have a length that is at least about 50% the length of SEQ ID NO: 4. In any of these examples, the MANF family protein can have a length that is at least about 80% the length of SEQ ID NO: 4. In any of these examples, the MANF family protein can have a length that is at least about 90% the length of SEQ ID NO: 4. In any of these examples, the MANF family protein can have a length that is the same length as SEQ ID NO: 4. The MANF family protein, in any of these examples can also have a maximum length. The maximum length can be, e.g., 100%, 90%, 80%, 70%, 60%, 50%, or 25% the length of SEQ ID NO: 4.

    TABLE-US-00002 TABLE 1 Human MANF Protein Sequences ASCESSION SEQ ID NAME Number SEQUENCE SEQ ID Human Pro- NP_006001 MRRMRRMWAT QGLAVALALS VLPGSRALRP GDCEVCISYL NO: 1 MANF GRFYQDLKDR DVTFSPATIE NELIKFCREA RGKENRLCYY IGATDDAATK IINEVSKPLA HHIPVEKICE KLKKKDSQIC ELKYDKQIDL STVDTKKLRV KELKKILDDW GETCKGCAEK SDYIRKINEL MPKYAPKAAS ARTDL SEQ ID Human Pro- MWATQGLAVA LALSVLPGSR ALRPGDCEVC ISYLGRFYQD  NO: 2 MANE LKDRDVTFSP ATIENELIKF CREARGKENR LCYYIGATDD AATKIINEVS KPLAHHIPVE KICEKLKKKD SQICELKYDK QIDLSTVDLK KLRVKELKKI LDDWGETCKG CAEKSDYIRK INELMPKYAP KAASARTDL SEQ ID Human MANF LRPGDCEVCI SYLGRFYQDL KDRDVTFSPA TIENELIKFC NO: 3 (Secreted REARGKENRL CYYIGATDDA ATKIINEVSK PLAHHIPVEK Form) ICEKLKKKDS QICELKYDKQ IDLSTVDLKK LRVKELKKIL DDWGETCKGC AEKSDYIRKI NELMPKYAPK AASARTDL SEQ ID Human MLRPGDCEVC ISYLGRFYQD LKDRDVTFSP ATIENELIKF NO: 4 Synthetic CREARGKENR LCYYIGATDD AATKIINEVS KPLAHHIPVE MANF KICEKLKKKD SQICELKYDK QIDLSTVDLK KLRVKELKKI LDDWGETCKG CAEKSDYIRK INELMPKYAP KAASARTDL

    [0183] MANF family proteins can be a pro-form of CDNF, or an active fragment thereof. For example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 80% identity with SEQ ID NO: 5. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 90% identity with SEQ ID NO: 5. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 95% identity with SEQ ID NO: 5. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 97% identity with SEQ ID NO: 5. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has 100% identity with SEQ ID NO: 5. In any of these examples, the MANF family protein can have a length that is at least about 5% the length of SEQ ID NO: 5. In any of these examples, the MANF family protein can have a length that is at least about 50% the length of SEQ ID NO: 5. In any of these examples, the MANF family protein can have a length that is at least about 80% the length of SEQ ID NO: 5. In any of these examples, the MANF family protein can have a length that is at least about 90% the length of SEQ ID NO: 5. In any of these examples, the MANF family protein can have a length that is the same length as SEQ ID NO: 5. The MANF family protein, in any of these examples can also have a maximum length. The maximum length can be, e.g., 100%, 90%, 80%, 70%, 60%, 50%, or 25% the length of SEQ ID NO: 5.

    [0184] MANF family proteins can be a mature or secreted form of CDNF, or an active fragment thereof. For example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 80% identity with SEQ ID NO: 6. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 90% identity with SEQ ID NO: 6. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 95% identity with SEQ ID NO: 6. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 97% identity with SEQ ID NO: 6. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has 100% identity with SEQ ID NO: 6. In any of these examples, the MANF family protein can have a length that is at least about 5% the length of SEQ ID NO: 6. In any of these examples, the MANF family protein can have a length that is at least about 50% the length of SEQ ID NO: 6. In any of these examples, the MANF family protein can have a length that is at least about 80% the length of SEQ ID NO: 6. In any of these examples, the MANF family protein can have a length that is at least about 90% the length of SEQ ID NO: 6. In any of these examples, the MANF family protein can have a length that is the same length as SEQ ID NO: 6. The MANF family protein, in any of these examples can also have a maximum length. The maximum length can be, e.g., 100%, 90%, 80%, 70%, 60%, 50%, or 25% the length of SEQ ID NO: 6.

    [0185] MANF family proteins can be a synthetic form of CDNF, or an active fragment thereof. The synthetic form of CDNF contains a non-natural N-terminal methionine. The N-terminal methionine can enable production of the synthetic form of CDNF in cell lines lacking the post-translational modification machinery to process the pro-form of CDNF to the secreted or mature form of CDNF. For example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 80% identity with SEQ ID NO: 7. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 90% identity with SEQ ID NO: 7. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 95% identity with SEQ ID NO: 7. In another example, the peptide sequence of the MANF family protein can comprise or consist of a sequence that has at least about 97% identity with SEQ ID NO: 7. In another example, the peptide sequence of the MANE family protein can comprise or consist of a sequence that has 100% identity with SEQ ID NO: 7. In any of these examples, the MANF family protein can have a length that is at least about 5% the length of SEQ ID NO: 7. In any of these examples, the MANF family protein can have a length that is at least about 50% the length of SEQ ID NO: 7. In any of these examples, the MANF family protein can have a length that is at least about 80% the length of SEQ ID NO: 7. In any of these examples, the MANF family protein can have a length that is at least about 90% the length of SEQ ID NO: 7. In any of these examples, the MANF family protein can have a length that is the same length as SEQ ID NO: 7. The MANF family protein, in any of these examples can also have a maximum length. The maximum length can be, e.g., 100%, 90%, 80%, 70%, 60%, 50%, or 25% the length of SEQ ID NO: 7.

    TABLE-US-00003 TABLE 2 Human CDNF Protein Sequences ASCESSION SEQ ID NAME Number SEQUENCE SEQ ID Human CDNF NP_001025125 MWCASPVAVV AFCAGLLVSH PVLTQGQEAG GRPGADCEVC NO: 5 Precursor KEFLNRFYKS LIDRGVNFSL DTIEKELISF CLDTKGKENR LCYYLGATKD AATKILSEVT RPMSVHMPAM KICEKLKKLD SQICELKYEK TLDLASVDLR KMRVAELKQI LHSWGEECRA CAEKTDYVNL IQELAPKYAA THPKTEL SEQ ID Human CDNF QEAGGRPGAD CEVCKEFLNR FYKSLIDRGV NFSLDTIEKE NO: 6 (Mature) LSIFCLDTKG KENRLCYYLG ATKDAATKIL SEVTRPMSVH MPAMKICEKL KKLDSQICEL KYEKTLDLAS VDLRKMRVAE LKQILHSWGE ECRACAEKTD YVNLIQELAP KYAATHPKTE L SEQ ID Human MQEAGGRPGA DCEVCKEFLN RFYKSLIDRG VNFSLDTIEK NO: 7 Synthetic ELISFCLDTK GKENRLCYYL GATKDAATKI LSEVTRPMSV CDNF HMPAMKICEK LKKLDSQICE LKYEKTLDLA SVDLRKMRVA ELKQILHSWG EECRACAEKT DYVNLIQELA PKYAATHPKT EL

    [0186] Active fragments of MANF or CDNF can include short peptides with a length of about 4-40 amino acids; for example, about: 4-40, 4-35, 4-30, 4-25, 4-20, 4-15, 4-10, 5-40, 6-40, 7-40, 8-40, 5-35, 5-30, 5-25, 5-20, 5-15, 5-10, 6-35, 6-30, 6-25, 6-20, 6-15, 6-10, 7-35, 7-30, 7-25, 7-20, 7-15, 7-10, 8-35, 8-30, 8-25, 8-20, or 8-15 amino acids. For example, the preferred peptides can consist of 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 amino acids. The peptides may comprise any of the naturally occurring amino acids such as alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine as well as non-conventional or modified amino acids. The peptide can have 70, 80, 85, 90, 95, 96, 97, 98, 99, or 100% homology (or identity) with the sequence of human CDNF or MANF protein. In some embodiments, the peptides comprise the sequence CXXC. In some embodiments, the peptides comprise the sequence CKGC (SEQ ID NO:94) or CRAC (SEQ ID NO:183) (see, e.g., WO 2013/034805). These peptides can be cell permeable. Active fragments of MANF can include any of the short peptides disclosed in Table 3. Active fragments of CDNF can include any of the short peptides disclosed in Table 4.

    TABLE-US-00004 TABLE 3 Short peptides of human MANF. SEQ ID NO SEQUENCE SEQ ID NO: 8 ILDDWGETCKGCAEKSDYIRKINELMPKYAPKAAS ARTDL SEQ ID NO: 9 LDDWGETCKGCAEKSDYIRKINELMPKYAPKAASA RTDL SEQ ID NO: 10 DDWGETCKGCAEKSDYIRKINELMPKYAPKAASAR TDL SEQ ID NO: 11 DWGETCKGCAEKSDYIRKINELMPKYAPKAASART DL SEQ ID NO: 12 WGETCKGCAEKSDYIRKINELMPKYAPKAASARTD L SEQ ID NO: 13 GETCKGCAEKSDYIRKINELMPKYAPKAASARTDL SEQ ID NO: 14 ETCKGCAEKSDYIRKINELMPKYAPKAARTDL SEQ ID NO: 15 TCKGCAEKSDYIRKINELMPKYAPKAASARTDL SEQ ID NO: 16 CKGCAEKSDYIRKINELMPKYAPKAASARTDL SEQ ID NO: 17 CKGCAEKSDYIRKIN SEQ ID NO: 18 TCKGCAEKSDYIRKI SEQ ID DO: 19 ETCKGCAEKSDYIRK SEQ ID NO: 20 GETCKGCAEKSDYIR SEQ ID NO: 21 WGETCKGCAEKSDYI SEQ ID NO: 22 DWGETCKGCAEKSDY SEQ ID NO: 23 DDWGETCKGCAEKSD SEQ ID NO: 24 LDDWGETCKGCAEKS SEQ ID NO: 25 ILDDWGETCKCAEK SEQ ID NO: 26 KILDDWGETCKGCAE SEQ ID NO: 27 KKILDDWGETCKGCA SEQ ID NO: 28 LKKILDDWGETCKGC SEQ ID NO: 29 CKGCAEKSDYIRKI SEQ ID NO: 30 TCKGCAEKSDYIRK SEQ ID NO: 31 ETCKGCAEKSDYIR SEQ ID NO: 32 GETCKGCAEKSDYI SEQ ID NO: 33 WGETCKGCAEKSDY SEQ ID NO: 34 DWGETCKGCAEKSD SEQ ID NO: 35 DDWGETCKGCAEKS SEQ ID NO: 36 LDDWGETCKGCAEK SEQ ID NO: 37 ILDDWGETCKGCAE SEQ ID NO: 38 KILDDWGETCKGCA SEQ ID NO: 39 KKILDDWGETCKGC SEQ ID NO: 40 CKGCAEKSDYIRK SEQ ID NO: 41 TCKGCAEKSDYIR SEQ ID NO: 42 ETCKGCAEKSDYI SEQ ID NO: 43 GETCKGCAEKSDY SEQ ID NO: 44 WGETCKGCAEKSD SEQ ID NO: 45 DWGETCKGCAEKS SEQ ID NO: 46 DDWGETCKGCAEK SEQ ID NO: 47 LDDWGETCKGCAE SEQ ID NO: 48 ILDDWGETCKGCA SEQ ID NO: 49 KILDDWGETCKGC SEQ ID NO: 50 CKGCAEKSDYIR SEQ ID NO: 51 TCKGCAEKSDYI SEQ ID NO: 52 ETCKGCAEKSDY SEQ ID NO: 53 GETCKGCAEKSD SEQ ID NO: 54 WGETCKGCAEKS SEQ ID NO: 55 DWGETCKGCAEK SEQ ID NO: 56 DDWGETCKGCAE SEQ ID NO: 57 LDDWGETCKGCA SEQ ID NO: 58 ILDDWGETCKGC SEQ ID NO: 59 CKGCAEKSDYI SEQ ID NO: 60 TCKGCAEKSDY SEQ ID NO: 61 ETCKGCAEKSD SEC ID NO: 62 GETCKGCAEKS SEQ ID NO: 63 WGETCKGCAEK SEQ ID NO: 64 DWGETCKGCAE SEQ ID NO: 65 DDWGETCKGCA SEQ ID NO: 66 LDDWGETCKGC SEQ ID NO: 67 CKGCAEKSDY SEQ ID NO: 68 TCKGCAEKSD SEC ID NO: 69 ETCKGCAEKS SEQ ID NO: 70 GETCKGCAEK SEQ ID NO: 71 WGETCKGCAE SEQ ID NO: 72 DWGETCKGCA SEQ ID NO: 73 DDWGETCKGC SEQ ID NO: 74 CKGCAEKSD SEQ TD NO: 75 TCKGCAEKS SEC ID NO: 76 ETCKGCAEK SEQ ID NO: 77 GETCKGCAE SEQ ID NO: 78 WGETCKGCA SEQ ID NO: 79 DWGETCKGC SEQ ID NO: 80 CKGCAEKS SEQ ID NO: 81 TCKGCAEK SEQ ID NO: 82 ETCKGCAE SEC ID NO: 83 GETCKGCA SEQ ID NO: 84 WGETCKGC SEQ ID NO: 85 CKGCAEK SEQ ID NO: 86 TCKGCNE SEQ ID NO: 87 ETCKGCA SEQ ID NO: 88 GETCKGC SEQ ID NO: 89 CKGCAE SEQ ID NO: 90 TCKGCA SEQ ID NO: 91 ETCKGC SEQ ID NO: 92 CKGCA SEQ ID NO: 93 TCKGC SEQ ID NO: 94 CKGC

    TABLE-US-00005 TABLE 4 Short peptides of human CDNF. SEQ ID NO SEQUENCE SEQ ID NO: 95 KQILHSWGEECRACAEKTDYVNLIQELAPKYAA THPKTEL SEQ ID NO: 96 QILHSWGEECRACAEKTDYVNLIQELAPKYAAT HPKTEL SEQ ID NO: 97 ILHSWGEECRACAEKTDYVNLIQELAPKYAATH PKTEL SEQ ID NO: 98 LHSWGEECRACAEKTDYVNLIQELAPKYAATHP KTEL SEQ ID NO: 99 HSWGEECRACAEKTDYVNLIQELAPKYAATHPK TEL SEQ ID NO: 100 SWGEECRACAEKTDYVNLIQELAPKYAATHPKT EL SEQ ID NO: 101 WGEECRACAEKTDYVNLIQELAPKYAATHPKTE L SEQ ID NO: 102 GEECRACAEKTDYVNLIQELAPKYAATHPKTEL SEQ ID NO: 103 EECRACAEKTDYVNLIQELAPKYAATHPKTEL SEQ ID NO: 104 ECRACAEKTDYVNLIQELAPKYAATHPKTEL SEQ ID NO: 105 CRACAEKTDYVNLIQELAPKYAATHPKTEL SEQ ID NO: 106 LKQILHSWGEECRAC SEQ ID NO: 107 KQILHSWGEECRACA SEQ ID NO: 108 QILHSWGEECRACAE SEQ ID NO: 109 ILHSWGEECRACAEK SEQ ID NO: 110 LHSWGEECRACAEKT SEQ ID NO: 111 HSWGEECRACAEKTD SEQ ID NO: 112 SWGEECRACAEKTDY SEQ ID NO: 113 WGEECRACAEKTDYV SEQ ID NO: 114 GEECRACAEKTDYVN SEQ ID NO: 115 EECRACAEKTDYVNL SEQ ID NO: 116 ECRACAEKTDYVNLI SEQ ID NO: 117 CRACAEKTDYVNLIQ SEQ ID NO: 118 KQILHSWGEECRAC SEQ ID NO: 119 QILHSWGEECRACA SEQ ID NO: 120 ILHSWGEECRACAE SEQ ID NO: 121 LHSWGEECRACEK SEQ ID NO: 122 HSWGEECRACAEKT SEQ ID NO: 123 SWGEECRACAEKTD SEQ ID NO: 124 WGEECRACAEKTDY SEQ ID NO: 125 GEECRACAEKTDYV SEQ ID NO: 126 EECRACAEKTDYVN SEQ ID NO: 127 ECRACAEKTDYVNL SEQ ID NO: 128 CRACAEKTDYVNLI SEQ ID NO: 129 QILHSWGEECRAC SEQ ID NO: 130 ILHSWGEECRACA SEQ ID NO: 131 LHSWGEECRACAE SEQ ID NO: 132 HSWGEECRACAEK SEQ ID NO: 133 SWGEECRACAEKT SEQ ID NO: 134 WGEECRACAEKTD SEQ ID NO: 135 GEECRACAEKTDY SEQ ID NO: 136 EECRACAEKTDYV SEQ ID NO: 137 ECRACAEKTDYVN SEQ ID NO: 138 CRACAEKTDYVNL SEQ ID NO: 139 ILHSWGEECRAC SEQ ID NO: 140 LHSWGEECRACA SEQ ID NO: 141 HSWGEECRACAE SEQ ID NO: 142 SWGEECRACAEK SEQ ID NO: 143 WGEECRACAEKT SEQ ID NO: 144 GEECRACAEKTD SEQ ID NO: 145 EECRACAEKTDY SEQ ID NO: 146 ECRACAEKTDYV SEQ ID NO: 147 CRACAEKTDYVN SEQ ID NO: 148 LHSWGEECRAC SEQ ID NO: 149 HSWGEECRACA SEQ ID NO: 150 SWGEECRACAE SEQ ID NO: 151 WGEECRACAEK SEQ ID NO: 152 GEECRACAEKT SEQ ID NO: 153 EECRACAEKTD SEQ ID NO: 154 ECRACAEKTDY SEQ ID NO: 155 CRACAEKTDYV SEQ ID NO: 156 HSWGEECRAC SEQ ID NO: 157 SWGEECRACA SEQ ID NO: 158 WGEECRACAE SEQ ID NO: 159 GEECRACAEK SEQ ID NO: 160 EECRACAEKT SEQ ID NO: 161 ECRACAEKTD SEQ ID NO: 162 CRACAEKTDY SEQ ID NO: 163 SWGEECRAC SEQ ID NO: 164 WGEECRACA SEQ ID NO: 165 GEECRACAE SEQ ID NO: 166 EECRACAEK SEQ ID NO: 167 ECRACAEKT SEQ ID NO: 168 CRACAEKTD SEQ ID NO: 169 WGEECRAC SEQ ID NO: 170 GEECRACA SEQ ID NO: 171 EECRACAE SEQ ID NO: 172 ECRACAEK SEQ ID NO: 173 CRACAEKT SEQ ID NO: 174 GEECRAC SEQ ID NO: 175 EECRACA SEQ ID NO: 176 ECRACAE SEQ ID NO: 177 CRACAEK SEQ ID NO: 178 EECRAC SEQ ID NO: 179 ECRACA SEQ ID NO: 180 CRACAE SEQ ID NO: 181 ECRAC SEQ ID NO: 182 CRACA SEQ ID NO: 183 CRAC

    [0187] The peptides can be conjugated to a detectable chemical or biochemical moiety such as a FITC-label. As used herein, a “detectable chemical or biochemical moiety” means a tag that exhibits an amino acid sequence or a detectable chemical or biochemical moiety for the purpose of facilitating detection of the peptide; such as a detectable molecule selected from among: a visible, fluorescent, chemiluminescent, or other detectable dye; an enzyme that is detectable in the presence of a substrate, e.g., an alkaline phosphatase with NBT plus BCIP or a peroxidase with a suitable substrate; a detectable protein, e.g., a green fluorescent protein. Preferably, the tag does not prevent or hinder the penetration of the peptide into the target cell.

    [0188] Pharmaceutical Compositions

    [0189] The active ingredients can be provided in a pharmaceutical composition. The pharmaceutical composition can comprise pharmaceutically acceptable diluent(s), excipient(s), or carrier(s). The pharmaceutical compositions can include other medicinal or pharmaceutical agents, carriers, adjuvants, such as preserving, stabilizing, wetting or emulsifying agents, solution promoters, salts for regulating the osmotic pressure, and/or buffers. Methods well known in the art for making formulations are to be found in, for example. Remington: The Science and Practice of Pharmacy, (20th ed.) ed. A. R. Gennaro A R., 2000, Lippencott Williams & Wilkins.

    [0190] It will be evident to those skilled in the art that the number and frequency of administration will be dependent upon the response of the host. “Pharmaceutically acceptable carriers” for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remingtons Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985). For example, sterile saline and phosphate-buffered saline at physiological pH may be used. Preservatives, stabilizers, dyes and even flavoring agents may be provided in the pharmaceutical composition. For example, sodium benzoate, sorbic acid and esters of p-hydroxybenzoic acid may be added as preservatives. In addition, antioxidants and suspending agents may be used.

    [0191] The pharmaceutical compositions may be in any form that allows for the composition to be administered to a patient. For example, the composition may be in the form of a solid, liquid or gas (aerosol). Typical routes of administration include, without limitation, oral, topical, parenteral (e.g., sublingually or buccally), sublingual, rectal, vaginal, and intranasal (e.g., as a spray) and also subcutaneous injections, intravenous, intramuscular, intrasternal, intracavernous, intrathecal, intrameatal, intraurethral injection or infusion techniques.

    [0192] Pharmaceutical compositions comprising a MANF family protein can be formulated for delivery to the eye. For example, the pharmaceutical compositions can be formulated for topical administration, intravitreal administration, intracameral administration, subconjunctival administration, subtenon administration, retrobulbar administration, posterior juxtascleral administration, or a combination thereof. In some embodiments, the pharmaceutical compositions comprising the MANF family protein are formulated for topical administration. In some embodiments, the pharmaceutical compositions comprising the MANF family protein are formulated for intravitreal administration.

    [0193] The pharmaceutical compositions and formulations disclosed herein can comprise one or more pharmaceutically acceptable excipients. The pharmaceutically acceptable excipients can comprise acacia, acesulfame potassium, acetic acid glacial, acetone, acetyltributyl citrate, acetyltriethyl citrate, adipic acid, agar, albumnin, alcohol, alginic acid, aliphatic polyesters, alitame, almond oil, alpha tocopherol, aluminum hydroxide adjuvant, aluminum monostearate, aluminum oxide, aluminum phosphate adjuvant, ammonia solution, ammonium alginate, ammonium chloride, ascorbic acid, ascorbyl palmitate, aspartame, attapulgite, bentonite, benzalkonium chloride, benzethonium chloride, benzoic acid, benzyl alcohol, benzyl benzoate, boric acid, bronopol, butylated hydroxyanisole, butylated hydroxytoluene, butylene glycol, butylparabel, calcium acetate, calcium alginate, calcium carbonate, calcium chloride, calcium hydroxide, calcium lactate, calcium phosphate dibasic anhydrous, calcium phosphate dibasic dihydrate, calcium phosphate tribasic, calcium silicate, calcium stearate, calcium sulfate, canola oil, carbomer, carbon dioxide, carboxymethylcellulose calcium, carboxymethylcellulose sodium, carrageenan, castor oil, castor oil hydrogenated, cellulose microcrystalline, cellulose microcrystalline and carboxymethylcellulose sodium, cellulose powdered, cellulose silicified microcrystalline, cellulose acetate, cellulose acetate phthalate, ceratonia, ceresin, cetostearyl alcohol, cetrimide, cetyl alcohol, cetylpyridinium chloride, chitosan, chlorhexidine, chlorobutanol, chlorocresol, chlorodifluoroethane (hcfc), chlorofluorocarbons (cfc), chloroxylenol, cholesterol, citric acid monohydrate, coconut oil, colloidal silicon dioxide, coloring agents, copovidone, corn oil, corn starch and pregelatinized starch, cottonseed oil, cresol, croscarmellose sodium, crospovidone, cyclodextrins, cyclomethicone, denatonium benzoate, dextrates, dextrin, dextrose, dibutyl phthalate, dibutyl sebacate, diethanolamine, diethyl phthalate, difluoroethane (hfc), dimethicone, dimethyl ether, dimethyl phthalate, dimethyl sulfoxide, dimethylacetamiide, disodium edetate, docusate sodium, edetic acid, erythorbic acid, erythritol, ethyl acetate, ethyl lactate, ethyl maltol, ethyl oleate, ethyl vanillin, ethylcellulose, ethylene glycol stearates, ethylene vinyl acetate, ethylparaben, fructose, fumaric acid, gelatin, glucose liquid, glycerin, glyceryl behenate, glyceryl monooleate, glyceryl monostearate, glyceryl paimitostearate, glycine, glycofurol, guar gum, hectorite, heptafluoropropane (hfc), hexetidine, hydrocarbons (hc), hydrochloric acid, hydrophobic colloidal silica, hydroxyethyl cellulose, hydroxyethylmethyl cellulose, hydroxypropyl betadex, hydroxypropyl cellulose, hydroxypropyl cellulose low substituted, hydroxypropyl starch, hypromellose, hypromellose acetate succinate, hypromellose phthalate, imidurea, inulin, iron oxides, isomalt, isopropyl alcohol, isopropyl myristate, isopropyl palmitate, kaolin, lactic acid, lactitol, lactose anhydrous, lactose inhalation, lactose monohydrate, lactose monohydrate and corn starch, lactose monohydrate and microcrystalline cellulose, lactose monohydrate and povidone, lactose monohydrate and powdered cellulose, lactose spray dried, lanolin, lanolin hydrous, lanolin alcohols, lauric acid, lecithin, leucine, linoleic acid, macrogol 15 hydroxystearate, magnesium aluminum silicate, magnesium carbonate, magnesium oxide, magnesium silicate, magnesium stearate, magnesium trisilicate, maleic acid, malic acid, maititol, maltitol solution, maltodextrin, maltol, maltose, mannitol, medium chain triglycerides, meglumine, menthol, methionine, methylcellulose, methylparaben, mineral oil, mineral oil light, mineral oil and lanolin alcohols, monoethanolamine, monosodium glutamate, monothioglycerol, myristic acid, myristyl alcohol, neohesperidin dihydrochalcone, neotame, nitrogen, nitrous oxide, octyldodecanol, oleic acid, oleyl alcohol, olive oil, palmitic acid, paraffin, peanut oil, pectin, pentetic acid, petrolatum, petrolatum and lanolin alcohols, phenol, phenoxyethanol, phenylethyl alcohol, phenylhnercuric acetate, phenyhnercuric borate, phenylmercuric nitrate, phospholipids, phosphoric acid, polacrilin potassium, poloxamer, polycarbophil, polydextrose, poly (dl lactic acid), polyethylene glycol, polyethylene oxide, polymethacrylates, poly(methyl vinylether/maleic anhydride), poiyoxyethylene alkyl ethers, polyoxyethylene castor oil derivatives, polyoxyethylene sorbitan fatty acid esters, polyoxyethylene stearates, polyoxylglycerides, polyvinyl acetate phthalate, polyvinyl alcohol, potassium alginate, potassium alumn, potassiumn benzoate, potassium bicarbonate, potassiumn chloride, potassium citrate, potassium hydroxide, potassium metabisufite, potassium sorbate, povidone, propionic acid, propyl gallate, propylene carbonate, propylene glycol, propylene glycol alginate, propylparaben, propylparaben sodium, pyrrolidone, raffinose, saccharin, saccharin sodium, safflower oil, saponite, sesame oil, shellac, simethicone, sodium acetate, sodium alginate, sodium ascorbate, sodium benzoate, sodium bicarbonate, sodium borate, sodium carbonate, sodium chloride, sodium citrate dihydrate, sodium cyclamate, sodium formaldehyde sulfoxylate, sodium hyaluronate, sodium hydroxide, sodium lactate, sodium lauryl sulfate, sodium metabisulfite, sodium phosphate dibasic, sodium phosphate monobasic, sodium propionate, sodium starch glycolate, sodium stearyl fumarate, sodium sulfite, sodium thiosulfate, sorbic acid, sorbitan esters (sorbitan fatty acid esters), sorbitol, soybean oil, starch, starch pregelatinized, starch sterilizable maize, stearic acid, stearyl alcohol, sucralose, sucrose, sucrose octaacetate, sugar compressible, sugar confectioner's, sugar spheres, sulfobutylether b cyclodextrin, sulfur dioxide, sulfuric acid, sunflower oil, suppository bases hard fat, tagatose, talc, tartaric acid, tetrafluoroethane (hfc), thaumatin, thimerosal, thymol, titanium dioxide, tragacanth, trehalose, triacetin, tributyl citrate, tricaprylin, triethanolamnine, triethyl citrate, triolein, vanillin, vegetable oil hydrogenated, vitamin e polyethylene glycol succinate, water, wax anionic emulsifying, wax carnauba, wax cetyl esters, wax microcrystalline, wax nonionic emulsifying, wax white, wax—yellow, xanthan gum, xylitol, zein, zinc acetate, zinc stearate, or any combination thereof.

    SPECIFIC EMBODIMENTS

    [0194] For the purposes of clarity and a concise description, specific embodiments are provided below. These specific embodiments are meant to supplement, not replace, the preceding description. Further, the recitation of specific embodiments and definitions below does not exclude the combination of any of the embodiments below with the embodiments and description set forth above.

    Embodiment 1

    [0195] A method of increasing retinal tolerance time, reducing cell death during an ischemic event in the retina, reducing cell death following an ischemic event in the retina, treating an ischemic event in the retina, or a combination thereof, the method comprising: (a) administering a dose of a pharmaceutical composition comprising an effective amount of a MANF family protein to a subject in need thereof; (b) performing a treatment to resolve a blockage causing the ischemic event.

    Embodiment 2

    [0196] The method of embodiment 1, wherein the MANF family protein is a mesencephalic astrocyte derived neurotrophic factor (MANF) protein, or a fragment thereof.

    Embodiment 3

    [0197] The method of embodiment 1, wherein the MANF family protein comprises a sequence that has at least about 80% identity with SEQ ID NO:3.

    Embodiment 4

    [0198] The method of embodiment 1, wherein the MANF family protein comprises a sequence that has at least about 85% identity with SEQ ID NO:3.

    Embodiment 5

    [0199] The method of embodiment 1, wherein the MANF family protein comprises a sequence that has at least about 90% identity with SEQ ID NO:3.

    Embodiment 6

    [0200] The method of embodiment 1, wherein the MANF family protein comprises a sequence that has at least about 95% identity with SEQ ID NO:3.

    Embodiment 7

    [0201] The method of embodiment 1, wherein the MANF family protein comprises a sequence that has 100% identity with SEQ ID NO:3.

    Embodiment 8

    [0202] The method of embodiment 1, wherein the MANF family protein consists of a sequence that has at least about 80% identity with SEQ ID NO:3.

    Embodiment 9

    [0203] The method of embodiment 1, wherein the MANF family protein consists of a sequence that has at least about 85% identity with SEQ ID NO:3.

    Embodiment 10

    [0204] The method of embodiment 1, wherein the MANF family protein consists of a sequence that has at least about 90% identity with SEQ ID NO:3.

    Embodiment 11

    [0205] The method of embodiment 1, wherein the MANF family protein consists of a sequence that has at least about 95% identity with SEQ ID NO:3.

    Embodiment 12

    [0206] The method of embodiment 1, wherein the MANF family protein consists of a sequence that has 100% identity with SEQ ID NO:3.

    Embodiment 13

    [0207] The method of any one of embodiments 3-12, wherein the MANF family protein has a length that is at least 80% the length of SEQ ID NO:3.

    Embodiment 14

    [0208] The method of any one of embodiments 3-12, wherein the MANF family protein has a length that is 100% the length of SEQ ID NO:3.

    Embodiment 15

    [0209] The method of embodiment 1, wherein the MANF family protein consists of a sequence listed in Table 3.

    Embodiment 16

    [0210] The method of embodiment 15, wherein the MANF family protein is cell permeable.

    Embodiment 17

    [0211] The method of embodiment 1, wherein the MANF family protein is a conserved dopamine neurotrophic factor (CDNF) protein, or a fragment thereof.

    Embodiment 18

    [0212] The method of embodiment 1, wherein the MANF family protein comprises a sequence that has at least about 80% identity with SEQ ID NO:6.

    Embodiment 19

    [0213] The method of embodiment 1, wherein the MANF family protein comprises a sequence that has at least about 85% identity with SEQ ID NO:6.

    Embodiment 20

    [0214] The method of embodiment 1, wherein the MANF family protein comprises a sequence that has at least about 90% identity with SEQ ID NO:6.

    Embodiment 21

    [0215] The method of embodiment 1, wherein the MANF family protein comprises a sequence that has at least about 95% identity with SEQ ID NO:6.

    Embodiment 22

    [0216] The method of embodiment 1, wherein the ML NF family protein comprises a sequence that has 100% identity with SEQ ID NO:6.

    Embodiment 23

    [0217] The method of embodiment 1, wherein the MANF family protein consists of a sequence that has at least about 80% identity with SEQ ID NO:6.

    Embodiment 24

    [0218] The method of embodiment 1, wherein the MANF family protein consists of a sequence that has at least about 85% identity with SEQ ID NO:6.

    Embodiment 25

    [0219] The method of embodiment 1, wherein the MANE family protein consists of a sequence that has at least about 90% identity with SEQ ID NO:6.

    Embodiment 26

    [0220] The method of embodiment 1, wherein the MANF family protein consists of a sequence that has at least about 95% identity with SEQ ID NO:6.

    Embodiment 27

    [0221] The method of embodiment 1, wherein the MANF family protein consists of a sequence that has 100% identity with SEQ ID NO:6.

    Embodiment 28

    [0222] The method of any one of embodiments 18-27, wherein the MANF family protein has a length that is at least 80% the length of SEQ ID NO:3.

    Embodiment 29

    [0223] The method of any one of embodiments 18-27, wherein the MANF family protein has a length that is 100% the length of SEQ ID NO:3.

    Embodiment 30

    [0224] The method of embodiment 1, wherein the MANF family protein consists of a sequence listed in Table 4.

    Embodiment 31

    [0225] The method of embodiment 30, wherein the MANF family protein is cell permeable.

    Embodiment 32

    [0226] The method of any one of embodiments 1-31, wherein the pharmaceutical composition is administered to an eye of the subject.

    Embodiment 33

    [0227] The method of embodiment 32, wherein the pharmaceutical composition is administered by topical administration, intravitreal injection, intracameral administration, subconjunctival administration, subtenon administration, retrobulbar administration, posterior juxtascleral administration, or a combination thereof.

    Embodiment 34

    [0228] The method of embodiment 32, wherein the pharmaceutical composition is administered by topical administration.

    Embodiment 35

    [0229] The method of embodiment 32, wherein the pharmaceutical composition is administered by intravitreal injection.

    Embodiment 36

    [0230] The method of any one of embodiments 1-35, wherein the dose is administered after the treatment to resolve the blockage.

    Embodiment 37

    [0231] The method of any one of embodiments 1-35, wherein the dose is administered prior to the treatment to resolve the blockage.

    Embodiment 38

    [0232] The method of any one of embodiments 1-37, wherein the dose has a volume of about: 1-500 μL, 10-250 μL, 25-150 μL, 50-100 μL, 1 μL, 5 μL, 10 μL, 15 μL, 20 μL, 25 μL, 30 μL, 35 μL, 40 μL, 45 μL, 50 μL, 55 μL, 60 μL, 65 μL, 70 μL, 75 μL, 80 μL, 85 μL, 90 μL, 95 μL, 100 μL, 105 μL, 110 μL, 115 μL, 120 μL, 125 μL, 150 μL, 175 μL, 200 μL, 225 μL, 250 μL, 300 μL, 350 μL, 400 μL, 450 μL, or 500 μL.

    Embodiment 39

    [0233] The method of any one of embodiments 1-37, wherein the dose has a volume of from about 1 μL to about 500 μL.

    Embodiment 40

    [0234] The method of any one of embodiments 1-37, wherein the dose has a volume of from about 10 μL to about 250 μL.

    Embodiment 41

    [0235] The method of any one of embodiments 1-37, wherein the dose has a volume of about 25 μL to about 150 μL.

    Embodiment 42

    [0236] The method of any one of embodiments 1-37, wherein the dose has a volume of from about 50 μL to about 100 μL.

    Embodiment 43

    [0237] The method of any one of embodiments 1-37, wherein the dose has a volume of from about 25 μL to about 125 μL.

    Embodiment 44

    [0238] The method of any one of embodiments 1-37, wherein the dose has a volume of about 50 μL.

    Embodiment 45

    [0239] The method of any one of embodiments 1-37, wherein the dose has a volume of about 100 μL.

    Embodiment 46

    [0240] The method of any one of embodiments 1-45, wherein the dose has a concentration of the MANF family protein that is about: 0.1-100 mg/mL, 0.1-40 mg/mL, 1-20 mg/mL, 1.5-15 mg/mL, 8.1-32.4 mg/mL, 2.7-5.4 mg/mL, 0.1 mg/mL, 0.5 mg/mL, 1 mg/mL, 1.1 mg/mL, 1.2 mg/mL, 1.3 mg/mL, 1.4 mg/mL, 1.5 mg/mL, 1.6 mg/mL, 1.7 mg/mL, 1.8 mg/mL, 1.9 ng/mL, 2 mg/mL, 2.1 mg/mL, 2.2 mg/mL, 2.3 mg/mL, 2.4 mg/mL, 2.5 mg/mL, 2.6 mg/mL, 2.7 mg/mL, 2.8 mg/mL, 2.9 mg/mL, 3 mg/mL, 3.1 mg/mL, 3.2 mg/mL, 3.3 mg/mL, 3.4 mg/mL, 3.5 mg/mL, 3.6 mg/mL, 3.7 mg/mL, 3.8 mg/mL, 3.9 mg/mL, 3.9 mg/mL, 4 mg/mL, 4.1 mg/mL, 4.2 mg/mL, 4.3 mg/mL, 4.4 mg/mL, 4.5 mg/mL, 4.6 mg/mL, 4.7 mg/mL, 4.8 mg/mL, 4.9 mg/mL, 5 mg/mL, 5.1 mg/mL, 5.2 mg/mL, 5.3 mg/mL, 5.4 mg/mL, 5.5 mg/mL, 5.6 mg/mL, 5.7 mg/mL, 5.8 mg/mL, 5.9 mg/mL, 6 mg/mL, 6.25 mg/mL, 6.5 mg/mL, 6.75 mg/mL, 7 mg/mL, 7.25 mg/mL, 7.5 mg/mL, 7.75 mg/mL, 8 mg/mL, 8.25 mg/mL, 8.5 mg/mL, 8.75 mg/mL, 9 mg/mL, 9.25 mg/mL, 9.5 mg/mL, 9.75 mg/mL, 10 mg/mL, 11 mg/mL, 12 mg/mL, 13 mg/mL, 14 mg/mL, 15 mg/mL, 16 mg/mL, 17 mg/mL, 18 mg/mL, 19 mg/mL, 20 mg/mL, 25 mg/mL, 30 mg/mL, 35 mg/mL, 40 mg/mL, 50 mg/mL, 60 mg/mL, 70 mg/mL, 80 mg/mL, 90 mg/mL, or 100 mg/mL.

    Embodiment 47

    [0241] The method of any one of embodiments 1-45, wherein the dose has a concentration of the MANF family protein that is from about 1 mg/mL to about 20 mg/mL.

    Embodiment 48

    [0242] The method of any one of embodiments 1-45, wherein the dose has a concentration of the MANF family protein that is from about 1.5 mg/mL to about 15 mg/mL.

    Embodiment 49

    [0243] The method of any one of embodiments 1-45, wherein the dose has a concentration of the MANF family protein that is from about 2.7 mg/mL to about 5.4 mg/mL.

    Embodiment 50

    [0244] The method of any one of embodiments 1-49, wherein the effective amount of the MANF family protein is about: 1-5000 μg, 5-2500 μg, 10-2000 μg, 500-2000 mg/mL, 50-1000 μg, 100-500 μg, 200-350 μg, 250-300 μg, 10 μg, 20 μg, 30 μg, 40 μg, 50 μg, 60 μg, 70 μg, 80 μg, 90 μg, 100 μg, 110 μg, 120 μg, 130 μg, 140 μg, 150 μg, 160 μg, 170 μg, 180 μg, 190 μg, 200 μg, 210 μg, 220 μg, 230 μg, 240 μg, 250 μg, 260 μg, 270 μg, 280 μg, 290 μg, 300 μg, 310 μg, 320 μg, 330 μg, 340 μg, 350 μg, 360 μg, 370 μg, 380 μg, 390 μg, 400 μg, 410 μg, 420 μg, 430 μg, 440 μg, 450 μg, 460 μg, 470 μg, 480 μg, 490 μg, 500 μg, 525 μg, 550 μg, 575 μg, 600 μg, 625 μg, 650 μg, 675 μg, 700 μg, 750 μg, 800 μg, 850 μg, 900 μg, 950 μg, 1000 μg, 1100 μg, 1200 μg, 1300 μg, 1400 μg, 1500 μg, 1750 μg, 2000 μg, 2500 μg, 3000 μg, 3500 μg, 4000 μg or 5000 μg.

    Embodiment 51

    [0245] The method of any one of embodiments 1-49, wherein the effective amount of the MANF family protein is from about 50 μg to about 1000 μg.

    Embodiment 52

    [0246] The method of any one of embodiments 1-49, wherein the effective amount of the MANF family protein is from about 100 μg to about 500 μg.

    Embodiment 53

    [0247] The method of any one of embodiments 1-49, wherein the effective amount of the MANF family protein is from about 250 μg to about 300 μg.

    Embodiment 54

    [0248] The method of any one of embodiments 1-53, wherein the dose is administered once every 2 to 8 weeks.

    Embodiment 55

    [0249] The method of any one of embodiments 1-53, wherein the dose is administered once every 3 to 6 weeks.

    Embodiment 56

    [0250] The method of any one of embodiments 1-53, wherein the dose is administered once every month.

    Embodiment 57

    [0251] The method of any one of embodiments 1-53, wherein the dose is administered once every two months.

    Embodiment 58

    [0252] The method of any one of embodiments 1-53, wherein the dose is administered once every hour.

    Embodiment 59

    [0253] The method of any one of embodiments 1-53, wherein the dose is administered once every two hours.

    Embodiment 60

    [0254] The method of any one of embodiments 1-53, wherein the dose is administered once every four hours.

    Embodiment 61

    [0255] The method of any one of embodiments 1-53, wherein the dose is administered daily.

    Embodiment 62

    [0256] The method of any one of embodiments 1-53, wherein the dose is only administered once.

    Embodiment 63

    [0257] The method of any one of embodiments 1-62, wherein the ischemic event is a retinal artery occlusion.

    Embodiment 64

    [0258] The method of any one of embodiments 1-62, wherein the ischemic event is an acute retinal artery occlusion.

    Embodiment 65

    [0259] The method of any one of embodiments 1-62, wherein the ischemic event is a central retinal artery occlusion.

    Embodiment 66

    [0260] The method of any one of embodiments 1-62, wherein the ischemic event is a branch retinal artery occlusion.

    Embodiment 67

    [0261] The method of any one of embodiments 1-62, wherein the ischemic event is not a chronic retinal artery occlusion.

    Embodiment 68

    [0262] The method of any one of embodiments 1-62, wherein the ischemic event is a retinal vein occlusion.

    Embodiment 69

    [0263] The method of any one of embodiments 1-62, wherein the ischemic event is not a retinal vein occlusion.

    Embodiment 70

    [0264] The method of any one of embodiments 1-69, wherein the treatment to resolve the blockage comprises administration of a vasodilator.

    Embodiment 71

    [0265] The method of embodiment 70, wherein the vasodilator comprises pentoxyphyline, inhalation of carbogen, hyperbaric oxygen, sublingual isosorbide dinitrite, or a combination thereof.

    Embodiment 72

    [0266] The method of any one of embodiments 1-71, wherein the treatment to resolve the blockage comprises ocular massage, intravenous acetazolamide, intravenous mannitol, topical antiglaucoma drops, anterior chamber paracentisis, or a combination thereof.

    Embodiment 73

    [0267] The method of any one of embodiments 1-72, wherein the treatment to resolve the blockage comprises intravenous methylprednisolone.

    Embodiment 74

    [0268] The method of any one of embodiments 1-73, wherein the treatment to resolve the blockage comprises Nd YAG laser treatment, pars plana vitrectomy, or a combination thereof.

    Embodiment 75

    [0269] The method of any one of embodiments 1-74, wherein the treatment to resolve the blockage comprises intravenous tissue plasminogen activator, intra-arterial tissue plasminogen activator, or a combination thereof.

    Embodiment 76

    [0270] The method of any one of embodiments 1-75, wherein the treatment to resolve the blockage comprises panretinal photocoagulation.

    Embodiment 77

    [0271] The method of any one of embodiments 1-76, wherein the treatment to resolve the blockage comprises administration of a steroid.

    Embodiment 78

    [0272] The method of any one of embodiments 1-77, wherein the MANE family protein and the treatment to resolve the blockage have a synergistic effect on retinal ganglion cell survival.

    Embodiment 79

    [0273] The method of any one of embodiments 1-77, wherein the MANF family protein and the treatment to resolve the blockage exhibit therapeutic synergy.

    Embodiment 80

    [0274] The method of any one of embodiments 1-79, further comprising diagnosing the ischemic event.

    Embodiment 81

    [0275] The method of embodiment 80, wherein diagnosing is based upon sudden loss of vision in one eye.

    Embodiment 82

    [0276] The method of embodiment 80 or 81, wherein diagnosing is based upon a determination of retinal opacity, a cherry red spot in the foveal center, the presence of box carring of the blood columns in retinal vessels, absence of arterial circulation based upon flurescein fundus angiography, or a combination thereof.

    Embodiment 83

    [0277] A method of increasing retinal tolerance time, reducing cell death during a retinal artery occlusion, reducing cell death following a retinal artery occlusion, treating a retinal artery occlusion, or a combination thereof, the method comprising administering a dose of a pharmaceutical composition comprising an effective amount of a MANF family protein to a subject exhibiting one or more symptoms of a retinal artery occlusion.

    Embodiment 84

    [0278] The method of embodiment 83, wherein the MANF family protein is a mesencephalic astrocyte derived neurotrophic factor (MANEF) protein, or a fragment thereof.

    Embodiment 85

    [0279] The method of embodiment 83, wherein the MANF family protein comprises a sequence that has at least about 80% identity with SEQ ID NO:3.

    Embodiment 86

    [0280] The method of embodiment 83, wherein the MANF family protein comprises a sequence that has at least about 85% identity with SEQ ID NO:3.

    Embodiment 87

    [0281] The method of embodiment 83, wherein the MANF family protein comprises a sequence that has at least about 90% identity with SEQ ID NO:3.

    Embodiment 88

    [0282] The method of embodiment 83, wherein the MANF family protein comprises a sequence that has at least about 95% identity with SEQ ID NO:3.

    Embodiment 89

    [0283] The method of embodiment 83, wherein the MANF family protein comprises a sequence that has 100% identity with SEQ ID NO:3.

    Embodiment 90

    [0284] The method of embodiment 83, wherein the MANF family protein consists of a sequence that has at least about 80% identity with SEQ ID NO:3.

    Embodiment 91

    [0285] The method of embodiment 83, wherein the MANF family protein consists of a sequence that has at least about 85% identity with SEQ ID NO:3.

    Embodiment 92

    [0286] The method of embodiment 83, wherein the MANF family protein consists of a sequence that has at least about 90% identity with SEQ ID NO:3.

    Embodiment 93

    [0287] The method of embodiment 83, wherein the MANF family protein consists of a sequence that has at least about 95% identity with SEQ ID NO:3.

    Embodiment 94

    [0288] The method of embodiment 83, wherein the MANF family protein consists of a sequence that has 100% identity with SEQ ID NO:3.

    Embodiment 95

    [0289] The method of any one of embodiments 85-94, wherein the MANF family protein has a length that is at least 80% the length of SEQ ID NO:3.

    Embodiment 96

    [0290] The method of any one of embodiments 85-94, wherein the MANF family protein has a length that is 100% the length of SEQ ID NO:3.

    Embodiment 97

    [0291] The method of embodiment 83, wherein the MANE family protein consists of a sequence listed in Table 3.

    Embodiment 98

    [0292] The method of embodiment 97, wherein the MANF family protein is cell permeable.

    Embodiment 99

    [0293] The method of embodiment 83, wherein the MANF family protein is a conserved dopamine neurotrophic factor (CDNF) protein, or a fragment thereof.

    Embodiment 100

    [0294] The method of embodiment 83, wherein the MANF family protein comprises a sequence that has at least about 80% identity with SEQ ID NO:6.

    Embodiment 101

    [0295] The method of embodiment 83, wherein the MANF family protein comprises a sequence that has at least about 85% identity with SEQ ID NO:6.

    Embodiment 102

    [0296] The method of embodiment 83, wherein the MAN family protein comprises a sequence that has at least about 90% identity with SEQ ID NO:6.

    Embodiment 103

    [0297] The method of embodiment 83, wherein the MANF family protein comprises a sequence that has at least about 95% identity with SEQ ID NO:6.

    Embodiment 104

    [0298] The method of embodiment 83, wherein the MANF family protein comprises a sequence that has 100% identity with SEQ ID NO:6.

    Embodiment 105

    [0299] The method of embodiment 83, wherein the MANF family protein consists of a sequence that has at least about 80% identity with SEQ ID NO:6.

    Embodiment 106

    [0300] The method of embodiment 83, wherein the MANF family protein consists of a sequence that has at least about 85% identity with SEQ ID NO:6.

    Embodiment 107

    [0301] The method of embodiment 83, wherein the MANF family protein consists of a sequence that has at least about 90% identity with SEQ ID NO:6.

    Embodiment 108

    [0302] The method of embodiment 83, wherein the MANF family protein consists of a sequence that has at least about 95% identity with SEQ ID NO:6.

    Embodiment 109

    [0303] The method of embodiment 83, wherein the MANF family protein consists of a sequence that has 100% identity with SEQ ID NO:6.

    Embodiment 110

    [0304] The method of any one of embodiments 101-109, wherein the MANF family protein has a length that is at least 80% the length of SEQ ID NO:3.

    Embodiment 111

    [0305] The method of any one of embodiments 101-109, wherein the MANF family protein has a length that is 100% the length of SEQ ID NO:3.

    Embodiment 112

    [0306] The method of embodiment 83, wherein the MANF family protein consists of a sequence listed in Table 4.

    Embodiment 113

    [0307] The method of embodiment 112, wherein the MANF family protein is cell permeable.

    Embodiment 114

    [0308] The method of any one of embodiments 83-113, wherein the pharmaceutical composition is administered to an eye of the subject.

    Embodiment 115

    [0309] The method of embodiment 114, wherein the pharmaceutical composition is administered by topical administration, intravitreal injection, intracameral administration, subconjunctival administration, subtenon administration, retrobulbar administration, posterior juxtascleral administration, or a combination thereof.

    Embodiment 116

    [0310] The method of embodiment 114, wherein the pharmaceutical composition is administered by topical administration.

    Embodiment 117

    [0311] The method of embodiment 114, wherein the pharmaceutical composition is administered by intravitreal injection.

    Embodiment 118

    [0312] The method of any one of embodiments 83-117, wherein the dose has a volume of about: 1-500 μL, 10-250 μL, 25-150 μL, 50-100 μL, 1 μL, 5 μL, 10 μL, 15 μL, 20 μL, 25 μL, 30 μL, 35 μL, 40 μL, 45 μL, 50 μL, 55 μL, 60 μL, 65 μL, 70 μL, 75 μL, 80 μL, 85 μL, 90 μL, 95 μL, 100 μL, 105 μL, 110 μL, 115 μL, 120 μL, 125 μL, 150 μL, 175 μL, 200 μL, 225 μL, 250 μL, 300 μL, 350 μL, 400 μL, 450 μL, or 500 μL.

    Embodiment 119

    [0313] The method of any one of embodiments 83-117, wherein the dose has a volume of from about 1 μL to about 500 μL.

    Embodiment 120

    [0314] The method of any one of embodiments 83-117, wherein the dose has a volume of from about 10 μL to about 250 μL.

    Embodiment 121

    [0315] The method of any one of embodiments 83-117, wherein the dose has a volume of about 25 μL to about 150 μL.

    Embodiment 122

    [0316] The method of any one of embodiments 83-117, wherein the dose has a volume of from about 50 μL to about 100 μL.

    Embodiment 123

    [0317] The method of any one of embodiments 83-117, wherein the dose has a volume of from about 25 μL, to about 125 μL.

    Embodiment 124

    [0318] The method of any one of embodiments 83-117, wherein the dose has a volume of about 50 μL.

    Embodiment 125

    [0319] The method of any one of embodiments 83-117, wherein the dose has a volume of about 100 μL.

    Embodiment 126

    [0320] The method of any one of embodiments 83-125, wherein the dose has a concentration of the MANF family protein that is about: 0.1-100 mg/mL, 0.1-40 mg/mL, 1-20 mg/mL, 1.5-15 mg/mL, 8.1-32.4 mg/mL, 2.7-5.4 mg/mL, 0.1 mg/mL, 0.5 mg/mL, 1 mg/mL, 1.1 mg/mL, 1.2 mg/mL, 1.3 mg/mL, 1.4 mg/mL, 1.5 mg/mL, 1.6 mg/mL, 1.7 mg/mL, 1.8 mg/mL, 1.9 ng/mL, 2 ng/mL, 2.1 mg/mL, 2.2 mg/mL, 2.3 mg/mL, 2.4 mg/mL, 2.5 mg/mL, 2.6 mg/mL, 2.7 mg/mL, 2.8 mg/mL, 2.9 mg/mL, 3 mg/mL, 3.1 mg/mL, 3.2 mg/mL, 3.3 mg/mL, 3.4 mg/mL, 3.5 mg/mL, 3.6 mg/mL, 3.7 mg/mL, 3.8 mg/mL, 3.9 mg/mg/mL, 4 mg/mL, 4.1 mg/mL, 4.2 mg/mL, 4.3 mg/mL, 4.4 mg/mL, 4.5 ing/mL, 46 mg/mL, 4.7 mg/mL, 4.8 mg/mL, 4.9 mg/mL, 5 mg/mL, 5.1 mg/mL, 5.2 mg/mL, 5.3 mg/mL, 5.4 mg/mL, 5.5 mg/mL, 5.6 mg/mL, 5.7 mg/mL, 5.8 mg/mL, 5.9 mg/mL, 6 mg/mL, 6.25 mg/mL, 6.5 mg/mL, 6.75 mg/mL, 7 mg/mL, 7.25 mg/mL, 7.5 mg/mL, 7.75 mg/mL, 8 mg/mL, 8.25 mg/mL, 8.5 mg/mL, 8.75 mg/mL, 9 mg/mL, 9.25 mg/mL, 9.5 mg/mL, 9.75 mg/mL, 10 mg/mL, 11 mg/mL, 12 mg/mL, 13 mg/mL, 14 mg/mL, 15 mg/mL, 16 mg/mL, 17 mg/mL, 18 mg/mL, 19 ng/mL, 20 mg/mL, 25 mg/mL, 30 mg/mL, 35 mg/mL, 40 mg/mL, 50 mg/mL, 60 mg/mL, 70 mg/mL, 80 mg/mL, 90 mg/mL, or 100 mg/mL.

    Embodiment 127

    [0321] The method of any one of embodiments 83-125, wherein the dose has a concentration of the MANF family protein that is from about 1 mg/mL to about 20 mg/mL.

    Embodiment 128

    [0322] The method of any one of embodiments 83-125, wherein the dose has a concentration of the MANF family protein that is from about 1.5 mg/mL to about 15 mg/mL.

    Embodiment 129

    [0323] The method of any one of embodiments 83-125, wherein the dose has a concentration of the MANF family protein that is from about 2.7 mg/mL to about 5.4 mg/mL.

    Embodiment 130

    [0324] The method of any one of embodiments 83-129, wherein the effective amount of the MANF family protein is about: 1-5000 μg, 5-2500 μg, 10-2000 μg, 500-2000 mg/mL, 50-1000 μg, 100-500 μg, 200-350 μg, 250-300 μg, 10 μg, 20 μg, 30 μg, 40 μg, 50 μg, 60 μg, 70 μg, 80 μg, 90 μg, 100 μg, 110 μg, 120 μg, 130 μg, 140 μg, 150 μg, 160 μg, 170 μg, 180 μg, 190 μg, 200 μg, 210 μg, 220 μg, 230 μg, 240 μg, 250 μg, 260 μg, 270 μg, 280 μg, 290 μg, 300 μg, 310 μg, 320 μg, 330 μg, 340 μg, 350 μg, 360 μg, 370 μg, 380 μg, 390 μg, 400 μg, 410 μg, 420 μg, 430 μg, 440 μg, 450 μg, 460 μg, 470 μg, 480 μg, 490 μg, 500 μg, 525 μg, 550 μg, 575 μg, 600 μg, 625 μg, 650 μg, 675 μg, 700 μg, 750 μg, 800 μg, 850 μg, 900 μg, 950 μg, 1000 μg, 1100 μg, 1200 μg, 1300 μg, 1400 μg, 1500 μg, 1750 μg, 2000 μg, 2500 μg, 3000 μg, 3500 μg, 4000 μg or 5000 μg.

    Embodiment 131

    [0325] The method of any one of embodiments 83-129, wherein the effective amount of the MANF family protein is from about 50 μg to about 1000 Mg.

    Embodiment 132

    [0326] The method of any one of embodiments 83-129, wherein the effective amount of the MANF family protein is from about 100 Mg to about 500 t g.

    Embodiment 133

    [0327] The method of any one of embodiments 83-129, wherein the effective amount of the MANF family protein is from about 250 μg to about 300 μg.

    Embodiment 134

    [0328] The method of any one of embodiments 83-133, wherein the dose is administered once every 2 to 8 weeks.

    Embodiment 135

    [0329] The method of any one of embodiments 83-133, wherein the dose is administered once every 3 to 6 weeks.

    Embodiment 136

    [0330] The method of any one of embodiments 83-133, wherein the dose is administered once every month.

    Embodiment 137

    [0331] The method of any one of embodiments 83-133, wherein the dose is administered once every two months.

    Embodiment 138

    [0332] The method of any one of embodiments 83-133, wherein the dose is administered once every hour.

    Embodiment 139

    [0333] The method of any one of embodiments 83-133, wherein the dose is administered once every two hours.

    Embodiment 140

    [0334] The method of any one of embodiments 83-133, wherein the dose is administered once every four hours.

    Embodiment 141

    [0335] The method of any one of embodiments 83-133, wherein the dose is administered daily.

    Embodiment 142

    [0336] The method of any one of embodiments 83-133, wherein the dose is only administered once.

    Embodiment 143

    [0337] The method of any one of embodiments 83-133, wherein the retinal artery occlusion is an acute retinal artery occlusion.

    Embodiment 144

    [0338] The method of any one of embodiments 83-143, wherein the retinal artery occlusion is a central retinal artery occlusion.

    Embodiment 145

    [0339] The method of any one of embodiments 83-143, wherein the retinal artery occlusion is a branch retinal artery occlusion.

    Embodiment 146

    [0340] A method of treating a retinal disorder, the method comprising administering to a subject in need thereof an effective amount of a MANF family protein and another active agent.

    Embodiment 147

    [0341] The method of embodiment 146, wherein the MANF family protein and the another active agent have a synergistic effect upon retinal ganglion cell survival.

    Embodiment 148

    [0342] The method of any one of embodiments 146-147, wherein the MANF family protein and the another active agent exhibit therapeutic synergy.

    Embodiment 149

    [0343] The method of any one of embodiments 146-148, wherein the MANF family protein and the another active agent have additive effects.

    Embodiment 150

    [0344] The method of any one of embodiments 146-149, wherein the MANF family protein is MANF, or a fragment thereof.

    Embodiment 151

    [0345] The method of any one of embodiments 146-150, wherein the MANF family protein is CDNF, or a fragment thereof.

    Embodiment 152

    [0346] The method of any one of embodiments 146-151, wherein the another active agent is a prostaglandin analog, a beta-adrenergic receptor antagonist, an alpha adrenergic agonist, a miotic agent, a carbonic anhydrase inhibitor, or a combination thereof.

    Embodiment 153

    [0347] The method of any one of embodiments 146-152, wherein the another active agent is a prostaglandin analog.

    Embodiment 154

    [0348] The method of embodiment 153, wherein the prostaglandin analog is latanoprost, bimatoprost, travoprost, unoprostone, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 155

    [0349] The method of any one of embodiments 146-154, wherein the another active agent is a beta-adrenergic receptor antagonist.

    Embodiment 156

    [0350] The method of embodiment 155, wherein the beta-adrenergic receptor antagonist is betaxolol, carteolol, levobunolol, metipranolol, timolol, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 157

    [0351] The method of any one of embodiments 146-156, wherein the another active agent is an alpha adrenergic agonist.

    Embodiment 158

    [0352] The method of embodiment 157, wherein the alpha adrenergic agonist is an α1 adrenergic agonist, an α2-adrenergic agonist, or any combination thereof.

    Embodiment 159

    [0353] The method of embodiment 158, comprising the ac adrenergic agonist that is methoxamine, methylnorepinephrine, midodrine, oxymetazoline, metaraminol, phenylephrine, or a pharmaceutical salt thereof or any combination thereof.

    Embodiment 160

    [0354] The method of embodiment 158, comprising the α2 adrenergic agonist that is clonidine, guanfacine, guanabenz, guanoxabenz, guanethidine, xylazine, tizanidine, methyldopa, fadolmidine, dexmedetomidine, brimonidine, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 161

    [0355] The method of embodiment 157, wherein the alpha adrenergic agonist is methoxamine, methylnorepinephrine, midodrine, oxymetazoline, metaraminol, phenylephrine, clonidine, guanfacine, guanabenz, guanoxabenz, guanethidine, xylazine, tizanidine, methyldopa, fadolmidine, dexmedetomidine, amidephrine, amitraz, anisodamine, apraclonidine, brimonidine, cirazoline, detomidine, dexmedetomidine, epinephrine, ergotamine, etilefrine, indanidine, lofexidine, medetomidine, mephentermine, metaraminol, methoxamine, mivazerol, naphazoline, norepinephrine, norfenefrine, octopamine, oxymetazoline, phenylpropanolamine, rilmnenidine, romifidine, synephrine, talipexole, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 162

    [0356] The method of any one of embodiments 146-161, wherein the another active agent is an α1 adrenergic agonist that is methoxamine, methylnorepinephrine, midodrine, oxymetazoline, metaraminol, phenylephrine, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 163

    [0357] The method of any one of embodiments 146-162, wherein the another active agent is an α2 adrenergic agonist that is clonidine, guanfacine, guanabenz, guanoxabenz, guanethidine, xylazine, tizanidine, methyldopa, fadolmhnidine, dexmedetomidine, brimonidine, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 164

    [0358] The method of any one of embodiments 146-163, wherein the another active agent is brimonidine or a pharmaceutical salt thereof.

    Embodiment 165

    [0359] The method of any one of embodiments 146-164, wherein the MANF family protein is MANF, or a fragment thereof and the other active agent is brimonidine or a pharmaceutical salt thereof.

    Embodiment 166

    [0360] The method of embodiment 165, wherein the MANF and the brimonidine or a pharmaceutical salt thereof have a synergistic effect upon retinal ganglion cell survival.

    Embodiment 167

    [0361] The method of embodiment 165, wherein the MANF and the brimonidine or a pharmaceutical salt thereof exhibit therapeutic synergy.

    Embodiment 168

    [0362] The method of any one of embodiments 146-167, wherein the retinal disorder is an acute retinal artery occlusion.

    Embodiment 169

    [0363] The method of any one of embodiments 146-167, wherein the retinal disorder is a central retinal artery occlusion or a branch retinal artery occlusion.

    Embodiment 170

    [0364] The method of any one of embodiments 146-167, wherein the retinal disorder is retinal ischemia.

    Embodiment 171

    [0365] The method of embodiment 170, wherein the retinal ischemia is caused by glaucoma, carotid artery stenosis, Takayasu's arteritis, giant cell arteritis, thromboembolism, central retinal artery occlusion, central retinal vein occlusion, diabetes, or a combination thereof.

    Embodiment 172

    [0366] The method of any one of embodiments 146-171, wherein the retinal disorder is macular degeneration, diabetic eye disease, age-related macular degeneration, branch retinal vein occlusion, central retinal vein occlusion, central retinal artery occlusion, central serous retinopathy, diabetic retinopathy, Fuchs' dystrophy, giant cell arteritis, glaucoma, hypertensive retinopathy, thyroid eye disease, iridocorneal endothelial syndrome, ischemic optic neuropathy, juvenile macular degeneration, macular edema, macular telangioctasia, marfan syndrome, optic neuritis, photokeratitis, retinitis pigmentosa, retinopathy of prematurity, stargardt disease, usher syndrome, or any combination thereof.

    Embodiment 173

    [0367] The method of embodiment 172, wherein the retinal disorder is age-related macular degeneration that is dry age related macular degeneration or wet age related macular degeneration.

    Embodiment 174

    [0368] The method of any one of embodiments 146-173, wherein the MANF family protein and the another active agent are administered separately.

    Embodiment 175

    [0369] The method of any one of embodiments 146-174, wherein the MANF family protein and the another active agent are administered together.

    Embodiment 176

    [0370] The method of any one of embodiments 146-175, wherein the MANF family protein is administered orally, parenterally, intranasally, or intravenously.

    Embodiment 177

    [0371] The method of any one of embodiments 146-176, wherein the another active agent is administered orally, parenterally, intranasally, or intravenously.

    Embodiment 178

    [0372] The method of any one of embodiments 146-177, wherein administration of the MANF family protein is topical, subconjunctival, intravitreal, retrobulbar, intracameral, systemic, or a combination thereof.

    Embodiment 179

    [0373] The method of any one of embodiments 146-178, wherein administration of the another active agent is topical, subconjunctival, intravitreal, retrobulbar, intracameral, systemic, or a combination thereof.

    Embodiment 180

    [0374] The method of any one of embodiments 146-179, wherein the effective amount of the MANF family protein is about: 0.5 μg-2.5 μg, 0.5 μg-5 μg, 0.5 μg-7.5 μg, 0.5 μg-12.5 μg, 0.5 μg-25 μg, 0.5 μg-50 μg, 0.5 μg-75 μg, 0.5 μg-100 μg, 0.5 μg-150 μg, 0.5 μg-250 μg, 0.5 μg-500 μg, 0.5 μg-1000 μg, 0.5 μg-1250 μg, 0.5 μg-2500 μg, 2.5 μg-5 μg, 2.5 μg-7.5 μg, 2.5 μg-12.5 μg, 2.5 μg-25 μg, 2.5 μg-50 μg, 2.5 μg-75 μg, 2.5 μg-100 μg, 2.5 μg-150 μg, 2.5 μg-250 μg, 2.5 μg-500 μg, 2.5 μg-1000 μg, 2.5 μg-1250 μg, 2.5 μg-2500 μg, 5 μg-7.5 μg, 5 μg-12.5 μg, 5 μg-25 μg, 5 μg-50 μg, 5 μg-75 μg, 5 μg-100 μg, 5 μg-150 μg, 5 μg-250 μg, 5 μg-500 μg, 5 μg-1000 μg, 5 μg-1250 μg, 5 μg-2500 μg, 7.5 μg-12.5 μg, 7.5 μg-25 μg, 7.5 μg-50 μg, 7.5 μg-75 μg, 7.5 μg-100 μg, 7.5 μg-150 μg, 7.5 μg-250 μg, 7.5 μg-500 μg, 7.5 μg-50000 μg, 7.5 μg-1250 μg, 7.5 μg-2500 μg, 12.5 μg-25 μg, 12.5 μg-50 μg, 12.5 μg-75 μg, 12.5 μg-100 μg, 12.5 μg-150 μg, 12.5 μg-250 μg, 12.5 μg-500 μg, 12.5 μg-1000 μg, 12.5 μg-1250 μg, 12.5 μg-2500 μg, 25 μg-50 μg, 25 μg-75 μg, 25 μg-100 μg, 25 μg-150 μg, 25 μg-250 μg, 25 μg-500 μg, 25 μg-1000 μg, 25 μg-1250 μg, 25 μg-2500 μg, 50 μg-75 μg, 50 μg-100 μg, 50 μg-150 μg, 50 μg-250 μg, 50 μg-500 μg, 50 μg-1000 μg, 50 μg-1250 μg, 50 μg-2500 μg, 75 μg-100 μg, 75 μg-150 μg, 75 μg-250 μg, 75 μg-500 μg, 75 μg-1000 μg, 75 μg-1250 μg, 75 μg-2500 μg, 100 μg-150 μg, 100 μg-250 μg, 100 μg-500 μg, 100 μg-1000 μg, 100 μg-1250 μg, 100 μg-2500 μg, 150 μg-250 μg, 150 μg-500 μg, 150 μg-1000 μg, 150 μg-1250 μg, 150 μg-2500 μg, 250 μg-500 μg, 250 μg-1000 μg, 250 μg-1250 μg, 250 μg-2500 μg, 500 μg-1000 μg, 500 μg-1250 μg, 500 μg-2500 μg, 1000 μg-1250 μg, 1000 μg-2500 μg, or 1250 μg-2500 μg per eye.

    Embodiment 181

    [0375] The method of any one of embodiments 146-180, wherein the effective amount of the MANF family protein is at least about: 0.5 μg, 2.5 μg, 5 μg, 7.5 μg, 12.5 μg, 25 μg, 50 μg, 75 μg, 100 μg, 150 μg, 250 μg, 500 μg, 1000 μg, 1250 μg, or 2500 μg per eye.

    Embodiment 182

    [0376] The method of any one of embodiments 146-181, wherein the effective amount of the MANF family protein is less than about: 0.5 μg, 2.5 μg, 5 μg, 7.5 μg, 12.5 μg, 25 μg, 50 μg, 75 μg, 100 μg, 150 μg, 250 μg, 500 μg, 1000 μg, 1250 μg, or 2500 μg per eye.

    Embodiment 183

    [0377] The method of any one of embodiments 146-182, wherein the effective amount of the another active agent is about: 0.5 μg-2.5 μg, 0.5 μg-5 μg, 0.5 μg-7.5 μg, 0.5 μg-12.5 μg, 0.5 μg-25 μg, 0.5 μg-50 μg, 0.5 μg-75 μg, 0.5 μg-10 μg, 0.5 μg-150 μg, 0.5 μg-250 μg, 0.5 μg-500 μg, 0.5 μg-1000 μg, 0.5 μg-1250 μg, 0.5 μg-2500 μg, 2.5 μg-5 μg, 2.5 μg-70.5 μg, 2.5 μg-12.5 μg, 2.5 μg-25 μg, 2.5 μg-50 μg, 2.5 μg-75 μg, 2.5 μg-100 μg, 2.5 μg-150 μg, 2.5 μg-250 μg, 2.5 μg-500 μg, 2.5 μg-1000 μg, 2.5 μg-1250 μg, 2.5 μg-2500 μg, 5 μg-7.5 μg, 5 μg-12.5 μg, 5 μg-25 μg, 5 μg-50 μg, 5 μg-75 μg, 5 μg-100 μg, 5 μg-150 μg, 5 μg-250 μg, 5 μg-500 μg, 5 μg-1000 μg, 5 μg-1250 μg, 5 μg-2500 μg, 7.5 μg-12.5 μg, 7.5 μg-25 μg, 7.5 μg-50 μg, 7.5 μg-75 μg, 7.5 μg-100 μg, 7.5 μg-150 μg, 7.5 μg-250 μg, 7.5 μg-500 μg, 7.5 μg-1000 μg, 7.5 μg-1250 μg, 7.5 μg-2500 μg, 12.5 μg-25 μg, 12.5 μg-50 μg, 12.5 μg-75 μg, 12.5 μg-100 μg, 12.5 μg-150 μg, 12.5 μg-250 μg, 12.5 μg-500 μg, 12.5 μg-1000 μg, 12.5 μg-1250 μg, 12.5 μg-2500 μg, 25 μg-50 μg, 25 μg-75 μg, 25 μg-100 μg, 25 μg-150 μg, 25 μg-250 μg, 25 μg-500 μg, 25 μg-1000 μg, 25 μg-1250 μg, 25 μg-2500 μg, 50 μg-75 μg, 50 μg-100 μg, 50 μg-150 μg, 50 μg-250 μg, 50 μg-500 μg, 50 μg-1000 μg, 50 μg-1250 μg, 50 μg-2500 μg, 75 μg-100 μg, 75 μg-150 μg, 75 μg-250 μg, 75 μg-500 μg, 75 μg-1000 μg, 75 μg-1250 μg, 75 μg-2500 μg, 100 μg-150 μg, 100 μg-250 μg, 100 μg-500 μg, 100 μg-1000 μg, 100 μg-1250 μg, 100 μg-2500 μg, 150 μg-250 μg, 150 μg-500 μg, 150 μg-1000 μg, 150 μg-1250 μg, 150 μg-2500 μg, 250 μg-500 μg, 250-500 μg, 250 μg-1000 μg, 250 μg-1250 μg, 250 μg-2500 μg, 500 μg-1000 μg, 500 μg-1250 μg, 500 μg-2500 μg, 1000 μg-1250 μg, 1000 μg-2500 μg, or 1250 μg-2500 μg per eye.

    Embodiment 184

    [0378] The method of any one of embodiments 146-183, wherein the effective amount of the another active agent is at least about: 0.5 μg, 2.5 μg, 5 μg, 7.5 μg, 12.5 μg, 25 μg, 50 μg, 75 μg, 100 μg, 150 μg, 250 μg, 500 μg, 1000 μg, 1250 μg, or 2500 μg per eye.

    Embodiment 185

    [0379] The method of any one of embodiments 146-184, wherein the effective amount of the another active agent is less than about: 0.5 μg, 2.5 μg, 5 μg, 7.5 μg, 12.5 μg, 25 μg, 50 μg, 75 μg, 100 μg, 150 μg, 250 μg, 500 μg, 1000 μg, 1250 μg, or 2500 μg per eye.

    Embodiment 186

    [0380] The method of any one of embodiments 146-185, wherein the MANF family protein is administered once every 2 to 8 weeks.

    Embodiment 187

    [0381] The method of any one of embodiments 146-185, wherein the MANF family protein is administered once every 3 to 6 weeks.

    Embodiment 188

    [0382] The method of any one of embodiments 146-185, wherein the MANF family protein is administered once every month.

    Embodiment 189

    [0383] The method of any one of embodiments 146-185, wherein the MANF family protein is administered once every two months.

    Embodiment 190

    [0384] The method of any one of embodiments 146-185, wherein the MANF family protein is administered once every hour.

    Embodiment 191

    [0385] The method of any one of embodiments 146-185, wherein the MANF family protein is administered once every two hours.

    Embodiment 192

    [0386] The method of any one of embodiments 146-185, wherein the MANF family protein is administered once every four hours.

    Embodiment 193

    [0387] The method of any one of embodiments 146-185, wherein the MANF family protein is administered daily.

    Embodiment 194

    [0388] The method of any one of embodiments 146-185, wherein the MANF family protein is administered only once.

    Embodiment 195

    [0389] The method of any one of embodiments 146-185, wherein the MANF family protein is administered one, two, or three times per day.

    Embodiment 196

    [0390] The method of any one of embodiments 146-195, wherein the another active agent is administered once every 2 to 8 weeks.

    Embodiment 197

    [0391] The method of any one of embodiments 146-195, wherein the another active agent is administered once every 3 to 6 weeks.

    Embodiment 198

    [0392] The method of any one of embodiments 146-195, wherein the another active agent is administered once every month.

    Embodiment 199

    [0393] The method of any one of embodiments 146-195, wherein the another active agent is administered once every two months.

    Embodiment 200

    [0394] The method of any one of embodiments 146-195, wherein the another active agent is administered once every hour.

    Embodiment 201

    [0395] The method of any one of embodiments 146-195, wherein the another active agent is administered once every two hours.

    Embodiment 202

    [0396] The method of any one of embodiments 146-195, wherein the another active agent is administered once every four hours.

    Embodiment 203

    [0397] The method of any one of embodiments 146-195, wherein the another active agent is administered daily.

    Embodiment 204

    [0398] The method of any one of embodiments 146-195, wherein the another active agent is administered only once.

    Embodiment 205

    [0399] The method of any one of embodiments 146-195, wherein the another active agent is administered one, two, or three times per day.

    Embodiment 206

    [0400] A pharmaceutical composition comprising an amount of a MANF family protein and another active agent that is effective for treating a retinal disorder.

    Embodiment 207

    [0401] The pharmaceutical composition of embodiment 206, further comprising one or more pharmaceutically acceptable excipients.

    Embodiment 208

    [0402] The pharmaceutical composition of any one of embodiments 206-207, wherein the MANF family protein and the another active agent have a synergistic effect upon retinal ganglion cell survival.

    Embodiment 209

    [0403] The pharmaceutical composition of any one of embodiments 206-208, wherein the MANE family protein and the another active agent exhibit therapeutic synergy.

    Embodiment 210

    [0404] The pharmaceutical composition of any one of embodiments 206-209, wherein the MANE family protein and the another active agent have additive effects.

    Embodiment 211

    [0405] The pharmaceutical composition of any one of embodiments 206-210, wherein the MANF family protein is MANF, or a fragment thereof.

    Embodiment 212

    [0406] The pharmaceutical composition of any one of embodiments 206-211, wherein the MANF family protein is CDNF, or a fragment thereof.

    Embodiment 213

    [0407] The pharmaceutical composition of any one of embodiments 206-212, wherein the another active agent is a prostaglandin analog, a beta-adrenergic receptor antagonist, an alpha adrenergic agonist, a miotic agent, a carbonic anhydrase inhibitor, or a combination thereof.

    Embodiment 214

    [0408] The pharmaceutical composition of any one of embodiments 206-213, wherein the another active agent is a prostaglandin analog.

    Embodiment 215

    [0409] The pharmaceutical composition of embodiment 214, wherein the prostaglandin analog is latanoprost, bimatoprost, travoprost, unoprostone, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 216

    [0410] The pharmaceutical composition of any one of embodiments 206-215, wherein the another active agent is a beta-adrenergic receptor antagonist.

    Embodiment 217

    [0411] The pharmaceutical composition of embodiment 216, wherein the beta-adrenergic receptor antagonist is betaxolol, carteolol, levobunolol, metipranolol, timolol, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 218

    [0412] The pharmaceutical composition of any one of embodiments 206-217, wherein the another active agent is an alpha adrenergic agonist.

    Embodiment 219

    [0413] The pharmaceutical composition of embodiment 218, wherein the alpha adrenergic agonist is an α1 adrenergic agonist, an α2-adrenergic agonist, or any combination thereof.

    Embodiment 220

    [0414] The pharmaceutical composition of embodiment 219, comprising the α1 adrenergic agonist that is methoxamine, methylnorepinephrine, midodrine, oxymetazoline, metaraminol, phenylephrine, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 221

    [0415] The pharmaceutical composition of embodiment 219, comprising the α2 adrenergic agonist that is clonidine, guanfacine, guanabenz, guanoxabenz, guanethidine, xylazine, tizanidine, methyldopa, fadolimidine, dexmedetornmidine, brirnonidine, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 222

    [0416] The pharmaceutical composition of embodiment 218, wherein the alpha adrenergic agonist is methoxamine, methylnorepinephrine, midodrine, oxymetazoline, metaraminol, phenylephrine, clonidine, guanfacine, guanabenz, guanoxabenz, guanethidine, xylazine, tizanidine, methyldopa, fadolmidine, dexmedetomidine, amidephrine, amitraz, anisodamine, apraclonidine, brimonidine, cirazoline, detomidine, dexmedetomidine, epinephrine, ergotamine, etilefrine, indanidine, lofexidine, medetomidine, mephentermine, metaramninol, methoxamine, mivazerol, naphazoline, norepinephrine, norfenefrine, octopamine, oxymetazoline, phenylpropanolamine, rilmenidine, romifidine, synephrine, talipexole, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 223

    [0417] The pharmaceutical composition of any one of embodiments 206-222, wherein the another active agent is an α1 adrenergic agonist that is methoxamine, methylnorepinephrine, midodrine, oxymetazoline, metaraminol, phenyliephrine, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 224

    [0418] The pharmaceutical composition of any one of embodiments 206-223, wherein the another active agent is an α2 adrenergic agonist that is clonidine, guanfacine, guanabenz, guanoxabenz, guanethidine, xylazine, tizanidine, methyldopa, fadolmidine, dexmedetomidine, brimonidine, or a pharmaceutical salt thereof, or any combination thereof.

    Embodiment 225

    [0419] The pharmaceutical composition of any one of embodiments 206-224, wherein the another active agent is brimonidine or a pharmaceutical salt thereof.

    Embodiment 226

    [0420] The pharmaceutical composition of any one of embodiments 206-225, wherein the MANF family protein is MANF, or a fragment thereof and the other active agent is brimonidine or a pharmaceutical salt thereof.

    Embodiment 227

    [0421] The pharmaceutical composition of embodiment 226, wherein the MANF and the brimonidine or a pharmaceutical salt thereof have a synergistic effect upon retinal ganglion cell survival.

    Embodiment 228

    [0422] The pharmaceutical composition of embodiment 226, wherein the MANF and the brirnonidine or a pharmaceutical salt thereof exhibit therapeutic synergy.

    Embodiment 229

    [0423] The pharmaceutical composition of any one of embodiments 206-228, wherein the retinal disorder is retinal ischemia.

    Embodiment 230

    [0424] The pharmaceutical composition of embodiment 229, wherein the retinal ischemia is caused by glaucoma, carotid artery stenosis, Takayasu's arteritis, giant cell arteritis, thromboembolism, central retinal artery occlusion, central retinal vein occlusion, diabetes, or a combination thereof:

    Embodiment 231

    [0425] The pharmaceutical composition of any one of embodiments 206-230, wherein the retinal disorder is macular degeneration, diabetic eye disease, age-related macular degeneration, branch retinal vein occlusion, central retinal vein occlusion, central retinal artery occlusion, central serous retinopathy, diabetic retinopathy, Fuchs' dystrophy, giant cell arteritis, glaucoma, hypertensive retinopathy, thyroid eye disease, iridocorneal endothelial syndrome, ischemic optic neuropathy, juvenile macular degeneration, macular edema, macular telangioctasia, marfan syndrome, optic neuritis, photokeratitis, retinitis pigmentosa, retinopathy of prematurity, stargardt disease, usher syndrome, or any combination thereof.

    Embodiment 232

    [0426] The pharmaceutical composition of embodiment 231, wherein the retinal disorder is age-related macular degeneration that is dry age related macular degeneration or wet age related macular degeneration.

    Embodiment 233

    [0427] The pharmaceutical composition of any one of embodiments 206-232, wherein the MANF family protein and the another active agent are administered separately.

    Embodiment 234

    [0428] The pharmaceutical composition of any one of embodiments 206-233, wherein the MANF family protein and the another active agent are administered together.

    Embodiment 235

    [0429] The pharmaceutical composition of any one of embodiments 206-234, wherein the MANF family protein is administered orally, parenterally, intranasally, or intravenously.

    Embodiment 236

    [0430] The pharmaceutical composition of any one of embodiments 206-235, wherein the another active agent is administered orally, parenterally, intranasally, or intravenously.

    Embodiment 237

    [0431] The pharmaceutical composition of any one of embodiments 206-236, wherein administration of the MANF family protein is topical, subconjunctival, intravitreal, retrobulbar, intracameral, systemic, or a combination thereof.

    Embodiment 238

    [0432] The pharmaceutical composition of any one of embodiments 206-237, wherein administration of the another active agent is topical, subconjunctival, intravitreal, retrobulbar, intracameral, systemic, or a combination thereof.

    Embodiment 239

    [0433] The pharmaceutical composition of any one of embodiments 206-238, wherein the effective amount of the MANF family protein is about: 0.5 μg-2.5 μg, 0.5 μg-5 μg, 0.5 μg-7.5 μg, 0.5 μg-12.5 μg, 0.5 μg-25 μg, 0.5 μg-50 μg, 0.5 μg-75 μg, 0.5 μg-100 μg, 0.5 μg-0.5 μg, 0.5 μg, 0.5 μg-500 μg, 0.5 μg-500 μg, 0.5 μg-1000 μg, 0.5 μg-1250 μg, 0.5 μg-2500 μg, 2.5 μg-5 μg, 2.5 μg-7.5 μg, 2.5 μg-12.5 μg, 2.5 μg-25 μg, 2.5 μg-50 μg, 2.5 μg-75 μg, 2.5 μg-100 μg, 2.5 μg-150 μg, 2.5 μg-250 μg, 2.5 μg-500 μg, 2.5 μg-1000 μg, 2.5 μg-1250 μg, 2.5 μg-2500 μg, 5 μg-7.5 μg, 5 μg-12.5 μg, 5 μg-25 μg, 5 μg-50 μg, 5 μg-75 μg, 5 μg-100 μg, 5 μg-150 μg, 5 μg-250 μg, 5 μg-500 μg, 5 μg-1000 μg, 5 μg-1250 μg, 5 μg-2500 μg, 7.5 μg-12.5 μg, 7.5 μg-25 μg, 7.5 μg-50 μg, 7.5 μg-75 μg, 7.5 μg-100 μg, 7.5 μg-150 μg, 7.5 μg-250 μg, 7.5 μg-500 μg, 7.5 μg-1000 μg, 7.5 μg-1250 μg, 7.5 μg-2500 μg, 12.5 μg-25 μg, 12.5 μg-50 μg, 12.5 μg-75 μg, 12.5 μg-100 μg, 12.5 μg-150 μg, 12.5 μg-250 μg, 12.5 μg-500 μg, 12.5 μg-1000 μg, 12.5 μg-1250 μg, 12.5 μg-2500 μg, 25 μg-50 μg, 25 μg-75 μg, 25 μg-100 μg, 25 μg-150 μg, 25 μg-250 μg, 25 μg-500 μg, 25 μg-1000 μg, 25 μg-1250 μg, 25 μg-2500 μg, 50 μg-75 μg, 50 μg-100 μg, 50 μg-150 μg, 50 μg-250 μg, 50 μg-500 μg, 50 μg-1000 μg, 50 μg-1250 μg, 50 μg-2500 μg, 75 μg-100 μg, 75 μg-150 μg, 75 μg-250 μg, 75 μg-500 μg, 75 μg-1000 μg, 75 μg-1250 μg, 75 μg-2500 μg, 100 μg-150 μg, 100 μg-250 μg, 100 μg-500 μg, 100 μg-1000 μg, 100 μg-1250 μg, 100 μg-2500 μg, 150 μg-250 μg, 150 μg-500 μg, 150 μg-1000 μg, 150 μg-1250 μg, 150 μg-2500 μg, 250 μg-500 μg, 250 μg-1000 μg, 250 μg-1250 μg, 250 μg-2500 μg, 500 μg-1000 μg, 500 μg-1250 μg, 500 μg-2500 μg, 1000 μg-1250 μg, 1000 μg-2500 μg, or 1250 μg-2500 μg per eye.

    Embodiment 240

    [0434] The pharmaceutical composition of any one of embodiments 206-239, wherein the effective amount of the MANF family protein is at least about: 0.5 μg, 2.5 μg, 5 μg, 7.5 μg, 12.5 μg, 25 μg, 50 μg, 75 μg, 100 μg, 150 μg, 250 μg, 500 μg, 1000 μg, 1250 μg, or 2500 μg per eye.

    Embodiment 241

    [0435] The pharmaceutical composition of any one of embodiments 206-240, wherein the effective amount of the MANF family protein is less than about: 0.5 μg, 2.5 μg, 5 μg, 7.5 μg, 12.5 μg, 25 μg, 50 μg, 75 μg, 100 μg, 150 μg, 250 μg, 500 μg, 1000 μg, 1250 μg, or 2500 μg per eye.

    Embodiment 242

    [0436] The pharmaceutical composition of any one of embodiments 206-241, wherein the effective amount of the another active agent is about: 0.5 μg-2.5 μg, 0.5 μg-5 μg, 0.5 μg-7.5 μg, 0.5 μg-12.5 μg, 0.5 μg-25 pug, 0.5 μg-50 μg, 0.5 μg-75 μg, 0.5 μg-100 μg, 0.5 μg-150 μg, 0.5 μg-250 μg, 0.5 μg-500 μg, 0.5 μg-1000 μg, 0.5 μg-1250 μg, 0.5 μg-2500 μg, 2.5 μg-5 μg, 2.5 μg-7.5 μg, 2.5 μg-12.5 μg, 2.5 μg-25 μg, 2.5 μg-50 μg, 2.5 μg-75 μg, 2.5 μg-100 μg, 2.5 μg-150 μg, 2.5 μg-250 μg, 2.5 μg-500 μg, 2.5 μg-1000 μg, 2.5 μg-1250 μg, 2.5 μg-2500 μg, 5 μg-7.5 μg, 5 μg-12.5 μg, 5 μg-25 μg, 5 μg-50 μg, 5 μg-75 μg, 5 μg-100 μg, 5 μg-150 μg, 5 μg-250 μg, 5 μg-100 μg, 5 μg-1000 μg, 55 μg-1250 μg, 5 μg-25 μg-5 μg-2500 μg, 7.5 μg-12.5 μg, 7.5 μg-25 μg, 7.5 μg-50 μg, 7.5 μg-75 μg, 7.5 μg-100 μg, 7.5 μg-150 μg, 7.5 μg-250 μg, 7.5 μg-500 μg, 7.5 μg-1000 μg, 7.5 μg-1250 μg, 7.5 μg-2500 μg, 12.5 μg-25 μg, 12.5 μg-50 μg, 12.5 μg-75 μg, 12.5 μg-100 μg, 12.5 μg-150 μg, 12.5 μg-250 μg, 12.5 μg-500 μg, 12.5 μg-1000 μg, 12.5 μg-1250 μg, 12.5 μg-2500 μg, 25 μg-50 μg, 25 μg-75 μg, 25 μg-100 μg, 25 μg-150 μg, 25 μg-250 μg, 25 μg-500 μg, 25 μg-1000 μg, 25 μg-1250 μg, 25 μg-2500 μg, 50 μg-75 μg, 50 μg-100 μg, 50 μg-150 μg, 50 μg-250 μg, 50 μg, 50 μg, 50 μg-1000 μg, 50 μg-1250 μg, 50 μg-2500 μg, 75 μg-100 μg, 75 μg-150 μg, 75 μg-250 μg, 75 μg-500 μg, 75 μg-1000 μg, 75 μg-1250 μg, 75 μg-2500 μg, 100 μg-150 μg, 100 μg-250 μg, 100 μg-500 μg, 100 μg-1000 μg, 100 μg-1250 μg, 100 μg-2500 μg, 150 μg-250 μg, 150 μg-500 μg, 150 μg-1000 μg, 150 μg-1250 μg, 150 μg-2500 μg, 250 μg-500 μg, 250 μg-1000 μg, 250 μg-1250 μg, 250 μg-2500 μg, 500 μg-1000 μg, 500 μg-1250 μg, 500 μg, 250 μg-1000 μg-1250 μg, 1000 μg-2500 μg, or 1250 μg-2500 μg per eye.

    Embodiment 243

    [0437] The pharmaceutical composition of any one of embodiments 206-242, wherein the effective amount of the another active agent is at least about: 0.5 μg, 2.5 μg, 5 μg, 7.5 μg, 12.5 μg, 25 μg, 50 μg, 75 μg, 100 μg, 150 μg, 250 μg, 500 μg, 1000 μg, 1250 μg, or 2500 μg per eye.

    Embodiment 244

    [0438] The pharmaceutical composition of any one of embodiments 206-243, wherein the effective amount of the another active agent is less than about: 0.5 μg, 2.5 μg, 5 μg, 7.5 μg, 12.5 μg, 25 μg, 50 μg, 75 μg, 100 μg, 150 μg, 250 μg, 500 μg, 1000 μg, 1250 μg, or 2500 μg per eye.

    Embodiment 245

    [0439] The pharmaceutical composition of any one of embodiments 206-244, wherein the MANF family protein is administered once every 2 to 8 weeks.

    Embodiment 246

    [0440] The pharmaceutical composition of any one of embodiments 206-244, wherein the MANF family protein is administered once every 3 to 6 weeks.

    Embodiment 247

    [0441] The pharmaceutical composition of any one of embodiments 206-244, wherein the MANF family protein is administered once every month.

    Embodiment 248

    [0442] The pharmaceutical composition of any one of embodiments 206-244, wherein the MANF family protein is administered once every two months.

    Embodiment 249

    [0443] The pharmaceutical composition of any one of embodiments 206-244, wherein the MANF family protein is administered once every hour.

    Embodiment 250

    [0444] The pharmaceutical composition of any one of embodiments 206-244, wherein the MANF family protein is administered once every two hours.

    Embodiment 251

    [0445] The pharmaceutical composition of any one of embodiments 206-244, wherein the MANF family protein is administered once every four hours.

    Embodiment 252

    [0446] The pharmaceutical composition of any one of embodiments 206-244, wherein the MANF family protein is administered daily.

    Embodiment 253

    [0447] The pharmaceutical composition of any one of embodiments 206-244, wherein the MANF family protein is administered only once.

    Embodiment 254

    [0448] The pharmaceutical composition of any one of embodiments 206-244, wherein the MANF family protein is administered one, two, or three times per day.

    Embodiment 255

    [0449] The pharmaceutical composition of any one of embodiments 206-254, wherein the another active agent is administered once every 2 to 8 weeks.

    Embodiment 256

    [0450] The pharmaceutical composition of any one of embodiments 206-254, wherein the another active agent is administered once every 3 to 6 weeks.

    Embodiment 257

    [0451] The pharmaceutical composition of any one of embodiments 206-254, wherein the another active agent is administered once every month.

    Embodiment 258

    [0452] The pharmaceutical composition of any one of embodiments 206-254, wherein the another active agent is administered once every two months.

    Embodiment 259

    [0453] The pharmaceutical composition of any one of embodiments 206-254, wherein the another active agent is administered once every hour.

    Embodiment 260

    [0454] The pharmaceutical composition of any one of embodiments 206-254, wherein the another active agent is administered once every two hours.

    Embodiment 261

    [0455] The pharmaceutical composition of any one of embodiments 206-254, wherein the another active agent is administered once every four hours.

    Embodiment 262

    [0456] The pharmaceutical composition of any one of embodiments 206-254, wherein the another active agent is administered daily.

    Embodiment 263

    [0457] The pharmaceutical composition of any one of embodiments 206-254, wherein the another active agent is administered only once.

    Embodiment 264

    [0458] The pharmaceutical composition of any one of embodiments 206-254, wherein the another active agent is administered one, two, or three times per day.

    Embodiment 265

    [0459] The pharmaceutical composition of any one of embodiments 206-264, provided as an eye drop or an injectable liquid.

    Examples

    Example 1: Production of Human Recombinant MANF

    [0460] Human MANF is expressed in a pre-form of 179 amino acid residues. The MANF protein is N-terminally processed and a signal sequence of 21 amino acids is removed, yielding the mature, secreted and active MANF with a length of 158 amino acid residues. The mature human MANF protein starts with the amino acid sequence LRPGD . . . and ends with . . . RTDL (See Table 1). In this example, MANF product is the recombinant form of human MANE (i.e., hrMANF) encompassing the mature sequence of 158 amino acid residues.

    [0461] The three-dimensional structure of full-length MANF has been determined by NMR and by X-ray crystallography. The three-dimensional structure of human MANF is shown in FIG. 1. The N-terminal domain (N-domain) of MANF encompassing residues L20-L120 is entirely helical, with four α-helices and a rare structural element, a π helix, immediately followed by a 310 helix. Most m-helices are involved in binding enzyme substrates or ligand molecules. The N-domain contains three disulfide bonds. A cluster of positively charged residues in the π and 310 helices are conserved among MANF homologues.

    [0462] The C-terminal domain (C-domain) of MANF encompasses residues T126-L158 and is well defined in the NMR solution structure. This domain is also entirely helical and contains one disulfide bond between conserved cysteines in the CXXC motif between α-helices 5 and 6. The CXXC motif is a consensus sequence of proteins of the thiol-protein oxidoreductase superfamily, other members of which include thioredoxins, glutaredoxins, and peroxiredoxins.

    [0463] The recombinant form of human MANF (hrMANF) was produced using the QMCF technology. The QMCF technology uses an episomal protein expression system that allows for expression of recombinant proteins in mammalian cells over an extended period of time (e.g., up to 50 days). The hrMANF protein was expressed by the QMCF protein production technology using the CHOEBNALT85 suspension cell line over a period of 11 days. The hrMANF was purified from the supernatant of expressing cells using a two-step ion-exchange chromatography and gel filtration (Superdex 75). The final hrMANF storage buffer was phosphate buffered saline (PBS) pH 7.4.

    [0464] The purity of the expressed hrMANF protein was evaluated by Coomassie-stained SDS-PAGE and Western blot (FIG. 2).

    Example 2: Evaluation of a Single Intravitreal Administration of MANF in a Rat Model of Retinal Ischemia-Induced Ganglion Cell Degeneration

    SUMMARY

    [0465] Purpose:

    [0466] The aim of this study was to evaluate the effects of intravitreal administration of MANF at 3 different doses (0.15 mg/mL, 0.5 ing/mL and 1.5 mg/mL) on retinal electric activity and retinal ganglion cell survival after a transient ischemia by clamping in albino rats.

    [0467] In this Example, retinal ischemia was induced by transient vascular clamping of the optic nerve in the right eyes of Sprague Dawley albino rats for 45 min. Reperfusion was initiated by the release of the clamp. Retinal function was evaluated by ERG at baseline and 7 days after ischemia. RGC survival was assessed by immunohistochemistry 7 days after ischemia. This model is appropriate for the study of acute RAO, but it may not represent chronic retinal artery hypoperfusion.

    [0468] Methods:

    [0469] Sixty (60) rats were randomly divided into five (5) groups of twelve (12) animals each.

    [0470] MANF at 0.15 mg/mL, 0.5 mg/mL and 1.5 mg/mL or vehicle (phosphate buffered saline; PBS) were administered by intravitreal administration (4 μL) in right eyes once, immediately after reperfusion.

    [0471] Reference (Aphagan®, 1 mg/kg brimonidine) was intraperitoneally dosed once, 30 min before optic nerve clamping.

    [0472] Retinal ischemia was induced by vascular clamping of the optic nerve in the right eyes for 45 min. Reperfusion was initiated by the release of the clamp. Retinal function was evaluated by electroretinography (ERG) at baseline and 7 days after ischemia. Retinal Ganglion Cell (RGC) survival was assessed by immunohistology 7 days after ischemia.

    [0473] Results:

    [0474] General Behavior:

    [0475] The general behavior and appearance of all animals were not altered by MANF treatment, regardless the dose. All animals showed a normal body weight gain from baseline to Day 7. No abnormal behavior or unhealthy signs were found for any treated animals during the study period. However, 3 animals died during the study: One animal treated with 1 mg/kg brimonidine was found dead on Day 0 after clamping. One animal each treated with 1 mg/kg brimonidine or PBS were found dead on Day 7 before evaluations were performed. These deaths were attributed to the effects of anesthesia and not to the treatment.

    [0476] Electroretinogram:

    [0477] The functional status of the retina was evaluated by electroretinography one week after the ischemic insult and compared to baseline values determined just prior to optic nerve ischemia. The b-wave is induced by potassium efflux shunted from activated bipolar cells by Müller cells and is an electrophysiological indicator of inner retinal signal transmission. The ERG parameters applied were the following: Color: white maximum; Maximum intensity: 2.6 cd.Math.s/m2 (0 dB); Duration 0.24 ms; Numbers of flashes: 1; Filter: 50 Hz; Impedance threshold: 90 kΩ.

    [0478] The results are presented in Table 5 and FIG. 3. As shown in Table 5 and FIG. 3, the clamping of the optic nerve for 45 minutes resulted in a marked impairment of the b-wave amplitude and of the RGC density in PBS-treated animals one week after the ischemic insult.

    [0479] The b-wave amplitude and the RGC survival were improved after single intravitreal administration of MANF, regardless the dose, as well as with 1 mg/kg brimonidine treatment.

    [0480] A significant improvement of the b-wave recovery was shown after intravitreal administration of MANF at 0.5 mg/mL (p=0.0193, ANOVA followed by Dunn's multiple comparison tests against PBS control). The b-wave amplitude on Day 7 recovered to 52% of the baseline mean value.

    [0481] A marked but not statistically significant protection from the reduction in b-wave amplitude was observed after intravitreal administration of MANF at 0.15 mg/mL and 1.5 mg/mL, in comparison with the PBS-treated group. The b-wave amplitudes were 49% and 47% of the mean baseline value for the groups treated with MANF at 0.15 mg/mL and 1.5 mg/mL, respectively, while the PBS-treated group displayed a b-wave amplitude of 37% on Day 7 compared to the baseline value.

    [0482] Prophylactically administered Alphagan® (1 mg/kg brimonidine) led to a significant protection of the b-wave amplitude in comparison with the vehicle group (p=0.015, ANOVA followed by Dunn's multiple comparison tests against PBS control). The b-wave amplitude recovered to 59% of the baseline mean value.

    TABLE-US-00006 TABLE 5 Normalized b-wave amplitudes and BrN3A-positive cell density one week after ischemia (right eye) MANF MANF MANF 0.15 0.5 1.5 Treatment mg/mL mg/mL mg/mL PBS Alphagan ® Normalized Mean ± .sup. 49 ± 13% .sup. 52 ± 15% .sup. 47 ± 10% .sup. 37 ± 11% .sup. 59 ± 22% b-wave SD amplitude (% of baseline) RGC density Mean ± 403 ± 189 465 ± 301 488 ± 214 264 ± 261 578 ± 185 .sup.(1) (cells/mm.sup.2) SD Note: .sup.(1) non ischemic retina: 2121 ± 455 RGC/mm.sup.2

    [0483] Retinal Ganglion Cell Survival:

    [0484] To assess the effect of the treatment on RGC viability, the RGC density was evaluated 7 days after ischemia by immunohistochemistry with a stain for the RGC specific marker Brn3a.

    [0485] The results are shown in Table 5 and FIG. 4. As shown in Table 5 and FIG. 4, the clamping of the optic nerve for 45 minutes resulted in a marked impairment of the RGC density in PBS-treated animals one week after the ischemic insult.

    [0486] The RGC density in the retina of non-ischemic eyes (two left eyes from each group) was 2121±455 RGC/mm.sup.2 (n=10). One week after ischemia, mean RGC density decreased to 264±261 RGC/mm.sup.2 (−88% compared to non-ischemic eyes) in the PBS-treated group.

    [0487] Intravitreal administration of MANF at 0.15 mg/mL, 0.5 mg/mL and 1.5 mg/mL, showed a trend in improvement of the mean RGC survival 7 days after injury with 403±189 cells/mm.sup.z, 465±301 cells/mm.sup.2 and 488±214 cells/mm.sup.2, respectively.

    [0488] Intraperitoneal administration of Alphagan® (1 mg/kg brimonidine) significantly prevented the decrease of surviving RGCs, with 578±185 RGCs/mm.sup.2 (p=0.0177, ANOVA followed by Dunn's multiple comparison tests against PBS control), when compared with the PBS-treated group.

    CONCLUSION

    [0489] Under the experimental conditions, a single intravitreal administration of MANF at 0.15 mg/mL, 0.5 mg/mL and 1.5 mg/mL displayed marked efficacy in preserving retinal function (ERG, b-wave amplitude) and a trend in protecting RGCs after a one-week reperfusion period in a rat model of retinal ischemia with clamping. The effect on the b-wave amplitude observed in the MANF (0.5 mg/mL) group was significantly different than the vehicle (PBS) treated group.

    [0490] The reference Alphagan® (1 mg/kg brimonidine) showed a significant efficiency in improving retinal function and protecting RGC.

    Introduction

    Background

    [0491] Retinal ischemia is a common cause of visual impairment and blindness. A number of clinical conditions, including central retinal artery or vein occlusion (CRAO, CRVO), diabetes, or glaucoma make themselves manifest by a reduction of retinal blood supply. Retinal ischemia initiates a self-reinforcing destructive cascade involving neuronal depolarization, calcium influx and oxidative stress initiated by energy failure and increased glutamatergic stimulation. The initial ischemic insult results in cellular perturbations that continue to progress despite or perhaps because of, reperfusion of the ischemic tissue. Ultimately, the retinal ganglion cells (RGC) die via apoptosis.

    [0492] Many studies have focused attention on histological or biochemical measures of protection of retinal ganglion cells. Demonstration of drug efficacy may also be assessed by measuring retinal function. The functional status of the retina is monitored by electroretinogram (ERG). The b-wave, which is induced by potassium efflux shunted “on” from bipolar cells by Muller cells in response to illumination, is the ERG-component most susceptible to ischemia.

    [0493] Thus, suppression of the b-wave of the ERG has been taken as an electrophysiological measure of retinal blood flow in humans and in experimental animal models. The a-wave, which is induced by light-activated hyperpolarization of photoreceptors, is usually less affected by changes in blood flow. Retinal protection in this model is also assessed directly by counting RGCs stained with BrN3a.

    [0494] Several laboratories have shown the capacity of different substances, including α2-adrenergic agonists, to prevent degeneration induced by retinal ischemia. Brimonidine has been demonstrated to show a neuroprotective effect in this model.

    [0495] Materials

    [0496] Test Item

    TABLE-US-00007 TABLE 6 Material table - Test item Material Test item Denomination MANF Concentration 3 mg/mL Characteristics (form, aspect, Injectable solution etc.) Batch number 03.05.2013 Icosagen Quantity received 5 × 1 mL Preparation 6 μg/eye (1.5 mg/mL)-2 μg/eye (0.5 mg/mL)-0.6 μg/eye (0.15 mg/mL) Diluted in PBS Storage conditions and stability Long: −80 ± 7° C.; In use: at room temperature

    [0497] Control Item

    TABLE-US-00008 TABLE 7 Material table - Control item Material Control item Denomination Vehicle (PBS) Characteristics (form, aspect, Solution molecular weight, etc.) Reference/Batch number Sigma: P5368/SLBG9935V Preparation (concentration, vehicle, One pouch dissolved in 1 L of composition, appearance after distilled water, was yield 0.01M formulation, pH) PBS; pH 7.4 Storage conditions Room temperature

    [0498] Reference Item

    TABLE-US-00009 TABLE 8 Material table - Reference item Material Reference item Denomination Alphagan ® (brimonidine) Concentration 2 mg/mL Characteristics (form, aspect, Solution molecular weight, etc.) Supplier Allergan Batch number E72453 Purity NA Preparation Ready to use Storage conditions Room temperature

    [0499] Animals and Husbandry

    [0500] All animals were treated according to the Directive 2010/63/UE European Convention for the Protection of Vertebrate Animals used for Experimental and other scientific purposes, and to the Association for Research in Vision and Ophthalmology (ARVO) Statement for the Use of Animals in Ophthalmic and Vision Research.

    [0501] Animals

    [0502] Animals

    [0503] Species: Rat. This is the species most commonly used in this experimental model.

    [0504] Strain: Sprague Dawley (albino).

    [0505] Age: Approximately 6 weeks (on ordering).

    [0506] Number/sex: 68 males (study 60: reserve 8).

    [0507] Breeder: “Charles River”—F-69592 L'Arbresie Cedex.

    [0508] Identification

    [0509] Tails were marked using a permanent ink marker, following the inclusion examination.

    [0510] Clinical Examination and Health Status

    [0511] Animals were held in observation for at least 1 week following their arrival. Animals were observed daily for signs of illness and particular attention was paid to their eyes.

    [0512] Housing

    [0513] Animal Husbandry

    [0514] Animals were housed in standard cages (two or three animals per cage), under identical environmental conditions. The temperature was held at 22±2° C. and the relative humidity at 55±10%. Rooms were continuously ventilated (15 air volumes per hour).

    [0515] Temperature and relative humidity were continuously controlled and recorded. Animals were routinely exposed (in-cage) to 10-200 lx light in a 12-hour light and darkness cycle.

    [0516] Food and Water

    [0517] Throughout the study, animals had free access to food and water. They were fed a standard dry pellet diet (Rod16-H-LASvendi GmbH D-59494 Soest Germany). Tap water, regularly analyzed, was available ad libitum from plastic bottles.

    [0518] Design and Procedure

    [0519] Study Design

    [0520] The schedule is presented in Table 9.

    TABLE-US-00010 TABLE 9 Study design Endpoints Group Rat Treatment Histological #ID #ID Induction Compound Dose Dosing regimen ERG evaluation 1 R#13 Retinal MANF 0.15 Intravitreal Scotopic RGCs to ischemia mg/mL administration in conditions quantification R#24 by optic right eyes (4 μL) 0 dB, both on 2 R#37 nerve MANF 0.5 once, eyes flatmounted to clamping mg/mL immediately after Baseline injured R#48 for 45 reperfusion and Day 7 retinas on 3 R#25 min on MANF 1.5 Day 7 to right eye mg/mL R#36 4 R#1 Vehicle — to (PBS) R#12 5 R#49 Alphagan ® 1 Intraperitoneal to (Brimonidine) mg/kg administration R#60 (0.5 mL/kg) once 30 min before induction

    [0521] Experimental Procedure

    [0522] Selection of the Animals

    [0523] Sixty (60) animals were included in this study out of sixty-eight (68) ordered.

    [0524] Only healthy animals with no visible sign of ocular defect were randomly assigned to the study groups, using a macrofunction in Excel® software on the basis of ERG baseline (b-wave amplitude in right eye).

    [0525] Route and Method of Administration

    [0526] Test and control items were injected intravitreally (4 μL) in right eye from anesthetized rat using a mix of xylazine/ketamine and a 30-G needle mounted on a syringe, immediately after reperfusion.

    [0527] Reference item was intraperitoneally dosed using a 0.5 mL/kg volume of administration, 30 min before induction.

    [0528] General In Vivo Observations

    [0529] Body Weight

    [0530] The body weight of all animals was recorded before the start of the study, on Day 0 and at the end of the study (Day 7).

    [0531] General Behavior

    [0532] Each day, the general behavior and the aspect of all animals were observed.

    [0533] Ischemia/Reperfusion Methods and Measurements

    [0534] Clamping

    [0535] Right eyes underwent a temporal orbitectomy combined with periorbital stripping. The globe remained in the orbit and was completely isolated on a pedicle consisting of the optic nerve, ophthamociliary arteries and the venous outflow. A clamp placed around the pedicle initiated the global ocular ischemia when tightened.

    [0536] Ischemia was maintained for 45 minutes. The reperfusion period was initiated by the release of the clamp.

    [0537] Evaluations and Measurements

    [0538] ERG was recorded before ischemia (baseline) and 7 days after reperfusion in both eyes. The a-wave and b-wave amplitudes (μV) were measured for each ERG; the a-wave and b-wave amplitudes as a percentage of the baseline values obtained before ischemia. Fifteen (15) min before measurement, 10 μL. Mydriaticum (0.5% tropicamide) were instilled for pupillary dilatation.

    [0539] ERG parameters: [0540] Color: white maximum. [0541] Maximum intensity: 2.6 cd.Math.s/m2 (0 dB); Duration 0.24 ms; number of flash: 1. [0542] Filter: 50 Hz. [0543] Impedance Threshold: 90 kΩ.

    [0544] Study Termination and Retinal Ganglion Cell (RGC) Evaluation

    [0545] At the end of the study, animals were euthanized by intraperitoneal injection of overdosed pentobarbital. This method is one of the recommended methods for euthanasia by European authorities.

    [0546] After euthanasia, the right eyeballs were fixed in Formalin 4% (24 h at 4° C.), dissected and retinas were flat mounted. Two left eyes retinas per group were sampled and processed the same as the right eye retinas. They served as naïve controls. The flat mounted preparations were stained with an Alexa 594 conjugated anti-BRN3A (Brain-specific hoeobox/POU domain protein 3A, Chemicon, cat #mAb1585) to label RGC. Fluorescence images were recorded with Apotome microscope at magnification ×10 (Zeiss). RGC were counted with Image J software in 8 locations for each retina area (2 pictures per quarter). The cell count was reported in cell/mm.sup.2.

    [0547] Data Processing

    [0548] Results were expressed in individual and summarized data tables using Microsoft Excel® Software.

    [0549] Statistical Analysis

    [0550] The statistical analyses were performed using the software GraphPad Prism.

    [0551] The statistical analysis results are summarized in Tables 10 and 11.

    [0552] a- and b-wave amplitudes were expressed as mean and standard deviation.

    [0553] A Kruskal-Wallis analysis was performed on the individual right eye b-wave amplitudes. The drug effect was assessed using the Dunn's multiple comparison tests; each treated group was compared to the vehicle.

    [0554] A Kruskal-Wallis analysis was performed on the individual RGC densities. The drug effect was assessed using the Dunn's multiple comparison tests; each treated group was compared to the vehicle,

    [0555] The p value has to be lower than 0.05 for the difference to be significant.

    [0556] Results

    [0557] General Behavior and Body Weight

    [0558] Body weights measures are reported in Table 12.

    [0559] All animals showed a normal body weight gain from baseline to Day 7.

    [0560] No abnormal behaviour or unhealthy signs were found for any treated animals during the study period. However, 3 animals died during the study: [0561] Animal R#55 treated with 1 mg/kg brimonidine was found dead on Day 0 after clamping. [0562] Animal R#56 treated with 1 mg/kg brimonidine and animal treated with PBS were found dead on Day 7 before evaluations.

    [0563] These deaths were related to anesthesia and not to the treatment.

    TABLE-US-00011 TABLE 10 Statistical analysis - Right eye b-wave amplitudes on Day 7 (% baseline) Kruskal-Wallis test P value 0.0243 Exact or approximate P value? Approximate P value summary * Do the medians vary signif. (P < 0.05) Yes Number of groups 5 Kruskal-Wallis statistic 11.21 Data summary Number of treatments (columns) 5 Number of values (total) 56 Number of families 1 Number of comparisons per family 4 Alpha 0.05 Dunn's multiple Mean rank Adjusted comparisons test diff. Significant? Summary P Value PBS vs. MANF −14.09 No ns 0.1712 0.15 mg/mL PBS vs. MANF −19.2 Yes * 0.0193 0.5 mg/mL PBS vs. MANF −10.7 No ns 0.4648 1.5 mg/mL PBS vs. Aphagan −20.66 Yes * 0.015 Mean Mean Mean Test details rank 1 rank 2 rank diff. n1 n2 PBS vs. MANF 15.64 29.73 −14.09 11 11 0.15 mg/mL PBS vs. MANF 15.64 34.83 −19.2 11 12 0.5 mg/mL PBS vs. MANF 15.64 26.33 −10.7 11 12 1.5 mg/mL PBS vs. Aphagan 15.64 36.3 −20.66 11 10

    TABLE-US-00012 TABLE 11 Statistical analysis - Surviving retinal ganglion cell density or Day 7 Kruskal-Wallis test P value 0.0667 Exact or approximate P value? Approximate P value summary ns Do the medians vary signif. (P < 0.05) No Number of groups 5 Kruskal-Wallis statistic 8.78 Data summary Number of treatments (columns) 5 Number of values (total) 58 Number of families 1 Number of comparisons per family 4 Alpha 0.05 Dunn's multiple Mean rank Adjusted comparisons test diff. Significant? Summary P Value PBS vs. MANF −8.48 No ns 0.915 0.15 mg/mL PBS vs. MANF −11 No ns 0.4712 0.5 mg/mL PBS vs. MANF −14 No ns 0.1892 1.5 mg/mL PBS vs. Aphagan −20.5 Yes * 0.0177 Mean Mean Mean Test details rank 1 rank 2 rank diff. n1 n2 PBS vs. MANF 18.7 27.2 −8.48 11 12 0.15 mg/mL PBS vs. MANF 18.7 29.7 −11 11 12 0.5 mg/mL PBS vs. MANF 18.7 32.7 −14 11 12 1.5 mg/mL PBS vs. Aphagan 18.7 39.2 −20.5 11 11

    TABLE-US-00013 TABLE 12 Animal body weight Body weights (g) Rat Day Sacrifice Treatment id Baseline Mean SD 0 Mean SD day Mean SD MANF 13 228 228 4 316 322 15 343 343 20 0.15 14 224 324 349 mg/mL 15 226 321 335 16 224 304 316 17 236 323 336 18 230 335 358 19 226 340 371 20 236 343 370 21 222 294 309 22 232 317 344 23 228 335 362 24 228 312 326 MANF 37 230 226 7 300 323 15 316 345 18 0.5 38 234 333 357 mg/mL 39 224 302 323 40 226 301 312 41 232 343 364 42 210 317 356 43 224 315 347 44 234 330 355 45 224 339 352 46 222 323 340 47 234 338 357 48 218 330 360 MANF 25 228 229 10 321 328 24 345 347 30 1.5 26 232 329 341 mg/mL 27 218 280 285 28 224 331 352 29 238 344 375 30 220 327 348 31 218 326 346 32 240 369 390 33 244 359 386 34 216 297 307 35 242 333 347 36 228 325 336 PBS 1 222 226 6 321 305 88 344 350 26 2 230 335 344 3 238 360 378 4 222 293 311 5 216 319 345 6 220 295 296 7 220 329 350 8 228 333 360 9 230 362 393 10 228 342 362 11 232 340 363 12 226 33 358 Alphagan 49 226 228 5 321 328 14 334 345 28 2 mg/mL 50 228 341 370 51 232 322 350 52 228 343 362 53 228 326 342 54 232 328 334 55 232 330 NA 56 230 318 339 57 232 350 387 58 218 320 328 59 232 340 363 60 220 301 282

    [0564] Electroretinogramns (ERG)

    [0565] The functional status of the retina was evaluated by electroretinography one week after the ischemic insult.

    [0566] The b-wave is induced by potassium efflux shunted from activated bipolar cells by Miller cells and is an electrophysiological indicator of retinal signal transmission. The a-wave, which is induced by light-activated hyperpolarization of photoreceptors, is usually less affected by changes in blood flow.

    [0567] Individual data, summarized in Table 13, are reported in Tables 14-18.

    [0568] A marked but not significant protection from the reduction in b-wave amplitude was observed after intravitreal administration of MANF at 0.15 mg/mL and 1.5 mg/mL, in comparison with the PBS-treated group. The b-wave amplitudes recovered by 49% and 47% from the mean baseline value for the groups treated with MANF at 0.15 mg/mL and 1.5 ng/mL, respectively, while PBS-treated group displayed a 37% recovery.

    [0569] A significant improvement of the b-wave recovery was shown after intravitreal administration of MANF at 0.5 mg/mL (p=0.0193). The b-wave amplitude recovered by 52% of the baseline mean value.

    [0570] Prophylactically administered Alphagan® (1 mg/kg brimonidine) led to a significant protection of the b-wave amplitude in comparison with the vehicle group (p=0.015). The b-wave amplitude recovered by 59% of the baseline mean value.

    TABLE-US-00014 TABLE 13 Right eye ERG measurements B-wave in right eye Treatment Time-point amplitude (μV) amplitude (%) MANF Baseline 1071.8 — 0.15 mg/mL Day 7 523.0 49.0 MANF Baseline 1050.3 — 0.5 mg/mL Day 7 539.9 52.1 MANF Baseline 1071.7 — 1.5 mg/mL Day 7 492.8 46.8 PBS Baseline 1052.8 — Day 7 387.7 37.4 Alphagan ® Baseline 1077.4 — 2 mg/mL Day 7 607.4 58.6

    TABLE-US-00015 TABLE 14 ERG measurements in both eyes with MANF 0.15 mg/mL; a = aberrant Amplitude (μV) Amplitude (% baseline) Baseline Day 7 Day 7 Rat id eye A-wave B-wave A-wave B-wave A-wave B-wave 13 treated −380 929 −154 448 41 48 right control left −423 785 −330 922 78 117 14 treated −410 846 −263 598 64 71 right control left −434 818 −383 986 88 121 15 treated −508 898 −264 566 52 63 right control left −498 886 −493 1170 99 132 16 treated −434 989 −283 557 65 56 right control left −398 887 −404 914 102 103 17 treated −457 998 −201 463 44 46 right control left −454 972 −412 939 91 97 18 treated −494 961 −283   0.sup.a 57 — right control left −462 877 −243 .sup. 380.sup.a 53 — 19 treated −503 1120 −152 425 30 38 right control left −467 1010 −383 812 82 80 20 treated −497 1120 −235 494 47 44 right control left −502 1070 −343 850 68 79 21 treated −480 1090 −325 295 68 27 right control left −526 996 −459 562 87 56 22 treated −627 1410 −407 860 65 61 right control left −613 1220 −475 1100  77 90 23 treated −476 1320 −255 557 54 42 right control left −445 1250 −405 1070  91 86 24 treated −496 1180 −308 490 62 42 right control left −550 1280 −405 897 74 70 Mean treated −480.2 1071.8 −260.8   523.0 54.1 49.0 SD right 61.2 170.2 71.5   140.0 11.7 12.7 SEM 17.7 49.1 20.6   42.2 3.4 3.8 Mean control left −481.0 1004.3 −394.6   929.3 82.5 93.8 SD 60.3 169.3 68.1   163.2 13.6 22.9 SEM 17.4 48.9 19.7   49.2 3.9 6.9

    TABLE-US-00016 TABLE 15 ERG measurements in both eyes with MANF 0.5 mg/mL; a = aberrant Amplitude (μV) Amplitude (% baseline) Baseline Day 7 Day 7 Rat id eye A-wave B-wave A-wave B-wave A-wave B-wave 37 treated −452 899 −247 561 55 62 right control left −416 843 −442 933 106 111 38 treated −399 869 −260 462 65 53 right control left −428 943 −405 1020 95 108 39 treated −467 957 −262 577 56 60 right control left −506 1000 −414 951 82 95 40 treated −472 986 −306 700 65 71 right control left −460 979 −409 1090 89 111 41 treated −487 965 −237 557 49 58 right control left −439 855 −388 934 88 109 42 treated −453 997 −293 563 65 56 right control left −482 1060 −480 1130 100 107 43 treated −565 1050 −225 494 40 47 right control left −468 859 −353 865 75 101 44 treated −545 1140 −319 545 59 48 right control left −489 1040 −434 925 89 89 45 treated −537 1160 −264 417 49 36 right control left −456 965 −383 844 84 87 46 treated −445 1180 −392 782 88 66 right control left −403 1100 −404 1010 100 92 47 treated −596 1230 −329 662 55 54 right control left −519 1060 −460 936 89 88 48 treated −475 1170 −93 159 20 14 right control left −443 1090 −329 717 74 66 Mean treated −491.1 1050.3 −268.9 539.9 55.4 52.1 SD right 57.4 121.4 72.4 156.7 16.4 15.3 SEM 16.6 35.1 20.9 45.2 4.7 4.4 Mean control left −459.1 982.8 −408.4 946.3 89.2 97.0 SD 35.6 92.4 42.7 110.6 9.7 13.5 SEM 10.3 26.7 12.3 31.9 2.8 3.9

    TABLE-US-00017 TABLE 16 ERG measurements in both eyes with MANF 1.5 mg/mL; ; a = aberrant Amplitude (μV) Amplitude (% baseline) Baseline Day 7 Day 7 Rat id eye A-wave B-wave A-wave B-wave A-wave B-wave 25 treated −320 841 −160 482 50 57 right control left −283 744 −262 921 93 124 26 treated −398 838 −225 270 57 32 right control left −439 885 −411 970 94 110 27 treated −359 831 −269 563 75 68 right control left −396 944 −405 1130 102 120 28 treated −447 1010 −242 442 54 44 right control left −490 1030 −376 808 77 78 29 treated −419 960 −254 556 61 58 right control left −387 917 −380 985 98 107 30 treated −494 1030 −156 426 32 41 right control left −467 973 −399 1040 85 107 31 treated −487 1110 −296 590 61 53 right control left −464 1040 −391 939 84 90 32 treated −459 1120 −299 417 65 37 right control left −399 915 −414 810 104 89 33 treated −481 1060 −255 456 53 43 right control left −417 895 −393 942 94 105 34 treated −740 1550 −262 579 35 37 right control left −677 1440 −459 1080 68 75 35 treated −539 1230 −273 588 51 48 right control left −537 1060 −433 805 81 76 36 treated −541 1280 −258 544 48 43 right control left −416 1050 −409 1010 98 96 Mean treated −473.7 1071.7 −245.8 492.8 53.4 46.8 SD right 107.4 210.0 45.8 96.0 11.9 10.4 SEM 31.0 60.6 13.2 27.7 3.4 3.0 Mean control left −447.7 991.1 −394.3 953.3 89.8 98.1 SD 95.8 167.6 47.4 106.3 11.0 16.6 SEM 27.6 48.4 13.7 30.7 3.2 4.8

    TABLE-US-00018 TABLE 17 ERG measurements in both eyes with PBS; † = anesthesia death. Amplitude (μV) Amplitude (% baseline) Baseline Day 7 Day 7 Rat id eye A-wave B-wave A-wave B-wave A-wave B-wave 1 treated −354 786 −117 260 33 33 right control left −378 844 −438 1010 116 120 2 treated −372 831 −219 312 59 38 right control left −396 893 −317 804 80 90 3 treated −475 808 −176 297 37 37 right control left −499 876 −348 652 70 74 4 treated −395 968 −233 562 59 58 right control left −432 984 −398 1070 92 109 5 treated −590 1040 −271 514 46 49 right control left −512 907 −481 950 94 105 6 treated −556 1050 −210 324 38 31 right control left −574 1080 −357 704 62 65 7 treated −503 1100 † † † † right control left −434 947 † † † † 8 treated −456 1060 −277 502 61 47 right control left −444 1030 −496 1100 112 107 9 treated −442 1070 −153 302 35 28 right control left −466 1070 −332 793 71 74 10 treated −535 1280 −196 492 37 38 right control left −534 1080 −387 924 72 86 11 treated −481 1220 −74 222 15 18 right control left −447 987 −419 1160 94 118 12 treated −618 1420 −322 478 52 34 right control left −550 1240 −361 910 66 73 Mean treated −481.4 1052.8 −204.4 387.7 42.8 37.4 SD right 83.8 191.8 72.6 121.5 14.0 11.0 SEM 24.2 55.4 21.9 36.6 4.2 3.3 Mean control left −472.2 994.8 −394.0 916.1 84.4 92.7 SD 61.6 112.4 59.1 164.2 18.4 19.5 SEM 17.8 32.4 17.8 49.5 5.5 5.9

    TABLE-US-00019 TABLE 18 ERG measurements in both eyes wth Alphagan; † = anasthesia death. Amplitude (μV) Amplitude (% baseline) Baseline Day 7 Day 7 Rat id eye A-wave B-wave A-wave B-wave A-wave B-wave 49 treated −399 905 −307 616 77 68 right control left −328 843 −346 938 105 111 50 treated −491 896 −330 370 67 41 right control left −530 979 −493 910 93 93 51 treated −461 808 −390 894 85 111 right control left −424 885 −415 1010 98 114 52 treated −416 1040 −309 700 74 67 right control left −404 973 −365 928 90 95 53 treated −450 1020 −177 516 39 51 right control left −429 1010 −328 1010 76 100 54 treated −447 1030 −262 462 59 45 right control left −484 961 −405 884 84 92 55 treated −510 1160 † † † † right control left −424 949 † † † † 56 treated −555 1050 † † † † right control left −552 1130 † † † † 57 treated −532 1150 −309 669 58 58 right control left −567 1210 −504 1080 89 89 58 treated −527 1300 −310 565 59 43 right control left −520 1120 −386 845 74 75 59 treated −558 1200 −392 812 70 68 right control left −577 1222 −445 1040 77 85 60 treated −538 1370 −307 470 57 34 right control left −484 1200 −366 875 76 73 Mean treated −490.3 1077.4 −309.3 607.4 64.5 58.6 SD right 54.5 166.6 61.0 164.3 12.9 21.9 SEM 15.7 48.1 19.3 52.0 4.1 6.9 Mean control left −476.9 1040.2 −405.3 952.0 86.3 92.8 SD 76.2 130.9 59.8 78.5 10.6 13.4 SEM 22.0 37.8 18.9 24.8 3.4 4.2

    [0571] Retinal Ganglion Cell Survival

    [0572] To assess the effect of the treatment on RGC viability, RGC density was evaluated 7 days after ischemia. Individual data, summarized in Table 19, are reported in table 20 and 21.

    [0573] The RGC density in the retina of non-ischemic eyes (two left eyes per group) was 2121±45-RGC/mm.sup.2 (n=12).

    [0574] One week after ischemia, mean RGC density decreased to 264±261 RGC/mm.sup.2 (−88′% compared to non-ischemic eyes) in the PBS-treated group.

    [0575] Intravitreal administration of MANF at 0.15 mg/mL, 0.5 mg/mL and 1.5 mg/mL, showed a trend in improvement of the mean RGC survival 7 days after injury with 403±189 cells/mm.sup.2, 465±301 cells/mm.sup.2 and 488±14 cells/mm.sup.2, respectively.

    [0576] Intraperitoneal administration of Alphagan® (1 mg/kg brimonidine) significantly prevented from the decrease of surviving RGCs, with 578±185 RGCs/mm.sup.2 (p=0.0177), when compared with the PBS-treated group.

    TABLE-US-00020 TABLE 19 Surviving retinal ganglion cell density in both eyes Alive cells (BrN3A Alive cells (BrN3A positive) (cells/mm.sup.2) positive) (cells/mm.sup.2) in in right eye left eye (n = 2/group) Treatment (n = 12/group) Mean SD MANF Mean 402.8 2 120.5 454.5 0.15 mg/mL SD 189.2 MANF Mean 464.9 0.5 mg/mL SD 301.3 MANF Mean 487.7 1.5 mg/mL SD 213.8 PBS Mean 264.3 SD 261.2 Alphagan ® Mean 578.0 2 mg/mL SD 185.4

    TABLE-US-00021 TABLE 20 Right injured eye survival RGCs Alive cells (BrN3A positive) in right eye cells/photo individual rat Value Value Value Value Value Value Value Value mean Treatment id 1 2 3 4 5 6 7 8 cells/mm.sup.2 MANF 13 11 24 39 26 5 12 31 78 47 0.15 14 389 162 6 9 240 17 42 143 210 mg/mL 15 503 377 284 377 228 234 133 115 469 16 446 489 484 342 321 322 728 332 722 17 391 444 484 560 220 336 263 356 636 18 305 305 227 311 272 233 345 261 471 19 235 143 261 312 324 500 233 180 456 20 221 221 250 356 247 7 321 171 374 21 228 18 194 39 205 79 5 7 161 22 404 409 348 7 235 430 123 116 432 23 247 293 260 198 211 260 268 223 408 24 266 326 125 78 318 365 295 379 448 Mean 402.8 SD 189.2 MANF 37 227 220 332 387 372 359 335 224 512 0.5 38 248 264 309 244 335 197 248 279 443 mg/mL 39 570 400 456 240 244 292 392 348 613 40 165 138 278 144 183 304 295 241 364 41 290 325 278 190 199 208 142 188 379 42 356 284 353 267 349 478 279 270 549 43 255 200 256 297 124 121 241 117 336 44 105 0 55 233 1 1 62 10 97 45 0 151 103 357 121 6 219 238 249 46 782 517 765 722 786 753 719 761 1209 47 6 0 2 7 100 84 111 194 105 48 585 554 425 254 395 443 426 391 724 Mean 464.9 SD 301.3 MANF 25 370 375 308 325 250 370 324 299 546 1.5 26 287 119 210 135 228 323 275 239 378 mg/mL 27 421 308 346 196 321 299 418 328 549 28 451 468 497 438 181 170 618 645 723 29 398 359 397 405 320 152 381 160 536 30 511 468 509 486 440 618 912 730 974 31 113 148 188 126 107 90 23 151 197 32 188 373 152 469 372 366 331 356 543 33 302 300 348 340 354 290 304 102 488 34 183 191 104 83 122 130 200 236 260 35 28 27 37 393 228 386 420 124 342 36 160 175 253 128 162 197 121 320 316 Mean 487.7 SD 213.8 PBS 1 299 203 532 409 302 157 161 247 481 2 52 5 37 14 62 54 65 27 66 3 4 6 8 133 66 89 12 40 75 4 38 99 44 64 7 61 11 10 70 5 50 24 75 55 113 215 184 243 200 6 36 2 4 216 0 6 2 10 58 7 ND ND ND ND ND ND ND ND — 8 423 108 324 389 229 186 51 420 444 9 25 31 21 5 ND ND ND ND 34 10 419 398 331 364 337 331 455 508 655 11 180 130 24 30 21 38 51 16 102 12 433 353 591 283 375 376 380 682 724 Mean 264.3 SD 261.2 Alphagan 49 461 465 537 483 460 467 256 196 693 2 mg/mL 50 455 417 422 406 426 429 307 242 647 51 291 308 342 343 287 284 278 164 479 52 479 438 504 471 365 456 265 375 699 53 640 653 738 423 657 536 465 344 928 54 160 216 308 322 331 371 266 183 449 55 ND ND ND ND ND ND ND ND — 56 428 508 338 371 380 564 552 538 766 57 186 201 133 318 308 337 119 145 364 58 411 72 291 205 205 47 259 245 361 59 362 293 48 140 322 231 269 223 393 60 511 437 428 265 304 349 293 191 579 Mean 578.0 SD 185.4 ND = not determined

    TABLE-US-00022 TABLE 21 Non-Injured eye RGCs density Alive cells (BrN3A positive) in left eye individual cells/photo mean Treatment rat id Value 1 cells/mm.sup.2 MANF 13 1 282 2 137 0.15 mg/mL 14   824 1 373 MANF 37 1 326 2 210 0.5 mg/mL 38 1 579 2 632 MANF 25 1 409 2 348 1.5 mg/mL 26 1 208 2 013 PBS 1   890 1 483 2 1 211 2 018 Alphagan ® 49 1 718 2 127 2 mg/mL 50 1 718 2 863 mean   2 120.5 SD    454.5

    CONCLUSION

    [0577] in these experimental conditions, after a one-week reperfusion period in a rat model of retinal ischemia by clamping, it can be stated that a single intravitreal administration of MANF at 0.15 mg/mL, 0.5 mg/mL and 1.5 mg/mL displayed a marked efficacy in rescuing retinal function (b-wave) and protecting RGC.

    [0578] The reference Alphagan® (1 mg/kg brimonidine) showed a significant efficacy in improving retinal function and protecting RGC.

    Example 3: 15-Day Ocular Tolerance Study in Rabbits

    [0579] The aim of this study was to evaluate the ocular tolerance of MANF (3 mg/mL) after a single intravitreal administration (100 μL) in pigmented rabbits over a 15 day period. Ten female pigmented rabbits were divided into two groups of five animals each, corresponding to both treatments. MANF and the vehicle (PBS, pH 7.4) were dosed by intravitreal injection in the right eye once, on Day 1.

    [0580] The eyes of the animals were examined by Split-lamp and assessed by using the McDonald-Shadduck's scale at Baseline and at Days 1, 3, 8 and 15. At the end of the in-life period on Day 15 both eyeballs of all animals were collected and processed for histology and microscopic examination.

    [0581] There were no treatment- or administration-related effects on body weight, clinical observations or ophthalmic examinations.

    [0582] No pathological findings related to treatment were found in any of the eyes observed during histopathology evaluation.

    CONCLUSION

    [0583] Under the experimental conditions, a single intravitreal administration of MANF in pigmented rabbits was macroscopically and microscopically well tolerated.

    Example 4: Synergistic Effects of MANF Family Proteins and Other Active Agents

    [0584] In this example, synergy between MANF family proteins and other active agents will be assessed by measuring retinal function after transient vascular clamping of the optic nerve, essentially as described in Example 2. The functional status of the retina will be monitored by electroretinogram (ERG). The b-wave, which is induced by potassium eflux shunted “on” from bipolar cells by Muller cells in response to illumination, is the ERG-component most susceptible to ischemia. Thus, suppression of the b-wave of the ERG has been taken as an electrophysiological measure of retinal blood flow in humans and in experimental animal models. Retinal protection in this model will also be assessed directly by counting RGCs stained with BrN3a.

    [0585] The MANF family protein (e.g., MANF, CDNF, or fragments thereof) will be administered by intravitreal injection. One or more other active agents (e.g., a prostaglandin analog; a beta-adrenergic receptor antagonist; an alpha adrenergic agonist, e.g., brimonidine; a miotic agent; a carbonic anhydrase inhibitor, etc.) will also be administered. The other active agents may be formulated with the MANF family protein or may be administered separately, by the same or a different route of administration.

    [0586] The results will show a greater than additive effect. The greater than additive effect may be demonstrated by retinal ganglion cell survival, recovery of B-wave amplitude, or both.

    Example 5: Prophylactic Use of MANF Family Proteins

    [0587] A MANF family protein (e.g., MANF, CDNF, or a fragment thereof, will be administered periodically (e.g., every: 1-8 weeks, 3-6 weeks, daily) to subjects to prevent retinal ganglion cell loss in the event of an ischemia of the retina, or to reduce the incidence of ischemic events in the retina. The subjects may be animals from an animal model prone to formation of emboli or thrombi.

    REFERENCES, EACH OF WHICH IS INCORPORATED BY REFERENCE IN ITS ENTIRETY

    [0588] Airavaara M, Shen H, Kuo C C, et al. Mesencephalic astrocyte-derived neurotrophic factor (MANF) reduces ischemic brain injury and promotes behavioral recovery in rats. J Comp Neurol. 2009; 515(1):116-124. Doi: 10.1002/cne.22039. [0589] Airavaara M, Chiocco M, Howard D. et al. Widespread cortnical expression of MANF by rAAV serotype 7: localization and protection against ischemic brain injury. Exp. Neurol 2010; 225(1): 104-113. doi: 10.1016/j.expneurol.2010.05.020. [0590] Apostolou A, Shen Y, Liang Y, et al. Armet, a UPR-upregulated protein, inhibits cell proliferation and ER stress-induced cell death. Exp Cell Res. 2008; 314(13):2454-67. [0591] Barnett N L, Osborne N N. Prolonged bilateral carotid artery occlusion induces electrophysiological and immunohistochemical changes to the rat retina without causing histological damage. Exp Eye Res. 1995; 61(1): 83-90. [0592] Biousse V. Thrombolysis for acute central retinal artery occlusion: is it time? Am J Ophthalmol. 2008; 146(5):631-634. [0593] Bradvica M, Benasic T, Vinkovik M. Retinal vascular occlusions. Advances in Ophthalmology. Dr. Shirnon Rumelt (Ed.) 2012. ISBN: 978-953-51-0248-9. InTech. [0594] Budak V and Akdogan M. Retinal ganglion cell death. Glaucoma—Basic and Clinical Concepts. Dr. Shimon Rumelt (Ed.) 2011, ISBN: 978-953-307-591-4. InTech. [0595] Chen S T, Hsu C Y, Hogan E L, Maricq H, Balentine J D. A model of focal ischemic stroke in the rat: reproducible extensive cortical infarction. Stroke 1986; 17(4):738-743. [0596] Cugati S, Varma D D, Chen C S, and Lew A W. Treatment options for central retinal artery occlusion. Current Treatmnent Options in Neurology 2013; 15:63-77. [0597] Glembotski C C, Thuerauf D J, Huang C, et al. Mesencephalic astrocyte-derived neurotrophic factor protects the heart from ischemic damage and is selectively secreted upon sarco/endoplasmic reticulum calcium depletion. J Biol Chem. 2012; 287(31): 25893-904. [0598] Gorbatyuk M and Gorbatyuk O. Review: Retinal degeneration: focus on the unfolded protein response. Molecular Vision. 2013; 19:1985-1998. [0599] Hayreh S S, Zinunerman M B, Kinmura A, Sanon A. Central retinal artery occlusion. Retinal survival time. Exp. Eye. Res 2004; 78:723-736. [0600] Hayreh S S, Podhajsky P A, Zimmerman B. Retinal artery occlusion: Associated systemic and ophthalmic abnormalities. Ophthalmology 2009; 116(10): 1928-1936. [0601] Hayreh S S. Ocular vascular occlusive disorders: Natural history of visual outcome. Progress in Retinal and Eye Research 2014; 41:1-25. [0602] Helhnan M, Arumnae U, Yu Ly, et al. Mesencephalic astrocyte-derived neurotrophic factor (MANF) has a unique mechanism to rescue apoptotic neurons. Journal of Biological Chemistry. 2011; 286(4):2675-2680. [0603] Hoseki J, Sasakawa H, Yamagu chi Y, et al. Solution structure and dynamics of mouse ARMET. FEBS Lett. 2010; 584(8): 1536-42. [0604] Hu Y, Park K K, Yan Li, et al. Differential effects of unfolded protein response pathways on axon injury-induced death of retinal ganglion cells. Neuron 2012:73:445-452. [0605] Kaur C, Foulds W S, Ling E-A. Hypoxia-ischemia and retinal ganglion cell damage. Clinical Ophthalmology 2008; 2(4):879-889. [0606] Kroeger H, Messah C, Abern K, et al. Induction of endoplasmic reticulum stress genes, BiP and Chop, in genetic and environmental models of retinal degeneration. IOVS. 2012; 53(12):7590-7599. [0607] Leavitt J A, Larson T A, Hodge D O, Gullerud R E. The incidence of central retinal artery occlusion in Olmsted County, Minnesota. Am J Ophthalmnol. 2011; 152(5):820-3.e2. [0608] Lee A-H, Iwakoshi N N, Glimcher L H. XBP-1 regulates a subset of endoplasmic reticulum resident chaperone genes in the unfolded protein response. Mol Cell Biol. 2003; 7448-7459. [0609] Lindholm P, Saarma M. Novel CDNF/MANF family of neurotropic factors. Dev Neurobiol. 2010; 70(5):360-71. [0610] Mizobuchi N, Hoseki J, Kubota H, et al. ARMET is a soluble E R protein induced by the unfolded protein response via ERSE-II element. Cell Struct Funct. 2007; 32(1):41-50. [0611] Nadal-Nicotis F M, Jimnnez-López M, Sobrado-Caivo P, et al. Bm3a as a marker of retinal ganglion cells: qualitative and quantitative time course studies in naive and optic nerve-injured retinas. Invest Ophthalmol Vis Sci. 2009; 50(8):3860-8. [0612] Oh-Hashi K, Tanaka K, Koga H, et al. Intracellular trafficking and secretion of mouse mesencephalic astrocyte-derived neurotrophic factor. Mol Cell Biochem. 2012; 363(1-2): 35-41. [0613] Parkash V, Lindholm P, Perminen J, et al. The structure of the conserved neurotrophic factors MANF and CDNF explains why they are bifunctional. Protein Eng Des Sel. 2009; 22(4):233-41. [0614] Petrova P, Raibekas A, Pevsner J, et al. MANF: a new mesencephalic, astrocyte-derived neurotrophic factor with selectivity for dopamrinergic neurons. J Mol Neurosci. 2003; 20(2):173-88. [0615] Shen Y, Sun A, Wang Y, et al. Upregulation of finesencephalic astrocyte-derived neurotrophic factor in glial cells associated with ischemia-induced glial activation. J Neuroinflanmmrnation 2012; 9(1):254 (1-13). [0616] Silla T, Haal I, Geimanen J, et al. Episomal maintenance of plasmids with hybrid origins in mouse cells. Journal of Virology. 2005; 79(24): 15277-15288. [0617] Tadimalla A, Belmont P J, Thuerauf D J, et al. Mesencephalic astrocyte-derived neurotrophic factor is an ischemia-inducible secreted endoplasmic reticulum stress response protein in the heart. Cire Res. 2008; 103(11):1249-58. [0618] Varma D D, Cugati S, Lee A W and Chen C S. A review of central retinal artery occlusion: Clinical presentation and management. Eye 2013; 27(6):688-697. [0619] Varma D D, Lee A W, Chen C S. Central retinal artery occlusion: General overview, diagnosis, and treatment. Retinal Physician 2013; 10:24-29. [0620] Yang L, Wu L, Guo X and Tso M. Activation of endoplasmic reticulum stress in degenerating photoreceptors of the rdl mouse. IOVS. 2007; 48(11):5191-5198. [0621] Yu Y Q, Liu L C, Wang F C, et al. Induction profile of MANF/ARMET by cerebral ischemia and its implication for neuron protection. Cereb Blood Flow Metab. 2010; 30(1):79-91.

    [0622] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.