TREATMENT AND PREVENTION OF MALARIA
20220233667 · 2022-07-28
Inventors
- Simon DRAPER (Oxford (Oxfordshire), GB)
- Matthew HIGGINS (Oxford (Oxfordshire), GB)
- Daniel G.W. ALANINE (Oxford (Oxfordshire), GB)
Cpc classification
A61K39/00
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61K39/39575
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
A61K39/015
HUMAN NECESSITIES
C12N15/115
CHEMISTRY; METALLURGY
International classification
A61K39/015
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
Abstract
There are provided antibodies and combination thereof, and other binding proteins against malarial antigens, as well as said antigens and vectors encoding the antibodies and antigens. The invention also provides the use of such compounds and combinations thereof in the prevention or treatment of malaria. In particular, synergistic combinations of non-neutralising antibodies directed towards an epitope on Reticulocyte-binding protein Homologue 5 (PfRH5) and neutralising antibodies directed towards Plasmodium merozoite antigens are provided.
Claims
1. A non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1).
2. The non-neutralising antibody, or binding fragment thereof, of claim 1, which comprises: (a) a heavy chain with a CDR1 sequence of SEQ ID NO: 11; a CDR2 sequence of SEQ ID NO: 12 and a CDR3 sequence of SEQ ID NO: 13, and a light chain with a CDR1 sequence of SEQ ID NO: 20; a CDR2 sequence of SEQ ID NO: 21 and a CDR3 sequence of SEQ ID NO: 22; (b) a heavy chain with a CDR1 sequence of SEQ ID NO: 14; a CDR2 sequence of SEQ ID NO: 14 and a CDR3 sequence of SEQ ID NO: 16, and a light chain with a CDR1 sequence of SEQ ID NO: 23; a CDR2 sequence of SEQ ID NO: 24 and a CDR3 sequence of SEQ ID NO: 25; or (c) a heavy chain with a CDR1 sequence of SEQ ID NO: 17; a CDR2 sequence of SEQ ID NO: 18 and a CDR3 sequence of SEQ ID NO: 19, and a light chain with a CDR1 sequence of SEQ ID NO: 26; a CDR2 sequence of SEQ ID NO: 21 and a CDR3 sequence of SEQ ID NO: 27.
3. The non-neutralising antibody, or binding fragment thereof of claim 1, which comprises: (a) a heavy chain variable region sequence of SEQ ID NO: 47 and a light chain variable region sequence of SEQ ID NO: 48; (b) a heavy chain variable region sequence of SEQ ID NO: 49 and a light chain variable region sequence of SEQ ID NO: 50; or (c) a heavy chain variable region sequence of SEQ ID NO: 51 and a light chain variable region sequence of SEQ ID NO: 52.
4. The non-neutralising antibody, or binding fragment thereof of claim 1, which is: (a) a monoclonal or polyclonal antibody; or (b) an Fab, F(ab′)2, Fv, scFv, Fd or dAb.
5. A composition comprising: (a) one or more non-neutralising antibody, or binding fragment thereof as defined in claim 1; and (b) one or more neutralising antibody, or binding fragment thereof, that specifically binds a Plasmodium merozoite antigen.
6. The composition of claim 5, wherein the Plasmodium merozoite antigen is: (a) PfRH5; (b) a non-PfRH5 antigen within the PfRH5 invasion complex; and/or (c) a target closely linked to the PfRH5-basigin interaction.
7. The composition of claim 5, wherein the Plasmodium merozoite antigen is selected from the group consisting of PfRH5, PfRipr, PfCyRPA, PfP113, PfRhopH3, PfRAP2, PfAMA1, PfRON2, PfEBA175, PfRH1, PfRH2a, PfRH2b, PfRH4, PfRAP1, PfRAP3, PfMSRP5, PfRAMA, PfSERA9, PfEBA181 and PfAARP.
8. The composition of claim 5, wherein the Plasmodium merozoite antigen is PfRH5 and the one or more neutralising antibody, or binding fragment thereof, specifically binds an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL); and the one or more neutralising antibody, or binding fragment thereof, specifically binds an epitope corresponding to: (a) residues Lys196 to Ser197; Asn347 to Asn352; Arg357 to His365; and Lys443 to Arg448 of PfRH5 (SEQ ID NO: 1); (b) residues Gly201 to Lys219; and Lys327 to Tyr335 of PfRH5 (SEQ ID NO: 1); (c) residues Gly201 to Lys219 and Lys327 to Gln342 of PfRH5 (SEQ ID NO: 1); or (d) residues Lys196, Ser197, Tyr346 to Asn354 and Lys443 to Lys452PfRH5 (SEQ ID NO: 1).
9. The composition of claim 8, wherein the one or more neutralising antibody, or binding fragment thereof; comprises: (a) a heavy chain with a CDR1 sequence of SEQ ID NO: 54; a CDR2 sequence of SEQ ID NO: 55 and a CDR3 sequence of SEQ ID NO: 56, and a light chain with a CDR1 sequence of SEQ ID NO: 60; a CDR2 sequence of SEQ ID NO: 61 and a CDR3 sequence of SEQ ID NO: 62; (b) a heavy chain with a CDR1 sequence of SEQ ID NO: 57; a CDR2 sequence of SEQ ID NO: 58 and a CDR3 sequence of SEQ ID NO: 59, and a light chain with a CDR1 sequence of SEQ ID NO: 63; a CDR2 sequence of SEQ ID NO: 64 and a CDR3 sequence of SEQ ID NO: 65; wherein optionally the one or more neutralising antibody, or binding fragment thereof; comprises: (i) a heavy chain variable region sequence of SEQ ID NO: 81 and a light chain variable region sequence of SEQ ID NO: 82; (ii) a heavy chain variable region sequence of SEQ ID NO: 83 and a light chain variable region sequence of SEQ ID NO: 84.
10. The composition of claim 5, wherein each of the one or more non-neutralising antibodies and the one or more neutralising antibodies, or binding fragment thereof, is independently selected from: (a) a monoclonal or polyclonal antibody; or (b) an Fab, F(ab′)2, Fv, scFv, Fd or dAb.
11. A neutralising antibody, or binding fragment thereof, that specifically binds an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL); and the one or more neutralising antibody, or binding fragment thereof, specifically binds an epitope corresponding to: (a) residues Lys196 to Ser197; Asn347 to Asn352; Arg357 to His365; and Lys443 to Arg448 of PfRH5 (SEQ ID NO: 1); (b) residues Gly201 to Lys219; and Lys327 to Tyr335 of PfRH5 (SEQ ID NO: 1); (c) residues Gly201 to Lys219 and Lys327 to Gln342 of PfRH5 (SEQ ID NO: 1); or (d) residues Lys196, Ser197, Tyr346 to Asn354 and Lys443 to Lys452PfRH5 (SEQ ID NO: 1).
12. A bispecific dual variable domain molecule comprising a non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1) and a neutralising antibody, or binding fragment thereof, that specifically binds a Plasmodium merozoite antigen.
13. A composition comprising: (a) an oligonucleotide aptamer that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1); and (b) an oligonucleotide aptamer that specifically binds to a Plasmodium merozoite antigen.
14. A viral vector, RNA vaccine or DNA plasmid that expresses one or more non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1); or one or more neutralising antibody, or binding fragment thereof, that specifically binds an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL).
15. A viral vector, RNA vaccine or DNA plasmid that expresses: (a) one or more non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1); and (b) one or more neutralising antibody, or binding fragment thereof, that specifically binds a Plasmodium merozoite antigen; wherein the one or more non-neutralising and neutralising antibodies or binding-fragments thereof are expressed by: (i) the same viral vector, RNA vaccine or DNA plasmid; or (ii) by two separate viral vectors, RNA vaccines or DNA plasmids; or a viral vector, RNA vaccine or DNA plasmid that expresses a bispecific dual variable domain molecule as defined in claim 12.
16. A vaccine that: (a) expresses or displays an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1); or a Plasmodium merozoite antigen as defined in any one of claims 8(a) to (d); or (b) induces a non-neutralising antibody or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1, or a neutralising antibody, or binding fragment thereof, that specifically binds an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL); wherein optionally said vaccine is selected from a viral vector, RNA vaccine, DNA plasmid, virus-like particle or a protein-based vaccine.
17. A vaccine that: (a) expresses or displays (i) an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1) and (ii) a Plasmodium merozoite antigen; or (b) induces (i) a non-neutralising antibody or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1), and (ii) a neutralising antibody, or binding fragment thereof, that specifically binds a Plasmodium merozoite antigen; and optionally (c) (i) expresses or displays one or more additional antigen selected from PfRipr, PfCyRPA, PfP113, PfRhopH3, PfRAP2, PfAMA1, PfRON2, PfEBA175, PfRH1, PfRH2a, PfRH2b, PfRH4, PfRAP1, PfRAP3, PfMSRP5, PfRAMA, PfSERA9, PfEBA181 and PfAARP, or a fragment thereof, or (ii) induces an antibody that specifically binds to said one or more additional antigen; wherein optionally: (i) said vaccine is selected from a viral vector, RNA vaccine, DNA plasmid, virus-like particle or a protein-based vaccine; (ii) wherein the epitope of (a)(i), the Plasmodium merozoite antigen of (a)(ii) and optionally the one or more additional antigen of (c)(i) are expressed or displayed by; or the non-neutralising antibody or binding fragment thereof of (b)(i), the neutralising antibody of (b)(ii) and optionally the one or more additional antigen of (c)(ii) are induced by: (i) the same vaccine, preferably the same viral vector, RNA vaccine, DNA plasmid, virus-like particle or a protein-based vaccine, even more preferably as a fusion protein; or (ii) by separate vaccines, preferably separate viral vectors, RNA vaccines, DNA plasmids, virus-like particles or proteins.
18. The viral vector, RNA vaccine or DNA plasmid of claim 14, wherein: (a) the one or more non-neutralising antibody, or binding fragment thereof, and the one or more neutralising antibody, or binding fragment thereof, or the bispecific dual variable domain molecule, epitope or antigen each further comprise a signal peptide; wherein optionally the signal peptides direct secretion from human cells, and preferably said signal peptide is a mammalian signal peptide from tissue plasminogen activator; and/or (b) the viral vector, RNA vaccine, DNA plasmid or vaccine is capable of expression in a mammalian cell; and/or (c) the DNA plasmid is capable of expression in a heterologous protein expression system; and optionally the viral vector is a human or simian adenovirus, an adeno-associated virus (AAV), or a pox virus, preferably an AdHu5, ChAd63, ChAdOX1, ChAdOX2 or modified vaccinia Ankara (MVA) vector.
19. A vaccine composition comprising: (i) a composition comprising: (a) one or more non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1), and (b) one or more neutralising antibody, or binding fragment thereof that specifically binds a Plasmodium merozoite antigen; (ii) a non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1) and optionally a neutralising antibody, or binding fragment thereof, that specifically binds an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL); (iii) a bispecific dual variable domain molecule comprising a non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1) and a neutralising antibody, or binding fragment thereof, that specifically binds a Plasmodium merozoite antigen; or (iv) a vaccine, viral vector, RNA vaccine, DNA plasmid, virus-like particle or a protein-based vaccine that expresses one or more non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1), or one or more neutralising antibody, or binding fragment thereof, that specifically binds an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL).
20. The vaccine composition of claim 19, wherein the vaccine composition is designed for use in a method of treating and/or preventing malaria.
21. A method of manufacture of a medicament for the prevention and/or treatment of malaria comprising providing or having provided the vaccine composition of claim 19 and manufacturing the medicament therefrom.
22. The vaccine composition according to claim 20, wherein: (a) the non-neutralising antibody is provided in the form of (i) an antibody that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1); (ii) a viral vector, RNA vaccine or DNA plasmid that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1); or one or more neutralising antibody, or binding fragment thereof, that specifically binds an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL); or (iii) a vaccine that: (a) expresses or displays an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1); or a Plasmodium merozoite antigen as defined in any one of claims 8(a) to (d); or (b) induces a non-neutralising antibody or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1, or a neutralising antibody, or binding fragment thereof, that specifically binds an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL); wherein optionally said vaccine is selected from a viral vector, RNA vaccine, DNA plasmid, virus-like particle or a protein-based vaccine; and/or (b) the neutralising antibody is provided by (i) an antibody that specifically binds an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL); and the one or more neutralising antibody, or binding fragment thereof, specifically binds an epitope corresponding to: (ia) residues Lys196 to Ser197; Asn347 to Asn352; Arg357 to His365; and Lys443 to Arg448 of PfRH5 (SEQ ID NO: 1); (ib) residues Gly201 to Lys219; and Lys327 to Tyr335 of PfRH5 (SEQ ID NO: 1); (ic) residues Gly201 to Lys219 and Lys327 to Gln342 of PfRH5 (SEQ ID NO: 1); or (id) residues Lys196, Ser197, Tyr346 to Asn354 and Lys443 to Lys452PfRH5 (SEQ ID NO: 1); (ii) a viral vector, RNA vaccine or DNA plasmid which expresses said neutralising antibody, said viral vector, RNA vaccine or DNA plasmid; (iii) a malarial vaccine comprising a Plasmodium merozoite antigen, wherein the Plasmodium merozoite antigen is (iiia) PfRH5, (iiib) a non-PfRH5 antigen within the PfRH5 invasion complex, and/or (iiic) a target closely linked to the PfRH5-basigin interaction; or (iv) a malarial vaccine comprising a vector expressing said Plasmodium merozoite antigen, or which induces said neutralising antibody.
23. A method of immunising a subject, the method comprising administering to the subject: (i) a composition comprising (a) one or more non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1) and (b) one or more neutralising antibody, or binding fragment thereof, that specifically binds a Plasmodium merozoite antigen; (ii) a non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1) and optionally a neutralising antibody, or binding fragment thereof, that specifically binds an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL); (iii) a bispecific dual variable domain molecule comprising (a) a non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1) and (b) a neutralising antibody, or binding fragment thereof, that specifically binds a Plasmodium merozoite antigen; (iv) a viral vector, RNA vaccine, or DNA plasmid that expresses one or more non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1) or one or more neutralising antibody, or binding fragment thereof, that specifically binds an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL); or (v) a vaccine composition of claim 19; for use in immunising the subject, which has a growth inhibitory activity (GIA) of at least 50% against a blood-stage Plasmodium parasite; wherein optionally: (a) the growth inhibitory activity (GIA) of at least 50% is against a plurality of genetic strains of the blood-stage Plasmodium parasite; and/or (b) the Plasmodium parasite is Plasmodium falciparum.
24. A host cell containing one or more recombinant expression vector which encodes for: (a) (i) one or more non-neutralising antibody, or binding fragment thereof, that specifically binds an epitope within residues corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1); and (ii) one or more neutralising antibody, or binding fragment thereof, that specifically binds a Plasmodium merozoite antigen; or (b) (i) an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1); and (ii) one or more Plasmodium merozoite antigen; wherein the Plasmodium merozoite antigen is: (a) PfRH5; (b) a non-PfRH5 antigen within the PfRH5 invasion complex; and/or (c) a target closely linked to the PfRH5-basigin interaction.
25. The vaccine of claim 16, wherein: (a) the one or more non-neutralising antibody, or binding fragment thereof, and the one or more neutralising antibody, or binding fragment thereof, or the bispecific dual variable domain molecule, epitope or antigen each further comprise a signal peptide; wherein optionally the signal peptides direct secretion from human cells, and preferably said signal peptide is a mammalian signal peptide from tissue plasminogen activator; and/or (b) the viral vector, RNA vaccine, DNA plasmid or vaccine is capable of expression in a mammalian cell; and/or (c) the DNA plasmid is capable of expression in a heterologous protein expression system; and optionally the viral vector is a human or simian adenovirus, an adeno-associated virus (AAV), or a pox virus, preferably an AdHu5, ChAd63, ChAdOX1, ChAdOX2 or modified vaccinia Ankara (MVA) vector.
Description
DESCRIPTION OF FIGURES
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
DETAILED DESCRIPTION OF THE INVENTION
[0041] Unless otherwise defined herein, scientific and technical terms used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. The meaning and scope of the terms should be clear; however, in the event of any latent ambiguity, definitions provided herein take precedent over any dictionary or extrinsic definition. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. In this application, the use of “or” means “and/or” unless stated otherwise. Furthermore, the use of the term “including”, as well as other forms, such as “includes” and “included”, is not limiting.
PfRH5 Antibodies
[0042] The following definitions are generally applicable to all antibodies of the invention, including the non-neutralising antibodies (non-nAb) and neutralising antibodies (nAb) discussed below.
[0043] The term “antibody”, as used herein, broadly refers to any immunoglobulin (Ig) molecule comprised of four polypeptide chains, two heavy (H) chains and two light (L) chains, or any functional fragment, mutant, variant, or derivation thereof, which retains the essential epitope binding features of an Ig molecule. Such mutant, variant, or derivative antibody entities are known in the art, non-limiting embodiments of which are discussed below.
[0044] In a full-length antibody, each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. Antibodies may be polyclonal (pAb) or monoclonal (mAb). Typically the antibodies of the invention are mAbs.
[0045] Antibodies of the invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass and may be from any species (e.g., mouse, human, chicken, rat, rabbit, sheep, shark and camelid).
[0046] The term “antigen-binding fragment” of an antibody (or simply “binding fragment”), as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by one or more fragments of a full-length antibody. Single chain antibodies are also encompassed. Such antigen-binding fragments may also be bispecific, dual specific, or multi-specific, specifically binding to two or more different antigens. Thus, examples of binding fragments encompassed within the term “antigen-binding fragment” of an antibody include Fab, Fv, scFv, dAb, Fd, Fab′ or F(ab′)2, tandem scFv and diabodies.
[0047] Also encompassed are antibody constructs, defined as a polypeptide comprising one or more the antigen binding fragment of the invention linked to a linker polypeptide or an immunoglobulin constant domain. Linker polypeptides comprise two or more amino acid residues joined by peptide bonds and are used to link one or more antigen binding portions.
[0048] An antibody of the invention may be a “human antibody”; defined as an antibody having variable and constant regions derived from human germline immunoglobulin sequences, but which may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3. Recombinant human antibodies are also encompassed by the present invention.
[0049] An antibody of the invention may be a “chimeric antibody”; defined as an antibody which comprises heavy and light chain variable region sequences from one species and constant region sequences from another species. The present invention encompasses chimeric antibodies having, for example, murine heavy and light chain variable regions linked to human constant regions.
[0050] An antibody of the invention may be a “CDR-grafted antibody”; defined as an antibody which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and/or VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3 or all three CDRs) has been replaced with human CDR sequences.
[0051] An antibody of the invention may be a “humanized antibody”; defined as an antibody which comprise heavy and light chain variable region sequences from a non-human species (e.g., a mouse) but in which at least a portion of the VH and/or VL sequence has been altered to be more “human-like”, i.e., more similar to human germline variable sequences. One type of humanized antibody is a CDR-grafted antibody, in which human CDR sequences are introduced into non-human VH and VL sequences to replace the corresponding nonhuman CDR sequences.
[0052] The terms “Kabat numbering”, “Kabat definitions and “Kabat labeling” are used interchangeably herein. These terms, which are recognized in the art, refer to a system of numbering amino acid residues which are more variable (i.e. hypervariable) than other amino acid residues in the heavy and light chain variable regions of an antibody, or an antigen binding portion thereof (Kabat et al. (1971) Ann. NY Acad, Sci. 190:382-391 and Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
[0053] Antibodies of the invention are not limited to a particular method of generation or production. Thus, the invention provides antibodies which have been manufactured from a hybridoma that secretes the antibody, as well as antibodies produced from a recombinantly produced cell that has been transformed or transfected with a nucleic acid or nucleic acids encoding the antibody. Such hybridomas, recombinantly produced cells, and nucleic acids form part of the invention.
[0054] An antibody, or antigen-binding fragment thereof, of the invention is selective or specific for PfRH5, or a particular epitope of PfRH5 as described herein. By specific, it will be understood that the antibody binds to the molecule of interest, in this case the PfRH5 fragment of the invention, with no significant cross-reactivity to any other molecule, particularly any other protein. For example, a binding compound or antibody of the invention that is specific for a particular PfRH5 epitope of the invention will show no significant cross-reactivity with other PfRH5 epitopes. As another example, a binding compound or antibody of the invention that is specific for PfRH5 will show no significant cross-reactivity with other malarial invasion proteins. Cross-reactivity may be assessed by any suitable method. Cross-reactivity of a binding compound (e.g. antibody) for a PfRH5 epitope with another PfRH5 epitope or non-PfRH5 protein may be considered significant if the binding compound (e.g. antibody) binds to the other molecule at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 100% as strongly as it binds to the PfRH5 epitope. A binding compound (e.g. antibody) that is specific for the PfRH5 fragment may bind to another molecule such as PfAMA1 at less than 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25% or 20% the strength that it binds to the PfRH5 epitope. Preferably, the binding compound (e.g. antibody) binds to the other molecule at less than 20%, less than 15%, less than 10% or less than 5%, less than 2% or less than 1% the strength that it binds to the PfRH5 epitope. Binding affinity may be quantified in any suitable way, e.g. by K.sub.D.
[0055] The binding affinity of a PfRH5 antibody (neutralising or non-neutralising) of the invention for PfRH5 may be quantified in terms of dissociation constant (K.sub.D). K.sub.D may be determined using any appropriate technique, but SPR is generally preferred in the context of the present invention. A PfRH5 antibody of the invention may bind to PfRH5 with a K.sub.D of less than 1 μM, less than 100 nM, less than 50 nM, less than 25 nM, less than 10 nM, less than 1 nM, less than 900 pM, less than 800 pM, less than 700 pM, less than 600 pM, less than 500 pM, less than 400 pM, less than 300 pM, less than 200 pM, less than 100 pM, less than 50 pM, less than 25 pM, less than 10 pM, less than 5 pM, or less. Typically a PfRH5 antibody of the invention binds to PfRH5 with a K.sub.D of less 50 nM, less than 10 nM or less than 1 nM.
[0056] Further antibodies which bind to the epitopes/antigens of the invention may be generated by producing variants of the antibodies of the invention. Such variants may have CDRs sharing a high level of identity with the CDRs of an antibody of the invention, for example may have CDRs each of which independently may differ by one or two amino acids from the antibody of the invention from which the variant antibody is derived, and wherein the variant retains the binding and functional properties of the antibody of the invention. Additionally, such antibodies may have one or more variations (e.g. a conservative amino acid substitution) in the framework regions. By way of a non-limiting example, variants of antibody mAb11 or mAb16 may have CDRs that differ by 1 or 2 amino acid residues in any one or more of the CDRs of antibody mAb11 or mAb16. Conservative amino acid substitutions are particularly contemplated (see the disclosure herein in relation to PfRH5 antigen variants, which applies equally to variants of antibodies of the invention). The variations in the amino acid sequences of the antibodies of the invention should maintain at least 75%, at least 80%, at least 85%, at least 90%, at least 95% and up to 99% sequence identity. Variants having at least 90% sequence identity with the antibodies of the invention, particularly the specific antibodies exemplified herein are specifically contemplated. Variation may or may not be limited to the framework regions and not present in the CDRs.
[0057] A particular exemplified antibody of the invention may be interchangeably referred to as mAbX (where X is an identification number) or as R5.X (where X is the same identification number).
[0058] DNA oligonucleotide aptamers, RNA oligonucleotide aptamers, and other engineered biopolymers against a PfRH5 antigen of the invention may also be able to replicate the activity of the antibodies and combinations thereof described here. As a vaccine, PfRH5 antigens of the invention are likely amenable to expression by recombinant viral vectored vaccines, as well as nucleic acid-based vaccines such as RNA or DNA; and recombinant protein or virus-like particles (VLPs) expressed in mammalian expression systems or insect cell systems. It is also possible to express the PfRH5 antigens of the invention as proteins or VLPs in bacteria or yeast, as well as plant/algae systems.
Non-Neutralising Antibodies
[0059] The present inventors have identified a novel epitope on PfRH5 which elicits antibodies which themselves possess no neutralising activity. However, the inventors have surprisingly shown that non-neutralising antibodies which bind to this epitope on PfRH5 potentiate the activity of all neutralising antibodies directed to PfRH5. In addition, these non-neutralising antibodies (non-nAb) also synergise with antibodies against other malarial invasion proteins.
[0060] The present inventors have previously solved the crystal structure of PfRH5 (see WO2016/016651, which is incorporated by reference in its entirety, particularly Example 1 and
[0061] A non-neutralising antibody or binding fragment thereof of the invention may comprise three heavy chain CDRs having sequences: (a) a CDR1 sequence of SEQ ID NO: 11; a CDR2 sequence of SEQ ID NO: 12 and a CDR3 sequence of SEQ ID NO: 13; (b) a CDR1 sequence of SEQ ID NO: 14; a CDR2 sequence of SEQ ID NO: 15 and a CDR3 sequence of SEQ ID NO: 16; or (c) a CDR1 sequence of SEQ ID NO: 17; a CDR2 sequence of SEQ ID NO: 18 and a CDR3 sequence of SEQ ID NO: 19.
[0062] A non-neutralising antibody or binding fragment thereof of the invention may comprise three light chain CDRs having sequences: (a) a CDR1 sequence of SEQ ID NO: 20; a CDR2 sequence of SEQ ID NO: 21 and a CDR3 sequence of SEQ ID NO: 22; a CDR1 sequence of SEQ ID NO: 23; a CDR2 sequence of SEQ ID NO: 24 and a CDR3 sequence of SEQ ID NO: 25; or (c) a CDR1 sequence of SEQ ID NO: 26; a CDR2 sequence of SEQ ID NO: 21 and a CDR3 sequence of SEQ ID NO: 27.
[0063] In a preferred embodiment, a non-neutralising antibody or binding fragment thereof of the invention may comprise: (a) a heavy chain with a CDR1 sequence of SEQ ID NO: 11; a CDR2 sequence of SEQ ID NO: 12 and a CDR3 sequence of SEQ ID NO: 13, and a light chain with a CDR1 sequence of SEQ ID NO: 20; a CDR2 sequence of SEQ ID NO: 21 and a CDR3 sequence of SEQ ID NO: 22; (b) a heavy chain with a CDR1 sequence of SEQ ID NO: 14; a CDR2 sequence of SEQ ID NO: 15 and a CDR3 sequence of SEQ ID NO: 16, and a light chain with a CDR1 sequence of SEQ ID NO: 23; a CDR2 sequence of SEQ ID NO: 24 and a CDR3 sequence of SEQ ID NO: 25; or (c) a heavy chain with a CDR1 sequence of SEQ ID NO: 17; a CDR2 sequence of SEQ ID NO: 18 and a CDR3 sequence of SEQ ID NO: 19, and a light chain with a CDR1 sequence of SEQ ID NO: 26; a CDR2 sequence of SEQ ID NO: 21 and a CDR3 sequence of SEQ ID NO: 27. In a more preferred embodiment, a non-neutralising antibody or binding fragment thereof of the present invention comprises the CDRs of mAb11 or the CDRs of mAb14.
[0064] A non-neutralising antibody or binding fragment thereof of the invention may comprise four heavy chain framework regions (FRs) having sequences: (a) a FR1 sequence of SEQ ID NO: 28; a FR2 sequence of SEQ ID NO: 29; a FR3 sequence of SEQ ID NO: 30; and a FR4 sequence of SEQ ID NO: 31; (b) a FR1 sequence of SEQ ID NO: 32; a FR2 sequence of SEQ ID NO: 33; a FR3 sequence of SEQ ID NO: 34; and a FR4 sequence of SEQ ID NO: 31; or (c) a FR1 sequence of SEQ ID NO: 35; a FR2 sequence of SEQ ID NO: 36; a FR3 sequence of SEQ ID NO: 37; and a FR4 sequence of SEQ ID NO: 38.
[0065] A non-neutralising antibody or binding fragment thereof of the invention may comprise four light chain framework regions (FRs) having sequences: (a) a FR1 sequence of SEQ ID NO: 39; a FR2 sequence of SEQ ID NO: 40; a FR3 sequence of SEQ ID NO: 41; and a FR4 sequence of SEQ ID NO: 42; (b) a FR1 sequence of SEQ ID NO: 43; a FR2 sequence of SEQ ID NO: 44; a FR3 sequence of SEQ ID NO: 41; and a FR4 sequence of SEQ ID NO: 42; or (c) a FR1 sequence of SEQ ID NO: 45; a FR2 sequence of SEQ ID NO: 40; a FR3 sequence of SEQ ID NO: 46; and a FR4 sequence of SEQ ID NO: 42.
[0066] Preferably a non-neutralising antibody of the invention has the heavy and light chain CDRs of the mAb11 and the corresponding heavy and light chain FRs of the mAb11 antibody; the heavy and light chain CDRs of the mAb14 and the corresponding heavy and light chain FRs of the mAb14 antibody; or the heavy and light chain CDRs of the mAb10 and the corresponding heavy and light chain FRs of the mAb10 antibody; as identified above. In a preferred embodiment, a non-neutralising antibody of the invention, or binding fragment thereof, comprises: (a) a heavy chain variable region sequence of SEQ ID NO: 47 and/or a light chain variable region sequence of SEQ ID NO: 48; (b) a heavy chain variable region sequence of SEQ ID NO: 49 and/or a light chain variable region sequence of SEQ ID NO: 50; or (c) a heavy chain variable region sequence of SEQ ID NO: 51 and/or a light chain variable region sequence of SEQ ID NO: 52. Particularly preferred are antibodies with both the VH and VL sequences listed above. In a more preferred embodiment, a non-neutralising antibody or binding fragment thereof of the present invention comprises the VH and VL sequences of mAb11 or mAb14.
[0067] The term “non-neutralising antibody” is defined herein to mean an antibody which by itself (in the absence of any other PfRH5 antibody or other antibody against a malarial invasion protein) lacks the ability, or has negligible ability, to inhibit the growth of Plasmodium falciparum parasites, and more preferably across a plurality of strains of blood-stage P. falciparum parasites.
[0068] This activity or lack thereof may be quantified using any appropriate technique and measured in any appropriate units. For example, the activity of PfRH5 antibodies of the invention may be given in terms of their growth inhibitory activity (GIA), half maximal effective concentration (EC.sub.50), antibody titre stimulated (in terms of antibody units, AU) and/or EC.sub.50 in terms of AU. The latter of these gives an indication of the quality of the response elicited by the PfRH5 antibody of the invention. Any appropriate technique may be used to determine the GIA, EC.sub.50, AU or EC.sub.50/AU. Typically the activity of polyclonal antibodies is quantified using EC.sub.50/AU, and the activity of monoclonal antibodies is quantified using EC.sub.50. Exemplary techniques are described in the examples and conventional techniques are known in the art.
[0069] Typically non-neutralising antibodies of the invention have a GIA of less than 25%, less than 20%, less than 15%, less than 10%, less than 5%, less than 4%, less than 3%, less than 2%, less than 1%, or less against Plasmodium parasites, down to zero GIA against Plasmodium parasites.
[0070] The growth inhibitory activity (GIA) may be measured at any appropriate concentration of the antibodies, for example the GIA may be measured at 0.1 mg/ml, 0.2 mg/ml, 0.3 mg/ml, 0.4 mg/ml, 0.5 mg/ml, 0.6 mg/ml, 0.7 mg/ml, 0.8 mg/ml, 0.9 mg/ml, 1 mg/ml, 2 mg/ml or 3 mg/ml of purified IgG antibody.
[0071] As described herein, without being bound by theory, the evidence suggests that non-neutralising antibodies of the invention slow the invasion of host red blood cells by the merozoite form of the Plasmodium parasite (referred to interchangeably herein as increasing invasion time), giving longer for neutralising antibodies to bind to their epitope on the merozoite. A non-neutralising antibody of the invention may increase invasion time by at least 1.5 times, at least 2 times, at least 2.5 times, at least 3 times or more, preferably at least 2 times and more preferably at least 3 times, compared with the time taken for red blood cell invasion by merozoites (typically a merozoite from the same malarial strain) in the absence of said non-neutralising antibody. By way of non-limiting example, a non-neutralising antibody of the invention may increase invasion time by at least 10 seconds, at least 15 seconds, at least 20 seconds, at least 30 seconds or more compared with the time taken for red blood cell invasion by merozoites (typically a merozoite from the same malarial strain) in the absence of said non-neutralising antibody. Typically, a non-neutralising antibody of the invention increases the phase of invasion immediately preceding merozoite penetration of a red blood cell (see schematic in
Neutralising Antibodies
[0072] The present inventors have further identified three novel epitopes on PfRH5 which elicits antibodies which possess significant neutralising activity. The inventors have also shown the effects of these neutralising antibodies (nAb) are potentiated when used in combination with the non-neutralising antibodies of the invention.
[0073] All the novel neutralising antibodies identified by the present inventors bind to the PfRH5ΔNL fragment. As indicated above, this fragment lacks both the signal peptide (corresponding to residues 1 to 23 of SEQ ID NO: 1 or 2); the flexible/disordered N-terminal region (corresponding to residues 24 to 139 or 24 to 159 (preferably 24 to 139) of SEQ ID NO: 1 or 2) of PfRH5) and the flexible loop region corresponding to amino acid residues 248 to 296 of SEQ ID NO: 1 or 2). The PfRH5ΔNL fragment is exemplified by SEQ ID NOs: 7 to 10.
[0074] Notably, the PfRH5ΔNL fragment lacks resides K33 to K51 of the full-length PfRH5 protein, which have previously been reported as the minimal PfP113 binding region, and which was thought to be a potential site for antibody-mediated neutralisation
[0075] In particular, the inventors identified three epitope bins which contain potent neutralising antibodies. The binding sites of mAb16 and mAb4 as defined herein both have significant overlap with the basigin binding site of PfRH5 (as defined in WO2016/016651, particularly in Example 1 which is incorporated by reference in its entirety, particularly Example 1 and
[0076] Accordingly, the invention provides a novel epitope within RH5ΔN (as exemplified by SEQ ID NOs: 3 to 6) or RH5ΔNL as exemplified by SEQ ID NOs: 7 to 10). In particular, the invention provides novel epitopes corresponding to (a) (i) residues Lys196 to Ser197; Asn347 to Asn352; Arg357 to His365; and Lys443 to Arg448 of PfRH5 (SEQ ID NO: 1); or (ii) residues Gly201 to Lys219; and Lys327 to Tyr335 of PfRH5 (SEQ ID NO: 1); (b) residues Gly201 to Lys219 and Lys327 to Gln342 of PfRH5 (SEQ ID NO: 1); or (c) residues Lys196, Ser197; Tyr346 to Asn354 and Lys443 to Lys452 of PfRH5 (SEQ ID NO: 1). In a preferred embodiment, the invention provides novel epitopes corresponding to (i) residues Lys196 to Ser197; Asn347 to Asn352; Arg357 to His365; and Lys443 to Arg448 of PfRH5 (SEQ ID NO: 1); or (ii) residues Gly201 to Lys219; and Lys327 to Tyr335 of PfRH5 (SEQ ID NO: 1). Alternatively, said epitopes may be defined in terms of the corresponding amino acid residues of another PfRH5 sequence (SEQ ID NO: 2) or fragment (such as any one of SEQ ID NOs: 3 to 10). With regards to PfRH5 fragments, the numbering of the amino acids of the epitope may differ from the residues indicated above (as these are defined by reference to the full-length sequence of PfRH5, typically SEQ ID NO: 1 or 2). However, the corresponding residues within a PfRH5 fragment may be readily identified using only routine skill and methods (e.g. sequence alignment). Indeed, by way of example, these epitopes are identified in the fragments of SEQ ID NOs: 3 to 10 in the sequence information section herein. More particularly, the epitope comprises or consists of amino acid residues corresponding to (a) Lys196; Ser197; Asn347; Asn352; Arg357; Asp361; Glu362; His365; Lys443; Trp447 and Arg448; or (b) Gly201; Lys202; Ile204; Asp207 to Phe209; Lys211; Lys212; Glu215; Lys219; Lys327, Asp331 and Tyr335 of PfRH5 or fragments thereof as defined above. Typically the epitopes described above give rise to (induce) neutralising antibodies of the invention, such as those exemplified herein.
[0077] A neutralising antibody or binding fragment thereof of the invention may comprise three heavy chain CDRs having sequences: (a) a CDR1 sequence of SEQ ID NO: 54; a CDR2 sequence of SEQ ID NO: 55 and a CDR3 sequence of SEQ ID NO: 56; or (b) a CDR1 sequence of SEQ ID NO: 57; a CDR2 sequence of SEQ ID NO: 58 and a CDR3 sequence of SEQ ID NO: 59.
[0078] A neutralising antibody or binding fragment thereof of the invention may comprise three light chain CDRs having sequences: (a) a CDR1 sequence of SEQ ID NO: 60; a CDR2 sequence of SEQ ID NO: 61 and a CDR3 sequence of SEQ ID NO: 62; or (b) a CDR1 sequence of SEQ ID NO: 63; a CDR2 sequence of SEQ ID NO: 64 and a CDR3 sequence of SEQ ID NO: 65.
[0079] In a preferred embodiment, a neutralising antibody or binding fragment thereof of the invention may comprise: (a) a heavy chain with a CDR1 sequence of SEQ ID NO: 54; a CDR2 sequence of SEQ ID NO: 55 and a CDR3 sequence of SEQ ID NO: 56, and a light chain with a CDR1 sequence of SEQ ID NO: 60; a CDR2 sequence of SEQ ID NO: 61 and a CDR3 sequence of SEQ ID NO: 62; or (b) a heavy chain with a CDR1 sequence of SEQ ID NO: 57; a CDR2 sequence of SEQ ID NO: 58 and a CDR3 sequence of SEQ ID NO: 59, and a light chain with a CDR1 sequence of SEQ ID NO: 63; a CDR2 sequence of SEQ ID NO: 64 and a CDR3 sequence of SEQ ID NO: 65.
[0080] A neutralising antibody or binding fragment thereof of the invention may comprise four heavy chain framework regions (FRs) having sequences: (a) a FR1 sequence of SEQ ID NO: 66; a FR2 sequence of SEQ ID NO: 67; a FR3 sequence of SEQ ID NO: 68; and a FR4 sequence of SEQ ID NO: 69; or (b) a FR1 sequence of SEQ ID NO: 70; a FR2 sequence of SEQ ID NO: 67; a FR3 sequence of SEQ ID NO: 71; and a FR4 sequence of SEQ ID NO: 72.
[0081] A neutralising antibody or binding fragment thereof of the invention may comprise four light chain framework regions (FRs) having sequences: (a) a FR1 sequence of SEQ ID NO: 73; a FR2 sequence of SEQ ID NO: 74; a FR3 sequence of SEQ ID NO: 75; and a FR4 sequence of SEQ ID NO: 76; or (b) a FR1 sequence of SEQ ID NO: 77; a FR2 sequence of SEQ ID NO: 78; a FR3 sequence of SEQ ID NO: 79; and a FR4 sequence of SEQ ID NO: 80.
[0082] Typically a neutralising antibody of the invention has both the heavy and light chain CDRs of the same antibody of the invention (e.g. the heavy and light chain CDRs of mAb16) and the heavy and light chain FRs from this same antibody (e.g. the heavy and light chain FRs of mAb16). Preferably a neutralising antibody of the invention comprises the heavy and light chain CDRs of the mAb16 antibody and the corresponding heavy and light chain FRs of the mAb16 antibody; or the heavy and light chain CDRs of the mAb4 and the corresponding heavy and light chain FRs of the mAb4 antibody; as identified above.
[0083] In a preferred embodiment, a neutralising antibody of the invention, or binding fragment thereof, comprises: (a) a heavy chain variable region sequence of SEQ ID NO: 81 and/or a light chain variable region sequence of SEQ ID NO: 82; or (b) a heavy chain variable region sequence of SEQ ID NO: 83 and/or a light chain variable region sequence of SEQ ID NO: 84.Particularly preferred are neutralising antibodies with both the VH and VL sequences listed above. In a more preferred embodiment, a neutralising antibody or binding fragment thereof of the present invention comprises the VH and VL sequences of mAb16 or mAb4.
[0084] The term “neutralising antibody” is defined herein to mean an antibody which by itself (in the absence of any other PfRH5 antibody or other antibody against a malarial invasion protein) has the ability to inhibit the growth of Plasmodium falciparum parasites, and more preferably across a plurality of strains of blood-stage P. falciparum parasites.
[0085] This activity may be quantified using any appropriate technique and measured in any appropriate units as discussed above in relation to non-neutralising antibodies. This disclosure applies equally to neutralising antibodies of the invention (and to other binding compounds as described herein).
[0086] Typically, the neutralising PfRH5 antibodies of the invention have a GIA of at least at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more against Plasmodium parasites. In a preferred embodiment, the PfRH5 fragments of the invention induce antibodies that have a growth inhibitory activity (GIA) of at least 70%, at least 75%, at least 80%, at least 90% or more against Plasmodium parasites.
[0087] The growth inhibitory activity (GIA) may be measured at any appropriate concentration of the antibodies (again, as described in relation to non-neutralising antibodies and which equally applies to neutralising antibodies). For example, the neutralising antibodies of the invention may give a GIA of at least 40%, at least 50% and preferably at least 70% or more against the blood-stage Plasmodium parasite, at an IgG concentration of 1 mg/ml IgG, of the purified neutralising antibody.
[0088] Preferably the neutralising PfRH5 antibodies of the invention exert similarly high levels of GIA against both the vaccine-homologous clone, 3D7, and against a vaccine-heterologous strain, FVO. A neutralising PfRH5 antibody of the invention has an EC.sub.50 which is at least comparable to total IgG against full length PfRH5, and preferably significantly lower than the EC.sub.50 against full-length PfRH5 of the EC.sub.50 of known anti-PfRH5 antibodies. A neutralising antibody of the invention preferably has an EC.sub.50 significantly lower than that of the anti-PfAMA1 BG98 standard (Faber, B. W., et al., Infection and immunity, 2013; incorporated herein by reference). Typically a neutralising PfRH5 antibody of the invention has an EC.sub.50 value of less than 500 μg/ml, less than 400 μg/ml, less than 300 μg/ml, less than 200 μg/ml, less than 150 μg/ml, less than 100 μg/ml, less than 90 μg/ml, less than 80 μg/ml, less than 70 μg/ml, less than 60 μg/ml, less than 50 μg/ml, less than 40 μg/ml, less than 30 μg/ml, less than 25 μg/ml, less than 20 μg/ml, less than 15 μg/ml, less than 10 μg/ml, less than 9 μg/ml, less than 8 μg/ml, less than 7 μg/ml, less than 6 μg/ml, less than 5 μg/ml, less than 4 μg/ml, less than 3 μg/ml, less than 2 μg/ml, less than 1 μg/ml, or less.
[0089] Typically the neutralising antibodies of the invention result in a GIA of at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more against the blood-stage Plasmodium parasite. In a preferred embodiment, the neutralising antibodies of the invention will raise antibodies that result in a GIA of at least 70% against the blood-stage Plasmodium parasite measured at any appropriate concentration as described herein.
[0090] Typically the PfRH5 neutralising antibodies of the invention are effective against genetically diverse strains of the Plasmodium parasite. This is likely to be of importance in achieving protection against the variety of strains circulating in the natural environment. Accordingly, in a preferred embodiment, the neutralising antibodies of the invention will result in a GIA of at least at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more against a plurality of genetic strains of the blood-stage Plasmodium parasite. In a preferred embodiment, the neutralising antibodies of the invention will result in a GIA of at least 70% or more against a plurality of genetic strains of the blood-stage Plasmodium parasite.
[0091] The PfRH5 fragment of the invention may have a comparable immunogenicity when compared with the full length PfRH5 antigen.
Antibody Combinations
[0092] As outlined above and as demonstrated in the Examples below, the present inventors have surprisingly shown that non-neutralising antibodies which bind to a particular epitope on PfRH5 potentiate the activity of all neutralising antibodies directed to PfRH5, and also synergise with antibodies against other malarial invasion proteins.
[0093] Accordingly, the present invention provides a composition comprising: (a) one or more non-neutralising antibody, or binding fragment thereof, that specifically binds a non-neutralising antibody epitope of the invention, particularly, an epitope corresponding to residues Ser153 to Ile163 and Asp305 to Lys319 of PfRH5 (SEQ ID NO: 1); and (b) one or more neutralising antibody, or binding fragment thereof, that specifically binds a Plasmodium merozoite antigen.
[0094] The one or more non-neutralising antibody may be any non-neutralising antibody as described herein. The disclosure of non-neutralising antibodies of the invention is generally applicable to all disclosure herein in relation to the compositions of the invention.
[0095] The one or more neutralising antibody may bind to any Plasmodium merozoite antigen, also referred to interchangably herein as a malarial invasion protein (or a fragment thereof), including malarial invasion proteins already known in the art. The one or more neutralising antibody typically binds to: (a) PfRH5; (b) a non-PfRH5 Plasmodium merozoite antigen that is within the PfRH5 invasion complex; or (c) a Plasmodium merozoite antigen that is closely linked to PfRH5. Closely linked Plasmodium merozoite antigens may act either prior to PfRH5 engagement (upstream of PfRH5) or after PfRH5 engagement (downstream of PfRH5).
[0096] In particular, the one or more neutralising antibody may bind to a Plasmodium merozoite antigen selected from: (a) PfRH5; (b) a non-PfRH5 antigen within the PfRH5 invasion complex; and/or (c) a target upstream or downstream of the PfRH5-basigin interaction.
[0097] As used herein, a non-PfRH5 antigen within the PfRH5 invasion complex is any malarial protein which associates with PfRH5 to form a complex essential for the invasion of red blood cells by the Plasmodium merozoites. Accordingly, non-PfRH5 antigens within the PfRH5 invasion complex include PfRipr, PfCyRPA, PfP113, PfRhopH3 and PfRAP2.
[0098] Non-limiting examples of Plasmodium merozoite antigens that are closely linked to PfRH5 include PfAMA1, PfRON2, PfEBA175, PfRH1, PfRH2a, PfRH2b, PfRH4, PfRAP1, PfRAP3, PfMSRP5, PfRAMA, PfSERA9, PfEBA181 and PfAARP, or a fragment thereof Antibodies to one or more of these antigens, or any combination thereof, may be used according to the invention.
[0099] In some preferred embodiments the one or more neutralising antibody is an anti-PfRH5 neutralising antibody as defined herein. The disclosure of neutralising PfRH5 antibodies of the invention is generally applicable to all disclosure herein in relation to the compositions of the invention.
[0100] Any combinations of neutralising antibodies of the invention (e.g. any two, three, four or more neutralising antibodies to one or more of the Plasmodium merozoite antigens described herein) may be used in combination with a non-neutralising antibody. By way of a non-limiting example, a non-neutralising antibody of the invention may be used in combination with a neutralising antibody (or binding fragment thereof) to PfRH5 together with a neutralising antibody (or binding fragment thereof) against a PfCyRPA antigen, a neutralising antibody (or binding fragment thereof) against a PfAMA1 antigen and/or a neutralising antibody (or binding fragment thereof) against a PfRipr antigen. Such a combination may be equally effective against both the vaccine-homologous 3D7 clone and the vaccine-heterologous FVO strain. One or more additional neutralising antibodies to other Plasmodium merozoite antigen(s) can be used in combination with the non-neutralising antibody (or binding fragment thereof), neutralising PfRH5 antibody and other merozoite antigen neutralising antibody combination. One exemplary preferred combination is a non-neutralising antibody of the invention together with a neutralising antibody (or binding fragment thereof) to PfRH5 and with a neutralising antibody (or binding fragment thereof) against a PfCyRPA antigen, a PfAMA1 antigen or a PfRipr antigen.
[0101] The combination of a non-neutralising antibody of the invention and a neutralising antibody of the invention may be in the form of two separate antibody molecules or binding fragments thereof. In which case, the antibodies may be used or administered (or in the case of a therapeutic indication) sequentially or simultaneously, with simultaneous use or administration being preferred. If the use/administration is sequential, preferably the non-neutralising antibody is used/administered first.
[0102] Alternatively, the non-neutralising antibody or binding fragment thereof and the neutralising antibody or binding fragment thereof may be in the form of a single molecule. Thus, the invention provides bispecific molecules comprising both a non-neutralising antibody or binding fragment thereof and a neutralising antibody or binding fragment thereof Such bispecific molecules include fusion proteins, trifunctional antibodies, F(ab′).sub.2, bispecific T-cell engager molecules, dual-variable-domain immunoglobulins (DVD-Ig™, in which the antigen-binding variable domains of two monoclonal antibodies are combined via linkers (typically naturally occurring linkers) to create a tetravalent, dual-targeting single agent). Examples of bispecific antibody structures are well known in the art, as are methods for their production, including the so-called “Knobs-into-Holes” (KiH) approach, the controlled Fab arm exchange method (cFAE) and using scFvs.
[0103] As well as use or administration of the non-neutralising antibodies and neutralising antibodies of the invention in protein (i.e. antibody) form as discussed above, the non-neutralising and neutralising antibodies of the invention may be used or administered in any other appropriate form.
[0104] In some embodiments, one or more non-neutralising antibody and/or one or more neutralising antibody is generated in vivo. In vivo generation of said antibodies may be via the administration of one or more vector (e.g. a viral vector, RNA vaccine or DNA plasmid) which encodes and expresses said one or more non-neutralising antibody and/or one or more neutralising antibody. Alternatively, in vivo generation of said antibodies may be by the administration of a vector or vaccine which (i) delivers an antigen which will induce the immune system to make said one or more non-neutralising antibody and/or one or more neutralising antibody, or (ii) encodes or expresses an antigen which will then induce the immune system to make said one or more non-neutralising antibody and/or one or more neutralising antibody; or (iii) natural exposure to malaria (particularly in the case of said one or more neutralising antibody).
[0105] Any combination of delivery of said one or more non-neutralising antibody and/or one or more neutralising antibody in protein form or in vivo generation of said one or more non-neutralising antibody and/or one or more neutralising antibody may be used.
[0106] For example, in some embodiments non-neutralising antibodies are used or administered in protein form (i.e. as antibodies), and the neutralising antibodies are generated in vivo.
[0107] The in vivo generation of the neutralising antibodies may be via the use or administration of a malarial vaccine encoding a Plasmodium merozoite antigen as described herein to a subject to be treated, by natural exposure to malaria, or by the use or administration of a vector or plasmid encoding the neutralising antibody (as exemplified herein).
[0108] In embodiments where the in vivo generation of the neutralising antibodies is via the use or administration of a malarial vaccine to a subject to be treated, the non-neutralising antibody or binding fragment thereof may be described as being used in combination with the antibodies generated in vivo in response to the malarial vaccine. The malarial vaccine may comprise any Plasmodium merozoite antigen as described herein. All the disclosure herein in relation to Plasmodium merozoite antigens to which neutralising antibodies of the invention specifically binds also applies to the Plasmodium antigens themselves as included in a malarial vaccine for use in combination with a non-neutralising antibody (or binding fragment thereof) of the invention. Thus, the malaria vaccine may contain one or more of: (a) PfRH5; (b) a non-PfRH5 Plasmodium merozoite antigen that is within the PfRH5 invasion complex; or (c) a Plasmodium merozoite antigen that is closely linked to PfRH5; or may contain a vector which encodes one or more of said antigens. Examples of such antigens are described herein. Typically the malarial vaccine comprises or encodes a PfRH5 antigen, preferably comprising or encoding an epitope for a neutralising antibody as described herein. Non-limiting examples of vaccine vectors are described herein.
[0109] The combination of a non-neutralising antibody of the invention and a malarial vaccine may be used or administered (or in the case of a therapeutic indication) sequentially or simultaneously. If the use/administration is sequential, preferably the malarial vaccine is used/administered first.
[0110] Alternatively, the neutralising antibodies may be generated in vivo naturally via exposure to malaria.
[0111] The non-neutralising antibodies may be used or administered as a vector encoding said non-neutralising antibody. In such embodiments, the neutralising antibodies may be generated in vivo as described above (e.g. induced by a vaccine, including protein, VLP or other vaccine, or expressed by an expression vector) or used or administered in protein (i.e. antibody) form. The antibodies (in whatever form) may be used or administered (or in the case of a therapeutic indication) sequentially or simultaneously. If the use/administration is sequential, preferably the non-neutralising antibody (in whatever form) is used/administered first.
[0112] Any combination of delivery method may be used for the non-neutralising antibodies and neutralising antibodies of the invention. In particular, the non-neutralising antibody may be delivered by a means selected from vaccine induction, in vivo vector generation or direct antibody protein delivery as described herein, or a combination thereof, and independently the neutralising antibody of may be also delivered by a means selected from vaccine induction, in vivo vector generation or direct antibody protein delivery as described herein, or a combination thereof. In some preferred embodiments: (i) the neutralising antibody is induced in vivo by a vaccine and the non-neutralising antibody is given directly as a protein antibody; (ii) both the neutralising and non-neutralising antibodies are given directly as protein antibodies; or (iii) both the neutralising and non-neutralising antibodies are induced by vaccines.
[0113] Regardless of how the non-neutralising antibody is delivered (e.g. as a protein antibody, expressed in vivo by a vector or plasmid of the invention or generated in vivo by the administration of a malarial vaccine (protein, virus-like particle or any other type of vaccine, examples of which are described herein)), or how the neutralising antibody is delivered (e.g. generated in vivo by administration of a malarial vaccine (protein, virus-like particle or any other type of vaccine, examples of which are described herein), by exposure to malaria, as a protein antibody or expressed in vivo by a vector or plasmid of the invention), a non-neutralising antibody of the invention can synergise the activity of the neutralising antibodies as described herein.
[0114] The non-neutralising antibodies of the invention are able to potentiate or synergise the activity of the neutralising antibodies. The terms potentiate and synergise (or variants thereof) are used interchangeably herein.
[0115] By potentiation, it is meant that the non-neutralising antibody increases the effect of the neutralising antibody beyond the effect obtained using the non-neutralising antibody alone. This can be quantified in any suitable way and measured using conventional means, as exemplified in the Examples herein.
[0116] Typically a non-neutralising antibody of the invention or binding fragment thereof reduces the amount or concentration of neutralising antibody required to obtain the desired inhibitory effect on the Plasmodium parasite. As a non-limiting example, a non-neutralising antibody or binding fragment thereof of the invention may decrease the EC.sub.50 value of a neutralising antibody or binding fragment thereof by at least two-fold, at least three-fold, at least four-fold, at least five-fold, at least six-fold, at least seven-fold, at least eight-fold, at least nine-fold, at least ten-fold or more compared with the EC.sub.50 value of the neutralising antibody or binding fragment thereof alone. In some preferred embodiments, the non-neutralising antibody or binding fragment thereof decreases the EC.sub.80 value of the neutralising antibody or binding fragment thereof by at least five-fold, more preferably at least seven-fold, even more preferably at least nine-fold or more compared with the EC.sub.80 value of the neutralising antibody or binding fragment thereof alone.
[0117] Typically the maximum synergistic effect of a non-neutralising antibody of the invention or binding fragment thereof is achieved using a concentration of greater than 1 μg/ml, greater than 10 μg/ml, greater than 50 μg/ml, greater than 100 μg/ml, greater than 150 μg/ml, greater than 200 μg/ml, greater than 250 μg/ml, greater than 300 μg/ml, or more of the non-neutralising antibody or binding fragment thereof. In some preferred embodiments, the maximum synergistic effect of a non-neutralising antibody of the invention or binding fragment thereof is achieved using a concentration of greater than 150 μg/ml, even more preferably greater than 200 μg/ml of the non-neutralising antibody or binding fragment thereof.
[0118] The ratio of a neutralising antibody or binding fragment thereof to non-neutralising antibody or binding fragment thereof (nAb:non-nAb) may be about 2:1, about 2.5:1, about 3:1, about 3.5:1, about 4:1 or about 4.5:1. Typically the nAb:non-nAb ratio is about 4:1. The lower the concentration of neutralising antibody or binding fragment thereof, the greater the effect of nAb-biased ratios. Thus, for concentrations of neutralising antibody (or binding fragment thereof) below 100 μg/ml, a nAb:non-nAb ratio of 4:1 is preferred. However, at neutralising antibody (or binding fragment thereof) concentrations above 100 μg/ml, the nAb:non-nAb has less effect, with nAb:non-nAb ratios in the range of 1:4 to 4:1 being roughly equivalent.
Other Binding Compounds
[0119] PfRH5 is a component of the mechanism by which the Plasmodium parasite invades RBCs. Compounds that specifically bind to PfRH5 inhibit this process and prevent the invasion of RBCs.
[0120] Accordingly, other binding compounds and combinations thereof may be used as alternatives to the non-neutralising antibody and neutralising antibody combinations described herein, provided that these combinations of other binding compounds include a non-neutralising binding compound to the epitope identified herein for the non-neutralising antibodies of the invention, and a neutralising binding compound to a Plasmodium merozoite antigen as defined herein, and that the non-neutralising binding compound synergises the activity of the neutralising binding compound as for the non-neutralising antibody/neutralising antibody combinations described herein.
[0121] Thus, the invention provides a composition comprising: (a) an oligonucleotide aptamer that specifically binds to the non-neutralising epitope of the invention, particularly, an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1); and (b) an oligonucleotide aptamer that specifically binds to a Plasmodium merozoite antigen as defined herein.
[0122] Any of the disclosure herein in relation to non-neutralising antibodies/neutralising antibodies and combinations thereof of the invention applies equally to other binding compounds and combinations thereof.
[0123] The non-neutralising and/or neutralising binding compounds of the invention may be oligonucleotide aptamers which bind to the respective epitopes/antigens as defined herein in relation to the corresponding non-neutralising and neutralising antibodies of the invention. The aptamer(s) may specifically bind to the respective epitopes/antigens as defined herein in relation to the corresponding non-neutralising and neutralising antibodies of the invention. Specificity is discussed herein in relation to the antibodies of the invention and applies equally to aptamers (or other binding compounds of the invention).
[0124] The activity of neutralising aptamers and the synergistic effect of non-neutralising aptamers may be assessed using a GIA assay. Such aptamers can be found by known methods (e.g. as set out in D. H. J. Bunka, P. G. Stockley, Nature Reviews Microbiology 4, 588 (2006)). An aptamer of the invention may be optimised to render it suitable for therapeutic use, e.g. it may be conjugated to a monoclonal antibody to modify its pharmacokinetics (e.g. half-life and biodistribution) and/or recruit Fc-dependent immune functions.
Vectors and Plasmids
[0125] The present invention provides vectors that express a non-neutralising antibody of the invention (or other non-neutralising binding compound as defined herein) and a neutralising antibody of the invention (or other neutralising binding compound as defined herein). Typically the vector is present in the form of a vaccine formulation.
[0126] The one or more non-neutralising and neutralising antibodies or binding-fragments thereof (or other binding compounds as defined herein) may be expressed by: (i) the same vector; or (ii) by two (or more in the case of multiple antibodies/binding proteins) separate vectors; or (iii) a vector that expresses a bispecific molecule (such as a bispecific dual variable domain molecule as defined herein). The vector(s) may be present in the form of a vaccine formulation.
[0127] The invention also provides a vector that expresses the non-neutralising antibody epitope, a vector that expresses one or more neutralising antibody epitope and a vector that expresses the non-neutralising antibody epitope and one or more neutralising antibody epitope of the invention. The vector(s) may be present in the form of a vaccine formulation.
[0128] The invention provides a vector that expresses: (a) a non-neutralising antibody epitope of the invention, particularly, an epitope corresponding to residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1); and (b) a Plasmodium merozoite antigen as defined herein; and optionally (c) one or more additional antigen selected from PfRipr, PfCyRPA, PfP113, PfRhopH3, PfRAP2, PfAMA1, PfRON2, PfEBA175, PfRH1, PfRH2a, PfRH2b, PfRH4, PfRAP1, PfRAP3, PfMSRP5, PfRAMA, PfSERA9, PfEBA181 and PfAARP, or a fragment thereof; wherein the epitope of (a), the Plasmodium merozoite antigen of (b) and optionally the one or more additional antigen of (c) are expressed by: (i) the same vector; or (ii) by separate vectors. The vector(s) may be present in the form of a vaccine formulation.
[0129] The vector(s) may be a viral vector. Such a viral vector may be an adenovirus (of a human serotype such as AdHu5, a simian serotype such as ChAd63, ChAdOX1 or ChAdOX2, or another form), an adeno-associated virus (AAV), or poxvirus vector (such as a modified vaccinia Ankara (MVA)). ChAdOX1 and ChAdOX2 are disclosed in WO2012/172277 (herein incorporated by reference in its entirety). ChAdOX2 is a BAC-derived and E4 modified AdC68-based viral vector. Preferably said viral vector is an AAV vector.
[0130] Viral vectors are usually non-replicating or replication impaired vectors, which means that the viral vector cannot replicate to any significant extent in normal cells (e.g. normal human cells), as measured by conventional means—e.g. via measuring DNA synthesis and/or viral titre. Non-replicating or replication impaired vectors may have become so naturally (i.e. they have been isolated as such from nature) or artificially (e.g. by breeding in vitro or by genetic manipulation). There will generally be at least one cell-type in which the replication-impaired viral vector can be grown—for example, modified vaccinia Ankara (MVA) can be grown in CEF cells. In one embodiment, the vector is selected from a human or simian adenovirus or a poxvirus vector.
[0131] Typically, the viral vector is incapable of causing a significant infection in an animal subject, typically in a mammalian subject such as a human or other primate.
[0132] The vector(s) may be a DNA vector, such as a DNA plasmid. In one embodiment the DNA vector(s) is capable of expression in a mammalian cell expression system, such as an immunised cell. The vector may be suitable for expression in a bacterial and/or insect host cell or expression system, such as any of those exemplified herein. A non-limiting example of a suitable expression vector is a pET15b vector, which may be optionally modified to encode an N-terminal tag, such as a hexa-histidine tag and/or a protease cleavage site, such as a TEV protease cleavage site.
[0133] The vector(s) may be a RNA vector, such as a self-amplifying RNA vaccine (Geall, A. J. et al., Proc Natl Acad Sci USA 2012; 109(36) pp. 14604-9; incorporated herein by reference).
[0134] The present invention may be a phage vector, such as an AAV/phage hybrid vector as described in Hajitou et al., Cell 2006; 125(2) pp. 385-398; herein incorporated by reference.
[0135] Vectors of the present invention also include virus-like particles (VLP), soluble proteins and/or fusion proteins comprising non-neutralising antibodies and neutralising antibodies (or other binding compounds), as described herein, or PfRH5 epitopes or Plasmodium merozoite antigens as described herein. Typically these comprise or express PfRH5 epitopes or Plasmodium merozoite antigens as described herein. Methods for generating VLPs are known in the art (see, for example, Brune et al. Sci. Rep. (2016), 19(6):19234, which is incorporated by reference in its entirety) and can readily be applied to the present invention. References herein to vectors of the invention may apply equally to VLP, soluble proteins and/or fusion proteins of the invention.
[0136] The antibodies/binding compounds or epitopes/antigens of the invention may be expressed by in a single vector. Wherein the vector of the invention expresses epitopes/antigens of the invention, the expressed epitopes/antigens are capable of inducing both non-neutralising and neutralising antibodies (or other binding proteins) as described herein. Alternatively, the modified PfRH5 antigen and the one or more additional antigen or fragment thereof may be delivered using a mixture of vectors expressing the individual non-neutralising and neutralising antibodies or epitopes/antigens which induce said antibodies (Forbes, E. K., et al., J Immunol, 2011. 187(7): p. 3738-50; and Sheehy, S. H., et al., Mol Ther, 2012. 20(12): p. 2355-68; both of which are incorporated herein by reference). Where the non-neutralising and neutralising antibodies or epitopes/antigens which induce said antibodies are co-expressed, this may be in the form of a fusion protein (Porter, D. W., et al., Vaccine, 2011. 29(43): p. 7514-22; incorporated herein by reference), or the non-neutralising and neutralising antibodies or epitopes/antigens which induce said antibodies expressed as separate transcripts under the control of separate promoters (Bruder, J. T., et al., Vaccine, 2010. 28(18): p. 3201-10; and Tine, J. A., et al., Infect Immun, 1996. 64(9): p. 3833-44; both of which are incorporated herein by reference), or the non-neutralising and neutralising antibodies or epitopes/antigens which induce said antibodies translated as a single polypeptide which undergoes cleavage to yield two separate antigens (Ibrahimi, A., et al., Hum Gene Ther, 2009. 20(8): p. 845-60; incorporated herein by reference).
[0137] The antibodies/binding compounds or epitopes/antigens of the invention may include a leader sequence, for example to assist in recombinant production and/or secretion. Any suitable leader sequence may be used, including conventional leader sequences known in the art. Suitable leader sequences include Bip leader sequences, which are commonly used in the art to aid secretion from insect cells and human tissue plasminogen activator leader sequence (tPA), which is routinely used in viral and DNA based vaccines and for protein vaccines to aid secretion from mammalian cell expression platforms. By way of a non-limiting example, the antibodies/binding compounds or epitopes/antigens of the invention may include the secretory signal from bovine tissue plasminogen activator, or may include another signal to direct the subcellular trafficking of the antibodies/binding compounds or epitopes/antigens. Alternatively, the antibodies/binding compounds or epitopes/antigens of the invention may be the mature form in which the N-terminal signal peptide has been removed.
[0138] The antibodies/binding compounds or epitopes/antigens of the invention may additionally comprise an N- or C-terminal tag, for example to assist in recombinant production and/or purification. Any N- or C-terminal tag may be used, including conventional tags known in the art. Suitable tags sequences include C-terminal hexa-histidine tags and the “C-tag” (the four amino acids EPEA at the C-terminus), which are commonly used in the art to aid purification from heterologous expression systems, e.g. insect cells, mammalian cells, bacteria, or yeast. Other examples of suitable tags include GST and MBP tags, or any other conventional tag which may be used to facilitate increased expression. In other embodiments, the antibodies/binding compounds or epitopes/antigens of the invention are purified from heterologous expression systems without the need to use a purification tag.
PfRH5 Antigens
[0139] The present invention provides PfRH5 antigens that give rise to non-neutralising antibodies as defined herein. The invention also provides PfRH5 antigens which give rise to neutralising antibodies as defined herein. The invention further relates to the use of other Plasmodium merozoite antigens which give rise to neutralising antibodies that can be used according to the present invention.
[0140] In particular, the invention provides PfRH5 antigens which comprise an epitope within residues corresponding to amino acid residues Ser153 to Ile163 and Aps305 to Lys319 of PfRH5 (SEQ ID NO: 1). As described herein, said antigens give rise to antibodies which are themselves non-neutralising, but which potentiate the activity of neutralising PfRH5 antibodies, and which also synergise with the activity of neutralising antibodies directed to other Plasmodium merozoite antigens as defined herein. The structure of such a PfRH5 antigen of the invention is not limited, provided that the epitope is held in the correct confirmation to give rise to non-neutralising antibodies according to the invention.
[0141] Full-length PfRH5 is defined by SEQ ID NO: 1 or 2. The mature form of PfRH5 in which the N-terminal signal peptide has been removed may comprise or consist of amino acid residues 26 to 526 of SEQ ID NO: 1 or 2. Said fragments may comprise or consist of at least 21, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, 110, 120, 130 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520 or more consecutive amino acid residues in length. Such fragments may have a common antigenic cross-reactivity with said unmodified (full-length) PfRH5 antigen. Unmodified PfRH5 antigens are described in detail in WO2012/114125 (herein incorporated by reference in its entirety).
[0142] The inventors have previously described rationally designed fragments of PfRH5 lacking some of the internal disorganised regions. These fragments, including fragments lack the flexible N-terminal domain and/or a flexible central linker. Said flexible N-terminal region of PfRH5 typically comprises amino acid residues corresponding to amino acid residues 1 to 139 or 1 to 159 of SEQ ID NO: 1 or 2. Amino acid residues corresponding to amino acid residues 1 to 23 of SEQ ID NO: 1 or 2 are typically a signal peptide that is cleaved from the mature PfRH5 protein. As used herein, the term flexible N-terminal region may include or exclude the signal peptide. Thus, the term flexible N-terminal region may include the signal peptide and so refer to the amino acids corresponding to amino acid residues 1 to 139 or 1 to 159 of SEQ ID NO: 1 or 2. Alternatively, the term flexible N-terminal region may exclude the signal peptide and so refer to the amino acids corresponding to amino acid residues 24 to 139 or 24 to 159 of SEQ ID NO: 1 or 2. Said flexible disordered central linker region of PfRH5 typically corresponds to amino acid residues 248 to 296 of SEQ ID NO: 1 or 2. The terms “flexible disordered central linker region”, “flexible central linker region” and “flexible central linker” are used interchangeable herein. The flexible central linker of PfRH5 as defined herein may comprise or consist of one of the recited sequences or variants thereof. Such rationally designed PfRH5 fragments may be discontinuous (i.e. contain consecutive runs of amino acid sequences that would be separated by additional amino acids in the full-length wild-type PfRH5). These rationally designed fragments are described in detail in WO 2016/016651 (herein incorporated by reference in its entirety).
[0143] Optimised PfRH5 fragments, derived from either unmodified PfRH5 or rationally designed PfRH5 fragments have also previously been developed, as described in WO 2018/055331 (herein incorporated by reference in its entirety). Such optimised fragments are typically more stable than the corresponding unmodified PfRH5 antigens, and also have improved expression profiles.
[0144] The PfRH5 antigens of the invention which give rise to non-neutralising antibodies of the invention may be derived from unmodified PfRH5 fragments, from rationally designed PfRH5 fragments, or from optimised PfRH5 fragments, provided they retain the epitope corresponding to amino acid residues Ser153 to Ile163 and Asp305 to Lys319 of PfRH5 (SEQ ID NO: 1) in the correct confirmation to give rise to non-neutralising antibodies with the synergistic activity described herein.
[0145] The invention provides PfRH5 antigens which comprise an epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL). As described herein, said antigens give rise to antibodies which are themselves neutralising, and the activity of which is potentiated by the non-neutralising PfRH5 antibodies of the invention as described herein. Typically, said PfRH5 antigens which give rise to neutralising PfRH5 antibodies of the invention comprise an epitope having residues corresponding to (i) amino acid residues Lys196 to Ser197; Asn347 to Asn352; Arg357 to His365; and Lys443 to Arg448 of PfRH5 (SEQ ID NO: 1); (ii) residues Gly201 to Lys219; and Lys327 to Tyr335 of PfRH5 (SEQ ID NO: 1); residues Gly201 to Lys219 and Lys327 to Gln342 of PfRH5 (SEQ ID NO: 1); or residues Lys196, Ser197, Tyr346 to Asn354 and Lys443 to Lys452 of PfRH5 (SEQ ID NO: 1). The structure of such a PfRH5 antigen of the invention is not limited, provided that the epitope is held in the correct confirmation to give rise to neutralising antibodies according to the invention.
[0146] The PfRH5 antigens of the invention which give rise to neutralising anti-PfRH5 antibodies of the invention may be derived from unmodified PfRH5 fragments, from rationally designed PfRH5 fragments, or from optimised PfRH5 fragments (as described above in relation to antigens which give rise to non-neutralising antibodies), provided they retain the epitope within SEQ ID NO: 3 (RH5ΔN) or SEQ ID NO: 7 (RH5ΔNL), and more particularly an epitope corresponding to (i) amino acid residues amino acid residues Lys196 to Ser197; Asn347 to Asn352; Arg357 to His365; and Lys443 to Arg448 of PfRH5 (SEQ ID NO: 1); (ii) residues Gly201 to Lys219; and Lys327 to Tyr335 of PfRH5 (SEQ ID NO: 1); residues Gly201 to Lys219 and Lys327 to Gln342 of PfRH5 (SEQ ID NO: 1); or residues Lys196, Ser197, Tyr346 to Asn354 and Lys443 to Lys452 of PfRH5 (SEQ ID NO: 1) in the correct confirmation to give rise to neutralising antibodies with the activity described herein.
[0147] The PfRH5 antigens of the invention (either which give rise to non-neutralising antibodies or to neutralising antibodies) may have variant sequences compared with the PfRH5 sequence (be it a wild-type/unmodified PfRH5 sequence, a rationally designed fragment or optimised PfRH5 sequence) from which it is derived. Such variants may exhibit at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97% at least 98%, at least 99% or more identity with the PfRH5 sequence from which they are derived.
[0148] Conventional methods for determining amino acid sequence identity are known in the art. The terms “sequence identity” and “sequence homology” are considered synonymous in this specification.
[0149] By way of example, a polypeptide of interest may comprise an amino acid sequence having at least 70, 75, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 99 or 100% amino acid sequence identity with the amino acid sequence of a reference polypeptide.
[0150] There are many established algorithms available to align two amino acid sequences. Typically, one sequence acts as a reference sequence, to which test sequences may be compared. The sequence comparison algorithm calculates the percentage sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters. Alignment of amino acid sequences for comparison may be conducted, for example, by computer implemented algorithms (e.g. GAP, BESTFIT, FASTA or TFASTA), or BLAST and BLAST 2.0 algorithms.
[0151] The BLOSUM62 table shown below is an amino acid substitution matrix derived from about 2,000 local multiple alignments of protein sequence segments, representing highly conserved regions of more than 500 groups of related proteins (Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915-10919, 1992; incorporated herein by reference). Amino acids are indicated by the standard one-letter codes. The percent identity is calculated as:
TABLE-US-00001 BLOSUM62 table A R N D C Q E G H I L K M F PST W Y V A 4 R-1 5 N-2 0 6 D-2-2 1 6 C 0-3-3-3 9 Q-1 1 0 0-3 5 E-1 0 0 2-4 2 5 G 0-2 0-1-3-2-2 6 H-2 0 1-1-3 0 0-2 8 I-1-3-3-3-1-3-3-4-3 4 L-1-2-3-4-1-2-3-4-3 24 K-1 2 0-1-3 1 1-2-1-3-2 5 M-1-1-2-3-1 0-2-3-2 1 2-1 5 F-2-3-3-3-2-3-3-3-1 0 0-3 0 6 P-1-2-2-1-3-1-1-2-2-3-3-1-2-4 7 S 1-1 1 0-1 0 0 0-1-2-2 0-1-2-1 4 T 0-1 0-1-1-1-1-2-2-1-1-1-1-2-1 1 5 W-3-3-4-4-2-2-3-2-2-3-2-3-1 1-4-3-2 11 Y-2-2-2-3-2-1-2-3 2-1-1-2-1 3-3-2-2 2 7 V 0-3-3-3-1-2-2-3-3 3 1-2 1-1-2-2 0-3-1 4
[0152] In a homology comparison, the identity may exist over a region of the sequences that is at least 10 amino acid residues in length (e.g. at least 15, 20, 30, 40, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500 or 520 amino acid residues in length)—e.g. up to the entire length of the reference sequence.
[0153] Substantially homologous polypeptides have one or more amino acid substitutions, deletions, or additions. In many embodiments, those changes are of a minor nature, for example, involving only conservative amino acid substitutions. Conservative substitutions are those made by replacing one amino acid with another amino acid within the following groups: Basic: arginine, lysine, histidine; Acidic: glutamic acid, aspartic acid; Polar: glutamine, asparagine; Hydrophobic: leucine, isoleucine, valine; Aromatic: phenylalanine, tryptophan, tyrosine; Small: glycine, alanine, serine, threonine, methionine. Substantially homologous polypeptides also encompass those comprising other substitutions that do not significantly affect the folding or activity of the polypeptide; small deletions, typically of 1 to about 30 amino acids (such as 1-10, or 1-5 amino acids); and small amino- or carboxyl-terminal extensions, such as an amino-terminal methionine residue, a small linker peptide of up to about 20-25 residues, or an affinity tag.
[0154] Typically a PfRH5 antigen of the invention (either which give rise to non-neutralising antibodies or to neutralising anti-PfRH5 antibodies) is at least 12, at least 13, at least ILL at least 15 at least 16 at least 17 at least 18 at least 19 at least 20 at least 21, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, 110, 120, 130 140, 150 or more consecutive amino acids in length. The PfRH5 antigens of the invention may be linear or branched, preferably linear.
[0155] The PfRH5 antigens of the invention may have substitutions at amino acid residues corresponding to amino acid residue 40 and/or amino acid residue 216 and/or amino acid residue 286 and/or amino acid residue 299 of SEQ ID NO: 1 or 2, wherein the amino acid T is replaced by an amino acid other than T. In one embodiment amino acid residues corresponding to amino acid residues 40, 216, 286 and/or 299 of SEQ ID NO: 1 or 2 are replaced with A. Typically, amino acid residues corresponding to amino acid residues 40, 216, 286 and 299 of SEQ ID NO: 1 or 2 are each replaced with A.
[0156] A PfRH5 antigen of the invention may be modified relative to the PfRH5 antigen from which it is derived, provided that: (i) in the case of a PfRH5 antigen that gives rise to a non-neutralising antibody of the invention, the epitope defined herein is retained and the antigen still gives rise to a non-neutralising antibody; or (ii) in the case of a PfRH5 antigen that gives rise to a neutralising antibody of the invention, the epitope defined herein is retained and the antigen still gives rise to a neutralising antibody.
[0157] An amino acid modification according to the invention may be a substitution, deletion, addition or other modification, including post-translational modification, unless the relevant disclosure explicitly says otherwise. Preferably said modifications are amino acid substitutions. In other words, the amino acid at a specified position within the PfRH5 antigen of the invention is substituted by a naturally occurring or non-naturally occurring amino acid that is different to the amino acid present at that position in the PfRH5 sequence from which the PfRH5 antigen of the invention is derived. Alternatively, the amino acid at a specified position within the PfRH5 antigen of the invention may be modified post-translationally. Post-translational modifications include glycosylations, acetylations, acylations, de-aminations, phosphorylisations, isoprenylisations, glycosyl phosphatidyl inositolisations and further modifications known to a person skilled in the art.
[0158] The modification of one or more amino acid position as described herein may be performed, for example, by specific mutagenesis, or any other method known in the art.
[0159] In embodiments in which one or more amino acid position is substituted relative to the corresponding PfRH5 antigen from which the antigen of the invention is derived, the substitution may be a conservative substitution or a non-conservative substitution. A conservative substitution is defined as substitution by an amino acid pertaining to the same physiochemical group to the amino acid present in the PfRH5 antigen from which the antigen of the invention is derived. A non-conservative amino acid substitution is defined as substitution by an amino acid pertaining to a different physiochemical group to the amino acid present in the PfRH5 antigen from which the antigen of the invention is derived. In more detail, amino acids are, in principle, divided into different physiochemical groups. Aspartate and glutamate belong to the negatively-charged amino acids. Histidine, arginine and lysine belong to the positively-charged amino acids. Asparagine, glutamine, serine, threonine, cysteine and tyrosine belong to the polar amino acids. Glycine, alanine, valine, leucine, isoleucine, methionine, proline, phenylalanine and tryptophan belong to the non-polar amino acids. Aromatic side groups are to be found among the amino acids histidine, phenylalanine, tyrosine and tryptophan. Thus, as a non-limiting example, a conservative substation may involve the substitution of a non-polar amino acid by another non-polar amino acid, such as substituting leucine with isoleucine. As another non-limiting example, a non-conservative substitution may involve the substation of a non-polar amino acid (e.g. leucine) with a negatively-charged amino acid (e.g. aspartate), a positively-charged amino acid (e.g. arginine), or a polar amino acid (e.g. asparagine).
Expression Systems
[0160] A PfRH5 antibody, binding compound or antigen of the invention may be expressed using any suitable systems.
[0161] Generation of antibodies once an epitope has been identified can be carried out using known methods in the art. The antibodies per se can be generated using such methods as mouse hybridomas, phage display or ribosome display. Other methods known to the person skilled in the art may also be used. The resultant functional antibodies from a mouse immunisation or a phage display screen can then have their binding confirmed by epitope mapping. Accordingly, the invention provides a hybridoma expressing any antibody (non-neutralising or neutralising) of the invention.
[0162] For example, one could readily determine whether an antibody binds to the epitope of the invention via a reference antibody such as the mAb11 antibody of the invention (for a non-neutralising antibody), or the mAb16 or mAb4 antibodies (for a neutralising antibody).
[0163] Such methods are a matter of routine in the art. By way of a non-limiting example, to determine whether a given antibody binds to the same epitope as antibody mAb11, the antibody mAb11 can be bound to PfRH5 under saturating conditions. Subsequently, the antibody of interest can be assessed for binding to PfRH5. If this antibody is capable of binding to PfRH5 following saturation binding with antibody mAb11, it is clear that the two antibodies are binding to different epitopes. If the antibody is not capable of binding to PfRH5 following saturation binding with antibody mAb11, then the antibody may be binding to the epitope of the invention. The binding profile of the antibody of interest should also be taken into consideration: if it binds with similar affinity (K.sub.D) and/or potency (GIA) to PfRH5 as antibody mAb11, then this makes it far more likely that it is binding to the epitope of the invention. Conversely, if the binding profiles are very different, this suggests that it is not binding to the epitope of the invention. Additional routine experimentation (such as peptide mutation and binding analyses) can be carried out to confirm whether the observed lack of binding in this situation is in fact due to binding the epitope of the invention or if some other phenomenon (such as steric hindrance) is responsible. Such experiments can be carried out using ELISA, RIA, Biacore, flow cytometry or other known antibody binding assays.
[0164] Antigens of the invention may be expressed using conventional systems. Such a system may be a prokaryotic or a eukaryotic system. Examples of such systems are well-known in the art. Non-limiting examples of suitable host systems include Escherichia coli, Saccharomyces cerevisiae, Pichia pastoris, non-lytic insect cell expression systems such as Schneider 2 (S2) and Schneider 3 (S3) cells from Drosophila melanogaster and Sf9 and Sf21 cells from Spodoptera frugiperda, and mammalian expression systems such as CHO cells and human embryonic kidney (HEK/HEK293) cells.
[0165] Accordingly, the invention provides a host cell containing a recombinant expression vector which encodes for a PfRH5 antigen of the invention. In a preferred embodiment the host cell is an insect cell, preferably a Drosophila melanogaster cell, or a Pichia yeast cell, or an Escherichia coli cell.
[0166] The term antigen as used herein refers to any peptide-based sequence that can be recognised by the immune system and/or that stimulates a cell-mediated immune response and/or stimulates the generation of antibodies. The PfRH5 antigens of the invention may be present in the form of a vaccine composition or vaccine formulation.
[0167] As described herein, the PfRH5 antigens of the invention raise non-neutralising or neutralising antibodies as described herein. The neutralising antibodies raised by PfRH5 antigens of the invention inhibit the growth of malarial parasites, i.e. Plasmodium parasites, preferably across a plurality of strains of blood-stage Plasmodium parasites. In a more preferred embodiment, the PfRH5 antigens of the invention raise neutralising antibodies that inhibit the growth of Plasmodium falciparum parasites, and more preferably across a plurality of strains of blood-stage P. falciparum parasites. The effectiveness of the PfRH5 antigens of the invention may be quantified using any appropriate technique and measured in any appropriate units. For example, the effectiveness of the PfRH5 antigens of the invention may be given in terms of their growth inhibitory activity (GIA), half maximal effective concentration (EC.sub.50), antibody titre stimulated (in terms of antibody units, AU) and/or EC.sub.50 in terms of AU (described herein in relation to antibodies of the invention). The latter of these gives an indication of the quality of the antibody response stimulated by the PfRH5 antigen of the invention. Any appropriate technique may be used to determine the GIA, EC.sub.50, AU or EC.sub.50/AU. Exemplary techniques are described in the examples and conventional techniques are known in the art. The disclosure herein in relation to quantifying the effectiveness of the antibodies of the invention applies equally to antibodies raised by PfRH5 antigens or epitopes of the invention.
[0168] The antibodies/binding compounds or epitopes/antigens of the invention may be expressed by in a single vector. Wherein the vector of the invention expresses epitopes/antigens of the invention, the expressed epitopes/antigens are capable of inducing both non-neutralising and neutralising antibodies (or other binding proteins) as described herein. Alternatively the combination of the non-neutralising and neutralising antibodies of the invention, or the combination of the corresponding epitopes/antigens, can be effected by mixing two separate recombinant protein vaccines (Pichyangkul, S., et al., Vaccine, 2009. 28(2): p. 452-62; and Ellis, R. D., et al., PLoS One, 2012. 7(10): p. e46094; both of which are incorporated herein by reference), or by co-delivery using vaccine platforms such as particle-based protein vaccine delivery (Bachmann, M. F., et al., Nat Rev Immunol, 2010. 10(11): p. 787-96; incorporated herein by reference), or virus-like particles (VLP), or by fusing or conjugating the PfRH5 epitopes/antigens to a construct or constructs that allow for particle formation and/or enhanced immunogenicity (Spencer, A. J., et al., PLoS One, 2012. 7(3): p. e33555; and Wu, Y., et al., Proc Natl Acad Sci USA, 2006. 103(48): p. 18243-8; both of which are incorporated herein by reference). In one embodiment, the PfRH5 antigen/epitope that gives rise to a non-neutralising antibody and the PfRH5 antigen/epitope that gives rise to a neutralising antibody may be delivered as a fusion protein (Biswas, S., et al., PLoS One, 2011. 6(6): p. e20977; incorporated herein by reference). Additionally or alternatively, the PfRH5 antigen/epitope that gives rise to a non-neutralising antibody and the PfRH5 antigen/epitope that gives rise to a neutralising antibody (or the non-neutralising antibody and neutralising antibodies themselves) may be delivered using a mixture of viral vectors expressing the individual antigens/epitopes (or antibodies) (Forbes, E. K., et al., J Immunol, 2011. 187(7): p. 3738-50; and Sheehy, S. H., et al., Mol Ther, 2012. 20(12): p. 2355-68; both of which are incorporated herein by reference), or viral vectors co-expressing both the PfRH5 antigen/epitope that gives rise to a non-neutralising antibody and the PfRH5 antigen/epitope that gives rise to a neutralising antibody (or the antibodies themselves). Co-expression may be in the form of a fusion protein (Porter, D. W., et al., Vaccine, 2011. 29(43): p. 7514-22; incorporated herein by reference), or as separate transcripts under the control of separate promoters (Bruder, J. T., et al., Vaccine, 2010. 28(18): p. 3201-10; and Tine, J. A., et al., Infect Immun, 1996. 64(9): p. 3833-44; both of which are incorporated herein by reference), or as a single polypeptide which undergoes cleavage to yield two separate antigens/epitopes (or antibodies) (Ibrahimi, A., et al., Hum Gene Ther, 2009. 20(8): p. 845-60; incorporated herein by reference).
Therapeutic Indications
[0169] The present invention also provides a method of stimulating or inducing an immune response in a subject comprising administering to the subject a composition of the invention, one or more antibodies of the invention, one or more binding proteins of the invention, one or more vectors of the invention, or one or more epitopes/antigens of the invention (as described above).
[0170] Thus, the invention provides a vaccine composition comprising a composition of the invention; a non-neutralising antibody, or binding fragment thereof, of the invention and a neutralising antibody, or binding fragment thereof, of the invention; a bispecific dual variable domain molecule of the invention; a viral vector, RNA vaccine or DNA plasmid of the invention, or one or more epitopes/antigens of the invention.
[0171] In one embodiment, the method of stimulating or inducing an immune response in a subject comprises administering a composition of the invention (including a vaccine composition); a non-neutralising antibody, or binding fragment thereof, of the invention and a neutralising antibody, or binding fragment thereof, of the invention; a bispecific dual variable domain molecule of the invention; a viral vector, RNA vaccine or DNA plasmid of the invention, or one or more epitopes/antigens of the invention (as described above) to a subject. In the context of the therapeutic uses and methods, a “subject” is any animal subject that would benefit from stimulation or induction of an immune response against a Plasmodium parasite. Typical animal subjects are mammals, such as primates, for example, humans.
[0172] Thus, the present invention provides a method for treating or preventing malaria.
[0173] The present invention also provides a composition of the invention (including a vaccine composition); a non-neutralising antibody, or binding fragment thereof, of the invention and a neutralising antibody, or binding fragment thereof, of the invention; a bispecific dual variable domain molecule of the invention; a viral vector, RNA vaccine or DNA plasmid of the invention, or one or more epitopes/antigens of the invention for use in the prevention or treatment of malaria.
[0174] The present invention also provides the use of a composition of the invention (including a vaccine composition); a non-neutralising antibody, or binding fragment thereof, of the invention and a neutralising antibody, or binding fragment thereof, of the invention; a bispecific dual variable domain molecule of the invention; a viral vector, RNA vaccine or DNA plasmid of the invention, or one or more epitopes/antigens of the invention in the manufacture of a medicament for the prevention and/or treatment of malaria.
[0175] The one or more epitopes/antigens of the invention may be in the form of a recombinant protein, a protein particle, a virus-like particle, a fusion protein, or a combination thereof as described herein. In addition, the one or more epitopes/antigens of the invention may be used in combination with one or more further antigens selected from the group consisting of PfRipr, PfCyRPA, PfP113, PfRhopH3, PfRAP2, PfAMA1, PfRON2, PfEBA175, PfRH1, PfRH2a, PfRH2b, PfRH4, PfRAP1, PfRAP3, PfMSRP5, PfRAMA, PfSERA9, PfEBA181 and PfAARP, or a fragment thereof; for use in prevention or treatment of malaria.
[0176] The present invention provides the use of a composition of the invention (including a vaccine composition); a non-neutralising antibody, or binding fragment thereof, of the invention and a neutralising antibody, or binding fragment thereof, of the invention; a bispecific dual variable domain molecule of the invention; a viral vector, RNA vaccine or DNA plasmid of the invention, or one or more epitopes/antigens of the invention (as described above) for use either alone or in combination in the prevention or treatment of malaria.
[0177] In one embodiment, the method for treating or preventing malaria comprises administering a therapeutically effective amount of a composition of the invention (including a vaccine composition); a non-neutralising antibody, or binding fragment thereof, of the invention and a neutralising antibody, or binding fragment thereof, of the invention; a bispecific dual variable domain molecule of the invention; a viral vector, RNA vaccine or DNA plasmid of the invention, or one or more epitopes/antigens of the invention (as described above), either alone or in combination, to a subject.
[0178] Vaccine compositions of the invention, whilst they may express or display an epitope as defined herein, or induce an antibody as defined herein, typically do not express or display the full-length PfRH5 protein. Instead, such vaccine compositions of the invention express or display rationally designed fragments of PfRH5 which comprise or consist of one or more epitope as defined herein, or otherwise induce an antibody as defined herein. Nor do vaccine compositions of the invention comprise or consist of the full-length PfRH5 protein, but rather such vaccines of the invention comprise or consist of rationally designed fragments of PfRH5 which comprise or consist of one or more epitope as defined herein, or otherwise induce an antibody as defined herein.
[0179] As used herein, the term “treatment” or “treating” embraces therapeutic or preventative/prophylactic measures, and includes post-infection therapy and amelioration of malaria.
[0180] As used herein, the term “preventing” includes preventing the initiation of malaria and/or reducing the severity or intensity of malaria. The term “preventing” includes inducing or providing protective immunity against malaria. Immunity to malaria may be quantified using any appropriate technique, examples of which are known in the art.
[0181] A composition of the invention (including a vaccine composition), a non-neutralising antibody, or binding fragment thereof, of the invention and a neutralising antibody, or binding fragment thereof, of the invention; a bispecific dual variable domain molecule of the invention; a viral vector, RNA vaccine or DNA plasmid of the invention, or one or more epitopes/antigens of the invention (as described above) may be administered to a subject (typically a mammalian subject such as a human or other primate) already having malaria, a condition or symptoms associated with malaria, to treat or prevent malaria. For example, the subject may be suspected of having come in contact with Plasmodium parasite, or has had known contact with Plasmodium parasite, but is not yet showing symptoms of exposure.
[0182] When administered to a subject (e.g. a mammal such as a human or other primate) that already has malaria, or is showing symptoms associated with Plasmodium parasite infection, a composition of the invention (including a vaccine composition), a non-neutralising antibody, or binding fragment thereof, of the invention and a neutralising antibody, or binding fragment thereof, of the invention; a bispecific dual variable domain molecule of the invention; a viral vector, RNA vaccine or DNA plasmid of the invention, or one or more epitopes/antigens of the invention (as described above) can cure, delay, reduce the severity of, or ameliorate one or more symptoms, and/or prolong the survival of a subject beyond that expected in the absence of such treatment.
[0183] Alternatively, a composition of the invention (including a vaccine composition), a non-neutralising antibody, or binding fragment thereof, of the invention and a neutralising antibody, or binding fragment thereof, of the invention; a bispecific dual variable domain molecule of the invention; a viral vector, RNA vaccine or DNA plasmid of the invention, or one or more epitopes/antigens of the invention (as described above) may be administered to a subject (e.g. a mammal such as a human or other primate) who ultimately may be infected with Plasmodium parasite, in order to prevent, cure, delay, reduce the severity of, or ameliorate one or more symptoms of malaria, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment, or to help prevent that subject from transmitting malaria.
[0184] The treatments and preventative therapies of the present invention are applicable to a variety of different subjects of different ages. In the context of humans, the therapies are applicable to children (e.g. infants, children under 5 years old, older children or teenagers) and adults. In the context of other animal subjects (e.g. mammals such as primates), the therapies are applicable to immature subjects and mature/adult subjects.
[0185] The present invention provides vaccine compositions comprising any of the compositions of the invention; non-neutralising antibodies, or binding fragments thereof, of the invention and the neutralising antibodies, or binding fragments thereof, of the invention; the bispecific dual variable domain molecules of the invention; the viral vectors, RNA vaccines or DNA plasmids of the invention, or one or more epitopes/antigens of the invention (described herein). Said vaccine compositions may further comprise one or more additional malarial antigens as described herein, and/or any further components as described herein.
[0186] A vaccine composition of the invention may further comprise one or more additional neutralising antibody to, a bispecific dual variable domain molecule binding to; a viral vector, RNA vaccine or DNA plasmid expressing such an antibody or binding molecule, or one or more epitopes/antigens (or vectors expressing) one or more additional antigen selected from the group consisting of PfRipr, PfCyRPA, PfP113, PfRhopH3, PfRAP2, PfAMA1, PfRON2, PfEBA175, PfRH1, PfRH2a, PfRH2b, PfRH4, PfRAP1, PfRAP3, PfMSRP5, PfRAMA, PfSERA9, PfEBA181 and PfAARP, or a fragment thereof. These may be expressed in any suitable form. As a non-limiting example, expression may be as a virus like particle (VLP). Recombinant particulate vaccines are well known in the art. They may be, for example, either fusion proteins or proteins chemically conjugated to particles. Examples of fusion proteins are hepatitis B surface antigen fusions (e.g. as in the RTS,S malaria vaccine candidate), hepatitis B core antigen fusions, or Ty-virus like particles. Examples of chemical fusion particles are the Q-beta particles under development by the biotechnology company Cytos (Zurich, Switzerland) and as in Brune et al. Sci. Rep. (2016), 19(6):19234.
[0187] The present invention further provides a vaccine composition comprising a PfRH5 epitope of the invention (which gives rise to a non-neutralising but synergistic antibody) and a Plasmodium merozoite antigen of the invention (which gives rise to a neutralising antibody synergised by the non-neutralising antibody of the invention). Optionally said vaccine may further comprise one or more additional antigen or a fragment thereof to an additional malarial antigen as described herein (particularly PfRipr or PfCyRPA or a fragment thereof), where either or both the PfRH5 epitope, the Plasmodium merozoite antigen and/or the one or more additional antigen or fragment thereof may be expressed as a soluble recombinant protein. Recombinant protein-based vaccines are well known in the art. They may be, for example, monomeric soluble proteins or soluble fusion proteins. Such proteins are typically administered or formulated in a vaccine adjuvant. Examples of protein-based vaccines are diphtheria and tetanus toxoids, or soluble malaria protein antigens such as the PfAMA1 protein vaccine candidates developed for blood-stage malaria (Spring, M. D., et al., PLoS ONE, 2009. 4(4): p. e5254; incorporated herein by reference).
[0188] The compositions of the invention; non-neutralising antibodies, or binding fragments thereof, of the invention and the neutralising antibodies, or binding fragments thereof, of the invention; the bispecific dual variable domain molecules of the invention; the viral vectors, RNA vaccines or DNA plasmids of the invention, or one or more epitopes/antigens of the invention (described herein) may be combined to provide a single vaccine product (as described above), e.g. by mixing two separate vaccines, or by co-delivery using vaccine platforms such as particle-based protein vaccine delivery, or by using a mixture of viral vectors expressing the individual components, or viral vectors co-expressing both components.
[0189] As used, herein, a “vaccine” is a formulation that, when administered to an animal subject such as a mammal (e.g. a human or other primate) stimulates or provides a protective immune response against Plasmodium parasitic infection. The immune response may be a humoral and/or cell-mediated immune response. A vaccine of the invention can be used, for example, to protect a subject from the effects of P. falciparum infection (i.e. malaria).
[0190] The lack of polymorphism at the PfRH5 locus (five non-synonymous SNP across its entire length in circulating P. falciparum parasites) suggest either a lack of substantial immune pressure, or a high degree of functional constraint that prevents mutations from freely occurring. This property makes it highly likely that the vaccine compositions comprising any of the compositions of the invention; non-neutralising antibodies, or binding fragments thereof, of the invention and the neutralising antibodies, or binding fragments thereof, of the invention; the bispecific dual variable domain molecules of the invention; the viral vectors, RNA vaccines or DNA plasmids of the invention, or one or more epitopes/antigens of the invention (described herein) according to the present invention will have broadly neutralising activity.
[0191] Thus, the compositions of the invention; non-neutralising antibodies, or binding fragments thereof, of the invention and the neutralising antibodies, or binding fragments thereof, of the invention; the bispecific dual variable domain molecules of the invention; the viral vectors, RNA vaccines or DNA plasmids of the invention, or one or more epitopes/antigens of the invention (described herein) typically provide a highly effective cross-strain GIA against the Plasmodium parasite. Thus, in one embodiment, the invention provides protection (such as long term protection) against disease caused by Plasmodium parasites. Typically, a composition of the invention; a non-neutralising antibody, or binding fragment thereof, of the invention and a neutralising antibody, or binding fragment thereof, of the invention; a bispecific dual variable domain molecule of the invention; a viral vector, RNA vaccine or DNA plasmid of the invention, or one or more epitopes/antigens of the invention (described herein) provides an antibody response (e.g. a neutralising antibody response) to Plasmodium parasitic infection. The compositions of the invention; non-neutralising antibodies, or binding fragments thereof, of the invention and the neutralising antibodies, or binding fragments thereof, of the invention; the bispecific dual variable domain molecules of the invention; the viral vectors, RNA vaccines or DNA plasmids of the invention, or one or more epitopes/antigens of the invention as described herein may be used to confer pre-erythrocytic or transmission-blocking protection against Plasmodium parasites.
[0192] The treatment and/or prevention of malaria according to the present invention may further comprise boosting a subject. Such “boosting” may comprise the administration of a pox virus, such as MVA.
Pharmaceutical Compositions and Formulations
[0193] The term “vaccine” is herein used interchangeably with the terms “therapeutic/prophylactic composition”, “formulation” or “medicament”.
[0194] The vaccine of the invention (as defined above) can be combined or administered in addition to a pharmaceutically acceptable carrier. Alternatively or in addition the vaccine of the invention can further be combined with one or more of a salt, excipient, diluent, adjuvant, immunoregulatory agent and/or antimicrobial compound.
[0195] Pharmaceutically acceptable salts include acid addition salts formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or with organic acids such as acetic, oxalic, tartaric, maleic, and the like. Salts formed with the free carboxyl groups may also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.
[0196] Administration of immunogenic compositions, therapeutic formulations, medicaments and prophylactic formulations (e.g. vaccines) is generally by conventional routes e.g. intravenous, subcutaneous, intraperitoneal, or mucosal routes. The administration may be by parenteral injection, for example, a subcutaneous, intradermal or intramuscular injection. Formulations comprising neutralizing antibodies may be particularly suited to administration intravenously, intramuscularly, intradermally, or subcutaneously.
[0197] Accordingly, immunogenic compositions, therapeutic formulations, medicaments and prophylactic formulations (e.g. vaccines) of the invention are typically prepared as injectables, either as liquid solutions or suspensions. Solid forms suitable for solution in, or suspension in, liquid prior to injection may alternatively be prepared. The preparation may also be emulsified, or the peptide encapsulated in liposomes or microcapsules.
[0198] The active immunogenic ingredients (such as the non-neutralising antibodies, or binding fragments thereof, of the invention and the neutralising antibodies, or binding fragments thereof, of the invention; the bispecific dual variable domain molecules of the invention; the viral vectors, RNA vaccines or DNA plasmids of the invention, or one or more epitopes/antigens of the invention) are often mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredient. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol, or the like and combinations thereof. In addition, if desired, the vaccine may contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and/or adjuvants which enhance the effectiveness of the vaccine.
[0199] Generally, the carrier is a pharmaceutically-acceptable carrier. Non-limiting examples of pharmaceutically acceptable carriers include water, saline, and phosphate-buffered saline. In some embodiments, however, the composition is in lyophilized form, in which case it may include a stabilizer, such as BSA. In some embodiments, it may be desirable to formulate the composition with a preservative, such as thiomersal or sodium azide, to facilitate long term storage.
[0200] Examples of additional adjuvants which may be effective include but are not limited to: complete Freund's adjuvant (CFA), Incomplete Freund's adjuvant (IFA), Saponin, a purified extract fraction of Saponin such as Quil A, a derivative of Saponin such as QS-21, lipid particles based on Saponin such as ISCOM/ISCOMATRIX, E. coli heat labile toxin (LT) mutants such as LTK63 and/or LTK72, aluminium hydroxide, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine (CGP 11637, referred to as nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1′-2′-dipalmitoyl-sn-glycero-3-hydroxyphosphoryl oxy)-ethylamine (CGP 19835A, referred to as MTP-PE), and RIBI, which contains three components extracted from bacteria, monophosphoryl lipid A, trehalose dimycolate and cell wall skeleton (MPL+TDM+CWS) in a 2% squalene/Tween 80 emulsion, the MF59 formulation developed by Novartis, and the AS02, ASO1, AS03 and ASO4 adjuvant formulations developed by GSK Biologicals (Rixensart, Belgium).
[0201] Examples of buffering agents include, but are not limited to, sodium succinate (pH 6.5), and phosphate buffered saline (PBS; pH 6.5 and 7.5).
[0202] Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral formulations or formulations suitable for distribution as aerosols. For suppositories, traditional binders and carriers may include, for example, polyalkylene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1%-2%.
[0203] Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders.
[0204] It is within the routine practice of a clinician to determine an effective amount of a vaccine composition of the invention. An effective amount is an amount sufficient to elicit a protective immune response against malaria. A clinician will also be able to determine appropriate dosage interval using routine skill.
Sequence Information
[0205] PfRH5 Antigens from which Antigens/Epitopes of the Invention May be Derived
Full Length PfRH5 Amino Acid Sequence (3D7) Including Signal Sequence: SEQ ID NO: 1
[0206]
TABLE-US-00002 1
Full Length PfRH5 Amino Acid Sequence (7G8) Including Signal Sequence: SEQ ID NO: 2
[0211]
TABLE-US-00003 1
PfRH5 Amino Acid Sequence (3D7) Excluding Signal Sequence and Flexible N-Terminal Region (Amino Acids 1 to 139): SEQ ID NO: 3 (3D7 RH5ΔN)
[0216]
TABLE-US-00004 1
PfRH5 Amino Acid Sequence (7G8) Excluding Signal Sequence and Flexible N-Terminal Region (Amino Acids 1 to 139): SEQ ID NO: 4 (7G8 RH5ΔN)
[0221]
TABLE-US-00005 1
PfRH5 Amino Acid Sequence (3D7) Excluding Signal Sequence and Flexible N-Terminal Region (Amino Acids 1 to 159): SEQ ID NO: 5
[0226]
TABLE-US-00006 1
PfRH5 Amino Acid Sequence (7G8) Excluding Signal Sequence and Flexible N-Terminal Region (Amino Acids 1 to 159): SEQ ID NO: 6
[0231]
TABLE-US-00007 1
PfRH5 Amino Acid Sequence (3D7) Excluding Signal Sequence, Flexible N-Terminal (Amino Acids 1 to 139) and Flexible Loop (Amino Acids 248 to 296) Regions: SEQ ID NO: 7 (3D7 RH5ΔNL)
[0236]
TABLE-US-00008 1
PfRH5 Amino Acid Sequence (7G8) Excluding Signal Sequence, Flexible N-Terminal (Amino Acids 1 to 139) and Flexible Loop (Amino Acids 248 to 296) Regions: SEQ ID NO: 8 (7G8 RH5ΔNL)
[0240]
TABLE-US-00009 1
PfRH5 Amino Acid Sequence (3D7) Excluding Signal Sequence, Flexible N-Terminal (Amino Acids 1 to 159) and Flexible Loop (Amino Acids 248 to 296) Regions: SEQ ID NO: 9
[0244]
TABLE-US-00010 1
PfRH5 Amino Acid Sequence (7G8) Excluding Signal Sequence, Flexible N-Terminal (Amino Acids 1 to 159) and Flexible Loop (Amino Acids 248 to 296) Regions: SEQ ID NO: 10
[0248]
TABLE-US-00011 1
Heavy Chain CDR Sequences for Non-Neutralising Antibodies of the Invention
[0252]
TABLE-US-00012 CDR1 CDR2 CDR3 Antibody (SEQ ID NO) (SEQ ID NO) (SEQ ID NO) mAb11 SYAMN WINTNTGNPTY ESPNYYDSSGYY (11) AQGFTG (12) SGYYFDY (13) mAb14 DYAMH GISWNSASMDY DPAPPYCGGDCY (14) ADSVKG (15) PSFDY (16) mAb10 SYWMS NIKQDGSEKYY GASGYYYYNYGM (17) VDSVKG (18) DV (19)
Light Chain CDR Sequences for Non-Neutralising Antibodies of the Invention
[0253]
TABLE-US-00013 CDR1 CDR2 CDR3 Antibody (SEQ ID NO) (SEQ ID NO) (SEQ ID NO) mAb11 GGKNIGSKSVH DDSDRPS QVWDSSSDHRV (20) (21) (22) mAb14 GNNIGSKSVH YDSDRPS QVWDSSRDHVV (23) (24) (25) mAb10 GGNNIGIKSVH DDSDRPS QVWDSSSDHPGV (26) (21) (27)
Heavy Chain Framework Region Sequences Non-Neutralising Antibodies of the Invention
[0254]
TABLE-US-00014 FR1 FR2 FR3 FR4 Antibody (SEQ ID NO) (SEQ ID NO) (SEQ ID NO) (SEQ ID NO) mAb11 EVQLVQSGSDLKKP WVRQAPGQGLEWVG RFVFSLDTSVSTAY WGQGTLVTVSS GASVKVSCKASGYT (29) LQISSLKAEDTAVY (31) FT (28) YCAR (30) mAb14 EVQLVESGGGLVQP WVRQAPGKGLEWVS RFTISRDNAKNSLY WGQGTLVTVSS GRSLRLSCAASGFT (33) LQMNSLRAEDTALY (31) FD (32) YCAK (34) MAb10 EVQLVESGGGLVQP WVRQAPGKGLEWVA RFTISGDNAKNSLY WGQGTRVTVSS GGSLRLSCAASGFT (36) LQMNSLRAEDTAVY (38) FS (35) YCAR (37)
Light Chain Framework Region Sequences Non-Neutralising Antibodies of the Invention
[0255]
TABLE-US-00015 FR1 FR2 FR3 FR4 Antibody (SEQ ID NO) (SEQ ID NO) (SEQ ID NO) (SEQ ID NO) mAb11 SYELTQPPSVSVAPG WYQQKPGQAPVLVVY GIPERFSGSNSGNTA FGGGTKLTVLGQP QTATITC (39) (40) TLTISRVEAGDEADY (42) YC (41) mAb14 SYELTQPPSMSVAPG WYQQKPGQAPVLVIY GIPERFSGSNSGNTA FGGGTKLTVLGQP KTARITCG (43) (44) TLTISRVEAGDEADY (42) YC (41) mAb10 QPVLTQPPSVSVAPG WYQQKPGQAPVLVVY GIPERFSGSNSANTA FGGGTKLTVLGQP QTARITC (45) (40) TLTISRVEAGDEADY (42) FC (46)
VH and VL Sequences for Non-Neutralising Antibodies of the Invention
[0256]
TABLE-US-00016 Antibody VH (SEQ ID NO) VL (SEQ ID NO) mAb11 EVQLVQSGSDLKKPGASVKVSCKASGYTFTS SYELTQPPSVSVAPGQTATITCGGKNIGSKS YAMNWVRQAPGQGLEWVGWINTNTGNPTYAQ VHWYQQKPGQAPVLVVYDDSDRPSGIPERFS GFTGRFVFSLDTSVSTAYLQISSLKAEDTAV GSNSGNTATLTISRVEAGDEADYYCQVWDSS YYCARESPNYYDSSGYYSGYYFDYWGQGTLV SDHRVFGGGTKLTVLGQP (48) TVSS (47) mAb14 EVQLVESGGGLVQPGRSLRLSCAASGFTFDD SYELTQPPSMSVAPGKTARITCGGNNIGSKS YAMHWVRQAPGKGLEWVSGISWNSASMDYAD VHWYQQKPGQAPVLVIYYDSDRPSGIPERFS SVKGRFTISRDNAKNSLYLQMNSLRAEDTAL GSNSGNTATLTISRVEAGDEADYYCQVWDSS YYCAKDPAPPYCGGDCYPSFDYWGQGTLVTV RDHVVFGGGTKLTVLGQP (50) SS (49) MAbi0 EVQLVESGGGLVQPGGSLRLSCAASGFTFSS QPVLTQPPSVSVAPGQTARITCGGNNIGIKS YWMSWVRQAPGKGLEWVANIKQDGSEKYYVD VHWYQQKPGQAPVLVVYDDSDRPSGIPERFS SVKGRFTISGDNAKNSLYLQMNSLRAEDTAV GSNSANTATLTISRVEAGDEADYFCQVWDSS YYCARGASGYYYYNYGMDVWGQGTRVTVSS SDHPGVFGGGTKLTVLGQP (52) (51)
Epitope for the Non-Neutralising Antibodies of the Invention: SEQ ID NO: 53
[0257]
TABLE-US-00017 SNYNIANSID IDEYNTKKKK LIKCIK
This is a non-linear epitope corresponding to residues Ser153 to Ile163 and Asp305 to Lys319 of SEQ ID NO: 1 or 2
Heavy Chain CDR Sequences for Neutralising Antibodies of the Invention
[0258]
TABLE-US-00018 CDR1 CDR2 CDR3 Antibody (SEQ ID NO) (SEQ ID NO) (SEQ ID NO) mAb16 SYGIS (54) WISGYDGNTNY DGPQVGDFDWQ AQKLQG (55) VYYYYGMDV (56) mAb4 NYAIN (57) GIIPIFATTNY DKHSWSYAFDI AQKFQG (58) (59)
Light Chain CDR Sequences for Neutralising Antibodies of the Invention
[0259]
TABLE-US-00019 CDR1 CDR2 CDR3 Antibody (SEQ ID NO) (SEQ ID NO) (SEQ ID NO) mAb16 RASQSINTWLA KASSLES QQYNSYLYT (60) (61) (62) mAb4 SGSSSNIGSNTVN SNNQRPS AAWDDSLNGWV (63) (64) (65)
Heavy Chain Framework Region Sequences Neutralising Antibodies of the Invention
[0260]
TABLE-US-00020 FR1 FR2 FR3 FR4 (SEQ ID (SEQ ID (SEQ ID (SEQ ID Antibody NO) NO) NO) NO) mAb16 AIRMTQSP WYQQKPGK GVPSRFSG FGQGTKV STLSASVG APNLLIS SGSGTEF EIRRTV DRVTITC (74) TLTISSL (76) (73) QPDDFAT YFC (75) mAb4 QSVLTQPP WYQHLPG GVPDRFSG FGGGTKL SASGTPG TAPKLLIH SKSGTSAS TVLGQP LRVTISC (78) LAISGLQS (80) (77) EDEADYYC (79)
Light Chain Framework Region Sequences Neutralising Antibodies of the Invention
[0261]
TABLE-US-00021 FR1 FR2 FR3 FR4 (SEQ ID (SEQ ID (SEQ ID (SEQ ID Antibody NO) NO) NO) NO) mAbl6 AIRMTQSP WYQQKPGK GVPSRFSG FGQGTKV STLSASVG APNLLIS SGSGTEF EIRRTV DRVTITC (74) TLTISSLQ (76) (73) PDDFATY FC (75) mAb4 QSVLTQPP WYQHLPGT GVPDRFSG FGGGTKL SASGTPG APKLLIH SKSGTSAS TVLGQP LRVTISC (78) LAISGLQS (80) (77) EDEADYYC (79)
VH and VL Sequences for Neutralising Antibodies of the Invention
[0262]
TABLE-US-00022 Antibody VH (SEQ ID NO) VL (SEQ ID NO) mAb QVQLVQSGAEVKKPG AIRMTQSPSTLSASV 16 ASVRVSCKASGYTFT GDRVTITCRASQSIN SYGISWVRQAPGQGL TWLAWYQQKPGKAPN EWMGWISGYDGNTNY LLISKASSLESGVPS AQKLQGRVTMTTDTS RFSGSGSGTEFTLTI TSTAYMELRSLRSDD SSLQPDDFATYFCQQ TAVYYCARDGPQVGD YNSYLYTFGQGTKVE FDWQVYYYYGMDWGQ IRRTV (82) GTTVTVSS(81) mAb EVQLVQSGAEVKKPG QSVLTQPPSASGTPG 4 SSVKVSCKASGGTFS LRVTISCSGSSSNIG NYAINWVRQAPGQGL SNTVNWYQHLPGTAP EWMGGIIPIFATTNY KLLIHSNNQRPSGVP AQKFQGRVTITADES DRFSGSKSGTSASLI TSTAYMELSSLRSED SGLQSEDEADYYCAA TAVYFCARDKHSWSY WDDSLNGWVFGGGTK AFDIWGQGTMVTVSS LTVLGQP (83) (84)
Epitope for the Neutralising Antibody mAb4 of the Invention: SEQ ID NO: 85
TABLE-US-00023 KSNNNFCNRY HYDEYIHKLN IWR
[0263] This is a non-linear epitope corresponding to residues Lys196 to Ser197; Asn347 to Asn352; Arg357 to His365; and Lys443 to Arg448 of SEQ ID NO: 1 or 2
Epitope for the Neutralising Antibody mAb16 of the Invention: SEQ ID NO: 86
TABLE-US-00024 GKCIAVDAFI KKINETYDKK ICMDMKNY
[0264] This is a non-linear epitope corresponding to residues Gly201 to Lys219 and Lys327 to Tyr335 of SEQ ID NO: 1 or the corresponding residues in SEQ ID NO: 2
The Neutralising Antibody Red Epitope Bin Sequence: SEQ ID NO: 87
[0265]
TABLE-US-00025
[0266] This is a non-linear epitope corresponding to residues Gly201 to Lys219 and Lys327 to Gln342 of SEQ ID NO: 1 or the corresponding residues in SEQ ID NO: 2
The Neutralising Antibody Blue Epitope Bin Sequence: SEQ ID NO: 88
[0267]
TABLE-US-00026 KSYNNNFCNT NKLNIWRTFQ K
This is a non-linear epitope corresponding to residues Lys196, Ser 197, Tyr346 to Asn354 and Lys443 to Lys452 of SEQ ID NO: 1 or the corresponding residues in SEQ ID NO: 2
RH5.1 amino acid sequence—based on residues E26-Q526 of the 3D7 clone reference sequence, together with a C-terminal four-amino acid purification tag (C-tag: EPEA—underlined) and four mutations to delete N-linked glycosylation sequons (T40A, T216A, T286A and T299A, each in bold), i.e. residue 1 corresponds to residues 26 of SEQ ID NO: 1 (SEQ ID NO: 89)
TABLE-US-00027 ENAIKKTKNQ ENNLALLPIK STEEEKDDIK NGKDIKKEID NDKENIKTNN AKDHSTYIKS 60 YLNTNVNDGL KYLFIPSHNS FIKKYSVFNQ INDGMLLNEK NDVKNNEDYK NVDYKNVNFL 120 QYHFKELSNY NIANSIDILQ EKEGHLDFVI IPHYTFLDYY KHLSYNSIYH KSSTYGKCIA 180 VDAFIKKINE AYDKVKSKCN DIKNDLIATI KKLEHPYDIN NKNDDSYRYD ISEEIDDKSE 240 ETDDETEEVE DSIQDTDSNH APSNKKKNDL MNRAFKKMMD EYNTKKKKLI KCIKNHENDF 300 NKICMDMKNY GTNLFEQLSC YNNNFCNTNG IRYHYDEYIH KLILSVKSKN LNKDLSDMTN 360 ILQQSELLLT NLNKKMGSYI YIDTIKFIHK EMKHIFNRIE YHTKIINDKT KIIQDKIKLN 420 IWRTFQKDEL LKRILDMSNE YSLFITSDHL RQMLYNTFYS KEKHLNNIFH HLIYVLQMKF 480 NDVPIKMEYF QTYKKNKPLT QEPEA 505
PfRH5 (PfRH5FL) sequence of amino acids E26-Q526 of the 3D7 clone P. falciparum reference sequence, with two mutations to delete N-linked glycosylation (N38Q and N214Q, shown in bold) and with an additional C-terminal AviTag™ and Strep-II® tag in tandem (SEQ ID NO: 90)
TABLE-US-00028 ENAIKKTKNQ ENQLTLLPIK STEEEKDDIK NGKDIKKEID NDKENIKTNN AKDHSTYIKS 60 YLNTNVNDGL KYLFIPSHNS FIKKYSVFNQ INDGMLLNEK NDVKNNEDYK NVDYKNVNFL 120 QYHFKELSNY NIANSIDILQ EKEGHLDFVI IPHYTFLDYY KHLSYNSIYH KSSTYGKCIA 180 VDAFIKKIQE TYDKVKSKCN DIKNDLIATI KKLEHPYDIN NKNDDSYRYD ISEEIDDKSE 240 ETDDETEEVE DSIQDTDSNH TPSNKKKNDL MNRTFKKMMD EYNTKKKKLI KCIKNHENDF 300 NKICMDMKNY GTNLFEQLSC YNNNFCNTNG IRYHYDEYIH KLILSVKSKN LNKDLSDMTN 360 ILQQSELLLT NLNKKMGSYI YIDTIKFIHK EMKHIFNRIE YHTKIINDKT KIIQDKIKLN 420 IWRTFQKDEL LKRILDMSNE YSLFITSDHL RQMLYNTFYS KEKHLNNIFH HLIYVLQMKF 480 NDVPIKMEYF QTYKKNKPLT QGSASGLNDI FEAQKIEWHE WSHPQFEK 528
PfRH5ΔNL amino acid sequence based on the 3D7 clone P. falciparum reference sequence—residues K140-K247 and N297-Q526 with two mutations to delete N-linked glycosylation sequons (T216A and T299A, each in bold) and with the addition of a C-terminal C-tag (underlined) (SEQ ID NO: 91).
TABLE-US-00029 KNVNFLQYHF KELSNYNIAN SIDILQEKEG HLDFVIIPHY TFLDYYKHLS YNSIYHKSST 60 YGKCIAVDAF IKKINEAYDK VKSKCNDIKN DLIATIKKLE HPYDINNKNR AFKKMMDEYN 120 TKKKKLIKCI KNHENDFNKI CMDMKNYGTN LFEQLSCYNN NFCNTNGIRY HYDEYIHKLI 180 LSVKSKNLNK DLSDMTNILQ QSELLLTNLN KKMGSYIYID TIKFIHKEMK HIFNRIEYHT 240 KIINDKTKII QDKIKLNIWR TFQKDELLKR ILDMSNEYSL FITSDHLRQM LYNTFYSKEK 300 HLNNIFHHLI YVLQMKFNDV PIKMEYFQTY KKNKPLTQEP EA 342
PfCyRPA based on the 3D7 clone P. falciparum sequence and comprised amino acids D29-E362 with three mutations introduced to ablate N-linked glycosylation (S147A, T324A and T340A, in bold) and also included a C-terminal CD4 tag comprising rat domains 3 and 4 (CD4d3+4) tag followed by a hexahistidine (His6) tag (SEQ ID NO: 92)
TABLE-US-00030 DSRHVFIRTE LSFIKNNVPC IRDMFFIYKR ELYNICLDDL KGEEDETHIY VQKKVKDSWI 60 TLNDLFKETD LTGRPHIFAY VDVEEIIILL CEDEEFSNRK KDMTCHRFYS NDGKEYNNAE 120 ITISDYILKD KLLSSYVSLP LKIENREYFL ICGVSPYKFK DDNKKDDILC MASHDKGETW 180 GTKIVIKYDN YKLGVQYFFL RPYISKNDLS FHFYVGDNIN NVKNVNFIEC THEKDLEFVC 240 SNRDFLKDNK VLQDVSTLND EYIVSYGNDN NFAECYIFFN NENSILIKPE KYGNTAAGCY 300 GGTFVKIDEN RALFIYSSSQ GIYNIHTIYY ANYEGAPSTS ITAYKSEGES AEFSFPLNLG 360 EESLQGELRW KAEKAPSSQS WITFSLKNQK VSVQKSTSNP KFQLSETLPL TLQIPQVSLQ 420 FAGSGNLTLT LDRGILYQEV NLVVMKVTQP DSNTLTCEVM GPTSPKMRLI LKQENQEARV 480 SRQEKVIQVQ APEAGVWQCL LSEGEEVKMD SKIQVLSKGL NSGSLHHILD AQKMLWNHRD 540 RNLPPLAPLG PHHHHHH 557
PfCyRPA based on the 3D7 clone P. falciparum sequence and comprised amino acids D29-E362 with three mutations introduced to ablate N-linked glycosylation (S147A, T324A and T340A, shown in bold) and also included a C-terminal 4-amino acid C-tag (EPEA, underlined) separated from the PfCyRPA sequence by a GGGGS linker (SEQ ID NO: 93)
TABLE-US-00031 DSRHVFIRTE LSFIKNNVPC IRDMFFIYKR ELYNICLDDL KGEEDETHIY VQKKVKDSWI 60 TLNDLFKETD LTGRPHIFAY VDVEEIIILL CEDEEFSNRK KDMTCHRFYS NDGKEYNNAE 120 ITISDYILKD KLLSSYVSLP LKIENREYFL ICGVSPYKFK DDNKKDDILC MASHDKGETW 180 GTKIVIKYDN YKLGVQYFFL RPYISKNDLS FHFYVGDNIN NVKNVNFIEC THEKDLEFVC 240 SNRDFLKDNK VLQDVSTLND EYIVSYGNDN NFAECYIFFN NENSILIKPE KYGNTAAGCY 300 GGTFVKIDEN RALFIYSSSQ GIYNIHTIYY ANYEGGGGSE PEA 343
PfP113Nt, encoding amino acids Y23-K219 of PfP113 (3D7) was expressed encoding C-terminal tags comprising CD4d3+4, a biotin acceptor peptide and a His6 tag in tandem. Mutations to deleted glycosylation are shown in bold. (SEQ ID NO: 94)
TABLE-US-00032 YVHNDVIKFG EENSLKCSQG NLYVLHCEVQ CLNGNNEIIH KRCNDDIEKK CNGNNKCIYF 60 FEYELRKKTQ SFRNKNSIEI SECVESEQNE VKTSTTCLLS NSFILDEAFI QYFFFIKNKN 120 EEPVICKDGN INIKSALLHS PFCEIKLKDI SEYIRKKCDN NKECLIDPLD VQKNLLNEED 180 PCYINNAYVS VNVVCNKGAP STSITAYKSE GESAEFSFPL NLGEESLQGE LRWKAEKAPS 240 SQSWITFSLK NQKVSVQKST SNPKFQLSET LPLTLQIPQV SLQFAGSGNL TLTLDRGILY 300 QEVNLVVMKV TQPDSNTLTC EVMGPTSPKM RLILKQENQE ARVSRQEKVI QVQAPEAGVW 360 QCLLSEGEEV KMDSKIQVLS KGLNSGSLHH ILDAQKMLWN HRDRNLPPLA PLGPHHHHHH 420
PfRH5Nt encoding amino acids F25-K140 of PfRH5 (3D7) was expressed encoding C-terminal tags comprising CD4d3+4, a biotin acceptor peptide and a His6 tag in tandem. Mutations to deleted glycosylation are shown in bold. (SEQ ID NO: 95)
TABLE-US-00033 FENAIKKTKN QENNLALLPI KSTEEEKDDI KNGKDIKKEI DNDKENIKTN NAKDHSTYIK 60 SYLNTNVNDG LKYLFIPSHN SFIKKYSVFN QINDGMLLNE KNDVKNNEDY KNVDYKGAPS 120 TSITAYKSEG ESAEFSFPLN LGEESLQGEL RWKAEKAPSS QSWITFSLKN QKVSVQKSTS 180 NPKFQLSETL PLTLQIPQVS LQFAGSGNLT LTLDRGILYQ EVNLVVMKVT QPDSNTLTCE 240 VMGPTSPKMR LILKQENQEA RVSRQEKVIQ VQAPEAGVWQ CLLSEGEEVK MDSKIQVLSK 300 GLNSGSLHHI LDAQKMLWNH RDRNLPPLAP LGPHHHHHH
The present invention will now be described with reference to the following non-limiting Examples.
EXAMPLES
Materials and Methods
Generation of Monoclonal Antibodies
Plasmablast Isolation and Sorting
[0268] Volunteers from a Phase Ia safety and immunogenicity clinical trial were bled seven days after the second immunization using MVA (modified vaccinia virus Ankara) encoding PfRH5FL. Blood was collected from volunteers in heparinized tubes and centrifuged in Leucosep tubes (Greiner Bio one) to separate the peripheral blood mononuclear cells (PBMC). The PBMC were enriched for B cells using a human pan-B cell enrichment kit (Easysep) and resuspended in DMEM before staining with a CD19.sup.+, CD10.sup.−, CD21.sup.−, CD27.sup.+, CD20.sup.−, CD38.sup.+, IgG fluorophore-conjugated antibody panel. Plasmablasts were single-cell sorted using a MoFlo cell sorter (Dako cytomation) into 96-well PCR plates containing 10 μL of 10 mM Tris HCl buffer containing 40 U/mL of RNase inhibitor (Promega). The study received ethical approval from the Oxfordshire Research Ethics Committee A in the UK (REC reference 14/SC/0120). The volunteers signed written consent forms and consent was verified before each vaccination.
Antibody Variable Gene Amplification
[0269] In each well of a 96-well plate containing a single antibody-secreting cell (ASC), a two-step RT-PCR was carried out with a first reverse transcription (RT) step using a Sensiscript RT kit (Qiagen) and degenerate primers 1-17 (see Table 1).
[0270] Next, a first PCR was performed on 1 μL of the RT reaction product using the same set of primers used before (1-17) which cover the diversity of all Vγ, Vκ and Vλ sequences using Phusion HF master mix (New England Biolabs). Following this, a nested PCR was performed using primers 18-51, also using Phusion HF master mix, (see Table 1) on 1 μL of the previous product diluted 1:100 to amplify inserts which contain plasmid-homologous extensions designed for circular polymerase extension cloning (CPEC).
TABLE-US-00034 TABLE 1 primers for antibody variable gene amplification Primer number Primer sequence (SEQ ID NO) (5′ to 3′) 1 (96) ACAGGTGCCCACTCCCAGGT GCAG 2 (97) AAGGTGTCCAGTGTGARGTG CAG 3 (98) CCCAGATGGGTCCTGTCCCA GGTGCAG 4 (99) CAAGGAGTCTGTTCCGAGGT GCAG 5 (100) GGAAGGTGTGCACGCCGCTG GTC 6 (101) ATGAGGSTCCCYGCTCAGCT GCTGG 7 (102) CTCTTCCTCCTGCTACTCTG GCTCCCAG 8 (103) ATTTCTCTGTTGCTCTGGAT CTCTG 9 (104) GTTTCTCGTAGTCTGCTTTG CTCA 10 (105) GGTCCTGGGCCCAGTCTGTG CTG 11 (106) GGTCCTGGGCCCAGTCTGCC CTG 12 (107) GCTCTGTGACCTCCTATGAG CTG 13 (108) GGTCTCTCTCSCAGCYTGTG CTG 14 (109) GTTCTTGGGCCAATTTTATG CTG 15 (110) GGTCCAATTCYCAGGCTGTG GTG 16 (111) GAGTGGATTCTCAGACTGTG GTG 17 (112) CACCAGTGTGGCCTTGTTGG CTTG 18 (113) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCCGAGG TGCAGCTGGTGCAG 19 (114) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCTGAGG TGCAGCTGGTGGAG 20 (115) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCCCAGG TGCAGCTGCAGGAG 21 (116) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCTGAGG TGCAGCTGTTGGAG 22 (117) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCCCAGG TGCAGCTACAGCAGTG 23 (118) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCCCAGG TTCAGCTGGTGCAG 24 (119) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCCCAGG TCCAGCTGGTACAG 25 (120) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCTGAAG TGCAGCTGGTGGAG 26 (121) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCCCAGG TACAGCTGCAGCAG 27 (122) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCCCAGC TGCAGCTGCAGGAG 28 (123) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCTCAGG TGCAGCTGGTGGAG 29 (124) GATGGGCCCTTGGTCGACGC TGAGGAGACGGTGACCAG 30 (125) GATGGGCCCTTGGTCGACGC TGAAGAGACGGTGACCATTG 31 (126) GATGGGCCCTTGGTCGACGC TGAGGAGACGGTGACCGTG 32 (127) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCTGACA TCCAGATGACCCAGTC 33 (128) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCAGACA TCCAGTTGACCCAGTCT 34 (129) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTGTGCCA TCCGGATGACCCAGTC 35 (130) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATGGGGATA TTGTGATGACCCAGAC 36 (131) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATGGGGATA TTGTGATGACTCAGTC 37 (132) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCAGAAA TTGTGTTGACACAGTC 38 (133) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCAGAAA TAGTGATGACGCAGTC 39 (134) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCAGAAA TTGTGTTGACGCAGTCT 40 (135) CTTTTTCTAGTAGCAACTGC AACCGGTGTACATTCGGACA TCGTGATGACCCAGTC 41 (136) ATGGTGCAGCCACCGTACGT TTGATYTCCACCTTGGTC 42 (137) ATGGTGCAGCCACCGTACGT TTGATATCCACTTTGGTC 43 (138) ATGGTGCAGCCACCGTACGT TTAATCTCCAGTCGTGTC 44 (139) ATGGTGCAGCCACCGTACGT CTGATTTCCACCTTGGTC 45 (140) CTTTTTCTAGTAGCAACTGC AACCGGTTCCTGGGCCCAGT CTGTGCTGACKCAG 46 (141) CTTTTTCTAGTAGCAACTGC AACCGGTTCCTGGGCCCAGT CTGCCCTGACTCAG 47 (142) CTTTTTCTAGTAGCAACTGC AACCGGTTCTGTGACCTCCT ATGAGCTGACWCAG 48 (143) CTTTTTCTAGTAGCAACTGC AACCGGTTCTCTCTCSCAGC YTGTGCTGACTCA 49 (144) CTTTTTCTAGTAGCAACTGC AACCGGTTCTTGGGCCAATT TTATGCTGACTCAG 50 (145) CTTTTTCTAGTAGCAACTGC AACCGGTTCCAATTCYCAGR CTGTGGTGACYCAG 51 (146) GGCTTGAAGCTCCTCACTCG AGGGYGGGAACAGAGTG
Cloning
[0271] The AbVec-hIgG1/AbVec-hIgKappa/AbVec-hIgLambda expression plasmids were a kind gift from Patrick C. Wilson (University of Chicago). These plasmids were 5′ digested using BshTI and at the 3′ using SalI (AbVec-hIgG1), XhoI (AbVec-hIgLambda) and Pfl23II (AbVec-hIgKappa) to yield linear products. CPEC assembly was done by mixing 100 ng of a 1:1 molar ratio of insert:plasmid in 20 μL containing 1× Phusion HF polymerase master mix and assembled using an 8-cycle CPEC protocol (8 cycles: 98° C. 10 s, slow ramp anneal 70° C. 55° C. at 0.1° C./s, 72° C. 35 s). Full nicked plasmids were subsequently transformed into Zymo 5a Mix & go competent Escherichia coli (Zymo Research) according to manufacturer's instructions, streaked on LB agar petri dishes containing 100 μg/mL carbenicillin and grown at 37° C. overnight in a static incubator. Colonies were screened by PCR for inserts of the correct size.
Screening
[0272] Exponential growth-phase adherent HEK293 cells were resuspended in DMEM (Sigma-Aldrich) supplemented with 2 mM L-glutamine, 1 mM sodium pyruvate, 100 U/mL penicillin, 0.1 mg/mL streptomycin and 10% ultra-low IgG foetal bovine serum (FBS) (all from Thermo Fischer Scientific) and seeded at 4×10.sup.4 cells/well in 100 μL 24 h prior to transfection in Costar 96-well cell culture plates (Corning). On the day of transfection, for each well, 50 μL of 60 μg/mL linear 25 kDa PEI (Alfa Aesar) was mixed with 200 ng of cognate heavy- and light-chain coding plasmid in a volume of 50 μL and shaken at 20° C. for 30 min. The DNA-PEI complexes were then added to the HEK293 cells. The next day, an additional 50 μL of supplemented DMEM (as described above) was added to each well. Supernatants were screened for PfRH5FL binding by indirect ELISA as described in the ELISA methods section.
Recombinant Protein Constructs, Expression and Purification
[0273] The recombinant PfRH5 sequence used in all experiments except for those involving BLI (
[0274] The recombinant PfRH5 sequence (also named “PfRH5FL” for simplicity) used in BLI experiments (
[0275] The recombinant PfRH5ΔNL sequence used was based on the 3D7 clone P. falciparum reference sequence and encoded amino acids K140-K247 and N297-Q526 with two mutations to delete N-linked glycosylation sequons (T216A and T299A) and with the addition of a C-terminal C-tag (SEQ ID NO: 91). PfRH5ΔNL was expressed as secreted protein from stably-transfected polyclonal Drosophila S2 cells. Its purification is detailed in the X-ray crystallography experimental procedures section.
[0276] The expression construct used for monomeric PfCyRPA production in
[0277] PfP113Nt, encoding amino acids Y23-K219 of PfP113 (3D7) (SEQ ID NO: 94) and PfRH5Nt encoding amino acids F25-K140 of PfRH5 (3D7) (SEQ ID NO: 95), were expressed encoding C-terminal tags comprising CD4d3+4, a biotin acceptor peptide and a His6 tag in tandem.
[0278] Recombinant monoclonal antibodies were transiently expressed in HEK293F cells using the Expi293™ Expression System (Thermo Fischer Scientific) according to the manufacturer's recommendations. Cognate heavy and light chain-coding plasmids were co-transfected at a 1:1 ratio. Supernatants were harvested by centrifuging the culture at 2500×g for 15 min and filtering the supernatant with a 0.22 μm vacuum filter. All mAbs were purified using a 5 mL Protein G HP column (GE Healthcare) on an ÄKTA start FPLC system or an AKTA Pure FPLC system (both GE Healthcare). Equilibration and wash steps were performed with Dulbecco's PBS and mAbs were eluted in 0.1 M glycine pH 2.7. The eluates were pH equilibrated to 7.4 using 1.0 M Tris HCl pH 9.0 and immediately buffer-exchanged into Dulbecco's PBS and concentrated using an Amicon® ultra centrifugal concentrator (Millipore) with a molecular weight cut-off of 30 kDa.
[0279] IgG from serum in
X-Ray Crystallography
Complex Preparation
[0280] PfRH5ΔNL was purified from Drosophila S2 culture supernatant using C-tag affinity chromatography and glycosylated contaminants were removed by a subsequent lectin chromatography step with a HiTrap ConA 4B column (GE Healthcare). Disordered regions were trimmed by an overnight incubation at 20° C. with endoproteinase gluC (New England Biolabs) at a final concentration of 1 μg/mL. Fab fragments were generated by papain digestion using a Pierce™ Fab Preparation Kit (Thermo Fischer Scientific) following the manufacturer's recommendations. Complexes were prepared by mixing each Fab fragment with PfRH5ΔNL at a 1:1 molar ratio and were methylated with 1 M ABC (Borane dimethylamine complex) and 1 M formaldehyde (both Sigma-Aldrich) (Walter et al., 2006). The methylated complexes were subjected to SEC on a HiLoad 16/60 Superdex 200 pg column (GE Healthcare) at 4° C. in 20 mM Tris pH 7.4, 150 mM NaCl. The complex-containing fractions were pooled and concentrated using an Amicon® ultra centrifugal concentrator (Millipore) with a molecular weight cut-off of 30 kDa.
Crystallisation, Data Collection and Processing
[0281] Crystallization was achieved using vapour diffusion in sitting drops. Crystals were obtained for the Fab fragments of mAbs R5.004, R5.011 and R5.016 alone, as well as for complexes consisting of PfRH5ΔNER5.004:R5.016 and PfRH5ΔNL:R5.011:R5.016. In each case, a TTP Labtech Mosquito LCP robot was employed to mix 100 nL of each protein complex at a concentration of 10 mg/mL with 100 nL of well solutions from commercially available crystal screens.
[0282] Crystals of R5.004 Fab fragments were obtained in the JCSG-plus crystallization screen (Molecular Dimensions) and were optimized with a final well solution of 0.2 M lithium sulfate, 0.1 M NaAc pH 4.5, 30% PEG 8000 and 0.33% hexamminecobalt(III) chloride, 0.06 M MES monohydrate, 0.06 PIPES, 0.02 M HEPES chloride. They were cryo-protected by transfer into well solution supplemented with 25% glycerol, then cryo-cooled by plunging into liquid nitrogen. Data were collected on beamline 1-03 at Diamond Light Source (Harwell, UK), leading to a complete data set at a resolution of 1.7 Å.
[0283] Crystals of R5.016 Fab fragments were obtained in the JCSG-plus crystallization screen (Molecular Dimensions), with a final well solution of 0.2 M lithium sulfate, 0.1 M NaAc pH 4.5, 50% PEG 400. Crystals were cryo-cooled directly in the well solution by plunging into liquid nitrogen. Data were collected on beamline 104-1 at Diamond Light Source (Harwell, UK), leading to a complete data set at a resolution of 2.1 Å.
[0284] Crystals of R5.011 Fab fragments were obtained in the JCSG-IV crystallization screen (Qiagen), with a final well solution of 0.16 M ZnAc, 0.108 M Na cacodylate pH 6.5, 14.4% PEG 8000, 20% glycerol. They were cryo-protected by transfer into well solution supplemented with 25% glycerol, then cryo-cooled by plunging into liquid nitrogen. Data were collected on beamline PROXIMA-1 at SOLEIL (Saint-Aubin, France), leading to a complete data set at a resolution of 2.3 Å.
[0285] Crystals of the PfRH5ΔNL:R5.004:R5.016 complex were obtained in the JCSG-plus crystallization screen (Molecular Dimensions), with a final well solution of 0.15 M DL malic acid, 20% PEG 3350. They were cryo-protected by transfer into well solution supplemented with 25% glycerol, then cryo-cooled by plunging into liquid nitrogen. Data were collected on beamline 104 at Diamond Light Source (Harwell, UK), leading to a complete data set at a resolution of 4.0 Å.
[0286] Crystals of the PfRH5ΔNL:R5.011:R5.016 complex were obtained in the Morpheus crystallization screen (Molecular Dimensions), with a final well solution of 10% PEG 20000, 20% PEG 550MME, 0.02 M amino acids, 0.1 M MES/imidazole pH 6.5. Crystals were cryo-cooled directly in the well solution by plunging into liquid nitrogen. Data were collected on beamline ID23 at the European Synchrotron Radiation Facility (Grenoble, France), leading to a complete data set at a resolution of 3.6 Å.
[0287] In each case, data reduction was performed using XDS. Molecular replacement solutions were found for each individual Fab fragment, using PHASER with the most closely related Fab fragment structure in the PDB, split into their constant and variable domains, as search models (4KQ3 for R5.004, 4HK0 for R5.011 and 5K90 for R5.016). This led to a cycle of model building and refinement using COOT and BUSTER. For R5.004, this resulted in a complete model for the Fab fragment. For R5.011, this resulted in a complete model for the Fab fragment, with the exception of residues 143-148 in the heavy chain, which were disordered in the electron density map. For R5.016, this resulted in a complete model for the Fab fragment, with the exception of residues 103-108 in the heavy chain and 1-7, 25-29 and 55-58 in the light chain, all of which were disordered in the electron density map.
[0288] The structure of the PfRH5ΔNL:R5.011:R5.016 complex was obtained to 3.6 Å resolution using PHASER with the structure of PfRH5ΔNL (PDB code: 4U0R) and those of Fab fragments obtained above, split into their constant and variable domains, as search models. All domains were well resolved, although significant changes in conformation were observed in CDR H3 of both R5.011 and R5.016, as a result of PfRH5ΔNL binding. COOT and BUSTER were used for refinement, including application of restraints that derived from the higher resolution structures of PfRH5ΔNL and the shared regions of the Fab fragments. This allowed the production of a final model in which all of the Fab fragment domains, and all of the CDR loops, were clearly resolved.
[0289] The structure of the PfRH5ΔNL:R5.004:R5.016 complex was obtained at 4 Å resolution, using PHASER. The structure of PfRH5ΔNL bound to the variable domain of R5.016, obtained from the structure of the PfRH5ΔNL:R5.011:R5.016 complex, and the structure of the variable domain of R5.004 obtained above, were used as search models in PHASER. No significant changes were observed in the CDR loops of the Fab fragment of R5.004. Placement of the constant domains of R5.016 and R5.004 was challenging, due to anisotropy resulting from disorder within the crystal. These domains were therefore placed using real space docking after refinement in BUSTER of a structure consisting of PfRH5ΔNL and the variable domains of R5.004 and R5.016. This gave unambiguous electron density for the regions of the constant domains which lie close to the contact with the variable domains, but, after refinement, electron density is still absent for the PfRH5ΔNL-distal parts of the constant domains. Refinement in COOT and BUSTER allowed the production of a final model in which the Fab fragment domains, and all of the CDR loops, were clearly resolved.
Humanized Mouse Passive Transfer
[0290] P. falciparum Sporozoite Production and Mouse Infection
[0291] The luciferase expressing strain P. falciparum NF54HT-GFP-luc was maintained in RPMI 1640 supplemented with 25 mM HEPES, 2 mM L-glutamine, 50 μM hypoxanthine, 10% human serum and sub-cultured in 5% O+ human erythrocytes. Briefly, asexual cultures were inoculated at 1 parasitemia with no further sub-culturing and daily media changes to induce gametocytogenesis. Mature gametocytes were fed to 4-day old Anopheles stephensi mosquitoes to initiate infection. Mosquitoes were incubated at 27° C. and 75% humidity for 14 d and given 8% dextrose+PABA to foster parasite growth. Liver humanized FRGN KO mice were purchased from Yecuris Corp. and showed human hepatocyte repopulation levels above 70% determined by human serum albumin levels. Liver humanized mice were cycled on NTBC once a month for 3 d at 8 μg/mL in the drinking water to maintain health. Animals did not receive NTBC three weeks prior to and during the infection study. For mosquito bite infection, 3-5 liver humanized FRGN mice were anesthetised and placed on top of a mosquito cage containing 150-250 infected mosquitoes for 20 min.
P. falciparum Liver-to-Blood Stage Transition
[0292] On the day of challenge, liver humanized FRGN mice were injected both in the retro-orbital plexus and the peritoneal cavity with 50 μL clodronate-containing liposomes (Clophosome®-A), 100 mg/kg cyclophosphamide (Sigma-Aldrich). Five days after challenge, the animals were bled a volume of approximately 200 μL, and 500 μL hRBC was injected in the retro-orbital plexus (70% O+ human erythrocytes in RPMI 1640 supplemented with 25 mM HEPES, 2 mM L-glutamine, 50 μM hypoxanthine and 10% human serum). The next day, mice were bled 200 μL and received an intraperitoneal injection of 700 μL hRBC. mAb transfer was done on day 6 to precede the establishment of blood-stage infection. Dosage was 15 mg total rabbit IgG per mouse formulated in PBS and delivered intravenously. The clodronate liposome and cyclophosphamide injections were repeated on days 5, 9, 11, 13. Human RBC were injected daily in a volume of 300-700 μL to keep the percentage of hRBC stable around 50-60%. If the percentage reached more than 70%, the mice were not injected with hRBC to limit morbidity. On days 9, 11 and 13 each mouse was bled from the retro-orbital plexus to sample antibody levels.
Quantification of Parasite Burden
[0293] Luciferase activity was measured in the mice using the IVIS Lumina II animal imager (Perkin Elmer). The abdomen of mice was shaved to enhance detection. Mice were injected intraperitoneally with 100 μL of luciferase substrate RediJect D-Luciferin (Perkin Elmer) to quantitate specific enzymatic activity. Animals were anesthetized and imaged within 5 min of substrate injection. Signal was acquired for 5 min using a field of view of 10 cm and medium binning factor. Living Image 3.0 software was used to measure total flux (photons/second) of a region of interest, which was placed around each mouse.
[0294] This study was carried out in accordance with the recommendations of the NIH Office of Laboratory Animal Welfare standards (OLAW welfare assurance #A3640-01). The protocol was approved by the Center for Infectious Disease Research Institutional Animal Care and Use Committee (IACUC) under protocol SK-16.
PfCyRPA/PfP113/BSG SPR Blocking Assays
[0295] Data were collected on a Biacore X100 (GE Healthcare). All data used were reference subtracted from a non-immobilized flow cell (Fc 2-1). Binding values were measured manually in the Biacore X100 control software.
PfRH5-Basigin Binding
[0296] Experiments were performed at 25° C. in SPR running buffer (PBS+0.05% Polysorbate-20, GE Healthcare). Approximately 670 RU of basigin was amine-coupled to a CMS chip (GE Healthcare) on flow cell 2 (Fc 2) using standard NHS/EDC chemistry. PfRH5FL-mAb complexes were made by mixing PfRH5FL and mAb to a final concentration of 0.5 μM PfRH5FL and 1 μM mAb in SPR running buffer. Complexes were injected over Fc 1 and Fc 2 at a flow rate of 10 μL/min for 30 s and the surface was regenerated with 10 mM glycine pH 1.5 for at a flow rate of 10 μL/min for 60 s. Between experiments, one injection of 0.5 μM PfRH5FL was made to assess basigin degradation caused by regeneration.
PfRH5-PfCyRPA Binding
[0297] Experiments were performed at 25° C. in SPR running buffer (PBS+0.05% Polysorbate-20, GE Healthcare) using a sensor chip protein A (GE Healthcare). mAb was injected at a concentration of 20 nM at a flow rate of 5 μL/min for 35 s over Fc 2 on a protein A coated chip (GE Healthcare). Next, PfRH5FL was injected over Fc 1 and Fc 2 at a concentration of 50 nM at a flow rate of 10 μL/min for 120 s before injecting PfCyRPA at a concentration of 1 μM for 120 s, also at a flow rate of 10 μL/min. The chip surface was regenerated with 10 mM glycine pH 1.5 for at a flow rate of 10 μL/min for 60 s.
PfRH5-PfP113 Binding
[0298] Experiments were performed at 37° C. in SPR running buffer (PBS+0.05% Polysorbate-20, GE Healthcare) using a Sensor chip CAP (GE Healthcare). The whole experiment was run at a flow rate of 5 μL/min. Approximately 1500 RU of CAP reagent (GE Healthcare) was captured on Fc 1 and Fc 2. On Fc 1, approximately 500 RU of a biotinylated control CD4d3+4-tagged protein was immobilized. On Fc 2, each experiment consisted of capturing 1500 RU of CAP reagent in an 80 s injection followed by approximately 1800 RU of PfP113Nt in an 80 s injection at a concentration of 20 μg/mL. After this, PfRH5FL-mAb complex (both at 1 μM) was flowed over Fc 1 and Fc 2. Flow cell 2 was regenerated between experiments in a 110 s injection of 6 M guanidine+250 mM NaOH, as per the manufacturer's instructions.
Bio-Layer Interferometry (BLI)
[0299] All BLI was carried out on an OctetRED384 (Pall ForteBio) using streptavidin-coated biosensors (Pall ForteBio) to immobilize PfRH5FL enzymatically monobiotinylated on a C-terminal AviTag™. Assays were carried out in 96-well format in black plates (Greiner). For assaying mAb binding to PfRH5FL variants (
ELISA
[0300] Qualitative mAb binding ELISAs such as those used in
[0301] Peptide ELISAs were carried out with a set of sixty-two custom-synthesized biotinylated 20-mer peptides of PfRH5 overlapping by 12 amino acids (Mimotopes). The list of peptide sequences was described previously by Payne et al., 2017 and can be found in supplementary table 4. Briefly, the peptides were designed to be oriented and tethered by their N-terminal biotinylated linker peptide (biotin-SGSG) with the exception the first peptide which contained the biotinylated linker at its C-terminus to preserve potential binding activity to the most N-terminal residues. These peptides were coated to the bottom wells of a streptavidin-coated 96-well plate in 50 4. The next day wells were blocked with 200 μL of Blocker™ Casein (Thermo Fisher) and washed five times with PBS-Tween 20. Bound mAbs were detected using an anti-human gamma-chain-specific alkaline phosphatase-conjugated secondary antibody (Sigma-Aldrich) or the mouse equivalent for QA1 in 504 for 30 min at a dilution of 1:1000 in PBS and washed six times with PBS-Tween 20 before being developed with 100 μL of PNPP alkaline phosphatase substrate for 20 min and read at 405 nm. To determine total PfRH5FL-specific IgG as in
Animal Vaccination Immunization Regimes
[0302] In
Affinity Determination by SPR
[0303] Data were collected on a Biacore X100 (GE Healthcare). Experiments were performed at 25° C. in Dulbecco's PBS+0.05% Polysorbate-20 (GE Healthcare). A sensor chip protein A (GE Healthcare) was used to capture 50-100 RU of purified mAb diluted in SPR running buffer at a flow rate of 5 μL/min. Next, an appropriate range (typically 20 nM-0.625 nM) of six 2-fold dilutions with one replicate of PfRH5FL was injected for 90 s at 60 μL/min and dissociation was measured for 1600 s (7200 s when necessary). The PfRH5FL analyte was >95% pure as assessed by SDS-PAGE. Specific binding of the PfRH5FL protein to mAb was obtained by reference-subtracting the response of a blank surface from that of the mAb-coated surface. The sensor surface was regenerated with a 60 s pulse of 10 mM glycine-HCl pH 1.5 (GE Healthcare). Sensorgrams were fitted to a global Langmuir 1:1 interaction model, allowing determination of the kinetic association and dissociation rate constants using Biacore X100 evaluation software.
AVEXIS Blocking Assay
[0304] All AVEXIS assays were conducted at the Wellcome Trust Sanger Institute, Cambridge, UK. Biotinylated monomeric bait protein was captured on streptavidin-coated flat-bottomed 96-well microtiter plates in 50 μL volumes for 1 h at 20° C. Plates were then washed 3 times with PBS and incubated with 50 μL of human PfRH5-specific mAb for 1 h at 20° C. The plates were washed 3 more times in PBS before the addition of 50 μL of pentameric β-lactamase-tagged prey proteins for a further 1 h at 20° C. All wells were subsequently washed twice with PBS-Tween 20 and then twice with PBS before the addition of 150 μL/well of the β-lactamase substrate nitrocefin. Absorbance readings were made at 485 nm. The protein constructs were all full-length ectodomains with threonine to alanine mutations to remove N-linked glycosylation sequons (except for basigin) as previously reported (Crosnier et al., 2011; Galaway et al., 2017): PfRH5 amino acids F25-Q526; PfCyRPA amino acids D29-E362; PfP113 amino acids Y23-K942; and basigin isoform 2 amino acids M1-A23 followed by G140-L322. All bait and prey proteins were expressed as fusion proteins N-terminal of a CD4d3+4 tag, a biotin acceptor peptide and a His6 tag. Prey proteins were expressed with a C-terminal with a collagen oligomeric matrix protein (COMP) peptide to promote pentamerization and a β-lactamase enzyme for quantification purposes.
Assay of GIA
[0305] All mAb GIA assays in
Dot Blot
[0306] Briefly, 1.5 4 of anti-PfRH5 mAb, a human anti-Zaire Ebolavirus GP IgG1 mAb, recombinant PfRH5FL (all at 1 mg/mL) and PBS were spotted onto 0.2 μm nitrocellulose membrane and air-dried for 10 min. Afterwards, the membrane was blocked in 3% BSA+3% skimmed milk in PBS for 1 h and washed in PBS. It was then immersed in P. falciparum 3D7 culture supernatant for 1 h and washed again in PBS. Bound PfRH5FL was detected by incubating the membrane in PfRH5FL-immunized rabbit serum diluted 2000-fold in PBS followed by an alkaline phosphatase-conjugated anti-rabbit IgG mAb (clone RG-96, Sigma-Aldrich) also diluted 1:2000, separated by two wash steps in PBS. After a final series of five PBS washes, the dot blot was developed with Sigmafast BCIP/NBT alkaline phosphatase substrate at 1 mg/mL (Sigma-Aldrich).
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)
[0307] HDX-MS was performed using a Waters HDX platform composed of a liquid handling robotic setup (LEAP technologies) for sample preparation and a nano-Acquity UPLC coupled to a Synapt G2-Si (Waters) mass spectrometer. Samples were prepared by 11-fold dilutions from 7 μM of apo PfRH5FL or PfRH5FL-mAb complex in deuterated or non-deuterated 20 mM HEPES, 150 mM NaCl pH 7.4 buffer. The pH of the sample was brought down to 2.3 by adding 50% vol/vol 150 mM HCl. Non-deuterated and deuterated samples were loaded by the robot. The apo PfRH5FL protein or PfRH5FL-mAb complex was digested in-line using a pepsin-immobilized column at 20° C. The peptides generated from pepsin digestion were trapped on a micro peptide trap for 2 min for the removal of salts at a flow rate of 200 μL/min and then separated using a C18 column with a linear gradient of 5-80% acetonitrile (CH.sub.3CN) and water both supplemented with 0.1% formic acid for 12 min at flow rate of 40 μL/min. The liquid chromatography temperature was set at 0° C. to reduce back-exchange. Sequence coverage and deuterium uptake were analysed by using ProteinLynx Global Server (Waters) and DynamX (Waters) programmes, respectively. Peptide mapping was obtained by using nondeuterated samples in triplicates and only unique peptides present in all three data files were selected for deuterium uptake data analysis. Leucine enkephalin at a continuous flow rate of 5 μL/min was sprayed as a lock mass for mass correction. Apo PfRH5FL protein digests provided a list of 2056 peptides, after applying several selection filters and manual inspection only 127 peptides were selected for analysis. These peptides provided >93% sequence coverage with many overlapping peptides. The samples were labelled for 20 s, 10 min and 2 h. All HDX-MS experiments were performed in duplicate.
Statistical Analyses
[0308] Data were analysed using GraphPad Prism version 6.07 for Windows (GraphPad Software Inc.). All tests used were described in the figure legends. In
Example 1—Vaccine-Induced Human mAbs to PfRH5
[0309] Anti-PfRH5 mAbs were isolated from single-cell sorted plasmablasts of immunized volunteers enrolled in a first-in-human Phase Ia clinical trial of a PfRH5-based vaccine delivered using recombinant chimpanzee adenovirus and poxvirus viral-vectors (see Table 2).
TABLE-US-00035 TABLE 2 Vaccination details of the three volunteers from which anti-PfRH5FL mAbs were isolated. VAC057 ChAd63 PfRH5FL MVA PfRH5FL Volunteer # Trial Group Time-point Prime Dose (vp) Boost Dose (pfu) 1017 2C Day 63 (7 days 5 × 10.sup.10 2 × 10.sup.8 post-boost) 1019 2B Day 63 (7 days 5 × 10.sup.10 1 × 10.sup.8 post-boost) 2207 2C Day 63 (7 days 5 × 10.sup.10 2 × 10.sup.8 post-boost)
[0310] Variable region (VR)-coding genes were isolated by RT-PCR and PCR and cloned into a human IgG1 scaffold. Cognate heavy-chain and light-chain plasmids were co-transfected in HEK293 cells and PfRH5-specificity was confirmed by supernatant reactivity to full-length PfRH5 protein comprising amino acids E26-Q526 (PfRH5FL) by ELISA. Seventeen genetically distinct mAbs were isolated (
TABLE-US-00036 TABLE 3 These affinities were generally in the low nanomolar to high picomolar range. K.sub.on K.sub.off K.sub.D mAb (M.sup.−1s.sup.−1) (s.sup.−1) (M) R5.001 1.02E+06 1.65E−03 1.62E−09 R5.002 3.86E+05 4.91E−03 1.27E−08 R5.003 1.70E+06 1.86E−03 1.09E−09 R5.004 1.71E+06 1.09E−03 6.36E−10 R5.006 6.77E+05 2.34E−04 3.46E−10 R5.007 3.78E+05 3.26E−04 8.63E−10 R5.008 7.22E+05 6.39E−04 8.86E−10 R5.009 5.12E+05 2.72E−04 5.31E−10 R5.010 7.83E+05 3.63E−04 4.63E−10 R5.011 1.61E+06 1.67E−05 1.03E−11 R5.013 7.73E+05 6.02E−05 7.79E−11 R5.014 3.15E+06 <2.91E−06 <9.21E−13 R5.015 6.29E+05 4.23E−05 6.73E−11 R5.016 1.14E+06 4.88E−04 4.28E−10 R5.017 1.44E+06 2.91E−04 2.01E−10 R5.018 4.25E+05 6.71E−06 1.58E−11 R5.019 3.07E+06 4.72E−04 1.54E−10 c2AC7 5.16E+06 1.62E−04 3.14E−11 c4BA7 5.89E+05 2.55E−05 4.33E−11 c9AD4 3.63E+06 5.04E−04 1.39E−10 QA1 2.95E+05 7.27E−04 2.46E−09
Table 3: List of anti-PfRH5 mAb binding properties, related to
[0311] The effect of PfRH5 polymorphism on mAb recognition was determined by measuring binding to recombinant PfRH5FL variants, each carrying one of the five most common amino acid substitutions (
Example 2—the Neutralizing Capacity of Human mAbs Binding PfRH5
[0312] To characterize the ability of the human mAbs to block merozoite entry into the RBC, they were all tested for in vitro GIA against 3D7 clone P. falciparum. An initial screen was carried out at high concentration to broadly determine which mAbs are capable of neutralization (
Example 3—all Major Neutralizing PfRH5 Epitopes are Contained in Truncated PfRH5ΔNL Protein
[0313] Previous crystallization of PfRH5 protein was aided by removal of two sections of disordered sequence resulting in a truncation lacking 188 of 526 residues (M1-Y139 and N248-M296), termed PfRH5ΔNL. Notably this truncated protein lacks the N-terminal region of PfRH5 (PfRH5Nt), including amino acids K33-K51 previously reported to be the minimal PfP113 binding region and thus a potential site for antibody-mediated neutralization.
[0314] Interestingly, all of the GIA-high mAbs and two of three GIA-low mAbs bound PfRH5ΔNL, suggesting that this construct contains the major neutralizing epitopes (
[0315] To investigate this further, the effect of PfRH5FL or PfRH5ΔNL proteins on the GIA of total polyclonal IgG purified from sera of PfRH5FL-immunized human vaccines was assessed. The in vitro GIA could be reversed by adding 0.5 μM of recombinant PfRH5FL or PfRH5ΔNL into the IgG sample. In samples from all seven vaccinated volunteers, the GIA of their IgG was completely reversed following the addition of either PfRH5 variant protein (
[0316] To confirm that PfRH5ΔNL vaccination is also capable of eliciting antibody to the most functionally relevant neutralizing epitopes present in PfRH5FL, two groups of rabbits were immunized with equimolar doses of PfRH5FL or PfRH5ΔNL. The resulting purified IgG showed comparable potency in the GIA assay across both groups, indicating that no major neutralizing epitopes are lost in PfRH5ΔNL (
Example 3—Clustering of PfRH5-Specific mAbs into Functional Groups
[0317] In an effort to better understand the relationship between mAb binding site and function, all mAbs were tested in pairs for their ability to bind simultaneously to monobiotinylated PfRH5FL by BLI (data not shown). This defined seven distinct epitope bins, with each bin containing mAbs that bind overlapping epitopes (
Example 4—Identifying the Epitopes for Key Neutralizing mAbs
[0318] The binding modes of R5.016 (also referred to as mAb16) and R5.004 (also referred to as mAb4), the two most potent known human anti-PfRH5 nAbs, were next determined by X-ray crystallography. The structure of a co-crystal containing PfRH5ΔNL, one R5.016 Fab fragment and one R5.004 Fab fragment diffracted to a resolution of 4.0 Å (
[0319] Superimposition of the R5.004 and R5.016 Fab structures on the structure of PfRH5ΔNL-BSG (PDB entry 4U0Q) reveals major overlap between the BSG binding site and R5.004 (
TABLE-US-00037 TABLE 4 Crystallographic data collection and refinement statistics of Fab fragments and complexes, related to FIGS. 5 and 7 R5.004 Fab R5.011 Fab R5.016 Fab PfRH5ΔNL:R5.004:R5.016 PfRH5ΔNL:R5.011:R5.016 Data collection Space P1 P2.sub.12.sub.12.sub.1 P4.sub.12.sub.12 C 1 2 1 P2.sub.12.sub.12.sub.1 group Cell dimensions a, b, c 55.21, 70.18, 47.86, 86.38, 80.08, 80.08, 235.15, 58.78, 140.99, 150.99, (Å) 73.26 127.4 162.69 116.79 163.97 α, β, γ 101.42, 92.97, 90.0, 90.0, 90.0, 90.0, 90.0, 106.41, 90.0, 90.0, (°) 112.47 90.0 90.0 90.0 90.0 Wavelength 0.9999 0.9786 0.92819 0.9795 0.9763 (Å) Resolution 42.45-1.66 (1.69-1.66) 47.86-2.28 (2.36-2.28) 15.24-2.10 (2.14-2.10) 46.92-4.01 (4.07-4.01) 49.16-3.58 (3.73-3.58) (Å) Total 389497 (18845) 316738 (27746) 39702 (1666) 42257 (1687) 281346 (41777) observations Total unique 111530 (5493) 24770 (2284) 31807 (1564) 13131 (522) 30867 (4579) R.sub.pim 3.9 (83.9) 7.0 (35.2) 2.9 (55.5) 8.1 (50.8) 13.6 (51.4) R.sub.merge (%) 6.2 (131.1) 17.1 (86.3) 10.0 (173.1) 12.3 (78.1) 30.3 (114.6) R.sub.meas (%) 7.3 (156.3) 18.5 (90.6) 10.5 (182.5) 14.8 (93.4) 35.8 (135.0) CC.sub.1/2 (%) 99.7 (49.9) 99.5 (85.3) 99.9 (53.6) 98.8 (64.1) 99.1 (86.3) I/s(I) 8.6 (1.0) 11.0 (3.5) 16.4 (1.3) 5.9 (1.4) 4.7 (1.6) Com- 95.7 (94.5) 99.3 (92.7) 100 (100) 99.0 (80.7) 99.7 (98.4) pleteness (%) Multiplicity 3.5 (3.4) 12.8 (12.1) 12.5 (10.7) 3.2 (3.2) 6.7 (6.7) Refinement Reflections 111570 23457 31616 13016 41714 R.sub.work/R.sub.free 18.3/20.4 18.6/22.7 20.4/22.3 32.6/37.7 27.4/31.0 Number of residues Protein 872 431 413 1175 2343 Water 833 238 203 0 0 Ligands 7 2 3 0 0 R.m.s deviations Bond lengths 0.01 0.01 0.01 0.01 0.01 (Å) Band angles 1.09 1.23 1.11 1.19 1.2 (°) Ram- achandran plot Favored (%) 97.8 96.7 97.3 92.9 93.6 Allowed (%) 2.2 3.3 2.7 7.1 6.4 Outliers (%) 0 0 0 0 0
TABLE-US-00038 TABLE 5 Proposed interactions between R5.004 and PfRH5 and between R5.016 and PfRH5, related to FIG. 5 R5.004 PfRH5 FWR/CDR region Residue (chain) Group Structural element Residue (chain) Group Interaction type CDR H1 Asn 31 (B) Side chain Helix 4 His 365 (A) Side chain Hydrogen CDR H1 Asn 31 (B) Side chain Helix 4 Asp 361 (A) Side chain Hydrogen CDR H2 Ile 52 (B) Side chain ⅚ loop Trp 447 (A) Side chain Hydrophobic CDR H2 Phe 55 (B) Side chain Helix 5 Lys 443 (A) Side chain Hydrophobic CDR H2 Thr 57 (B) Side chain Helix 5 Lys 443 (A) Side chain Hydrogen CDR H3 Asp 99 (B) Side chain Helix 4 Arg 357 (A) Side chain Hydrogen CDR H3 His 101 (B) Side chain Helix 4 Glu 362 (A) Side chain Hydrogen CDR H3 Tyr 105 (B) Side chain Helix 4 Asp 361 (A) Side chain Hydrogen CDR L1 Ser 31 (C) Side chain ½ loop Lys 196 (A) Side chain Hydrogen CDR L1 Ser 31 (C) Main chain ½ loop Ser 197 (A) Side chain Hydrogen CDR L3 Trp 92 (C) Side chain ¾ loop Asn 352 (A) Side chain Hydrogen CDR L3 Asp 94 (C) Side chain ¾ loop Asn 347 (A) Side chain Hydrogen CDR L3 Asn 97 (C) Side chain ⅚ loop Trp 447 (A) Main chain Hydrogen CDR L3 Asn 97 (C) Side chain ⅚ loop Arg 448 (A) Main chain Hydrogen R5.016 PfRH5 FWR/CDR region Residue (chain) Group Structural element Residue (chain) Group Interaction type CDR H1 Thr 28 (E) Side chain Helix 2 Lys 211 (A) Side chain Hydrogen CDR H1 Ser 31 (E) Side chain Helix 2 Asp 207 (A) Side chain Hydrogen CDR H1 Tyr 32 (E) Side chain Helix 2 Ala 208 (A) Main chain Hydrogen CDR H2 Tyr 54 (E) Side chain Helix 2 Ile 204 (A) Side chain Hydrophobic Heavy chain FWR3 Arg 98 (E) Side chain Helix 2 Glu 215 (A) Side chain Hydrogen CDR H3 Pro 101 (E) Side chain Helix 2 Ile 204 (A) Side chain Hydrophobic CDR H3 Gln 102 (E) Side chain Helix 2 Gly 201 (A) Main chain Hydrogen CDR H3 Asp 105 (E) Side chain Helix 2 Lys 202 (A) Side chain Hydrogen CDR H3 Tyr 111 (E) Side chain Helix 2 Lys 202 (A) Side chain Hydrophobic CDR H3 Tyr 111 (E) Main chain Helix 3 Tyr 335 (A) Side chain Hydrogen CDR H3 Tyr 113 (E) Side chain Helix 3 Asp 331 (A) Side chain Hydrogen CDR H3 Tyr 113 (E) Side chain Helix 2 Phe 209 (A) Side chain Hydrophobic CDR H3 Asp 117 (E) Side chain Helix 2 Lys 212 (A) Side chain Hydrogen CDR L2 Leu 54 (D) Main Chain Helix 3 Lys 327 (A) Side chain Hydrogen CDR L2 Glu 55 (D) Side chain Helix 2 Lys 212 (A) Side chain Hydrogen CDR L2 Ser 56 (D) Side chain Helix 2 Lys 219 (A) Side chain Hydrogen
structure, one overlaps with R5.016 while one does not. This suggests that, while simultaneous binding is possible, the proximity of R5.016 to the BSG binding site is likely to lead to steric occlusion in the context of an intact IgG antibody and membrane attachment of both components. In comparison to previously studied murine mAbs, R5.016 shares much of its binding site with 9AD4, while R5.004 binds to a distinct epitope which shows some overlap with that of QA1. Indeed, 9AD4 and QA1 compete for binding with R5.016 and R5.004, respectively (
Example 5—a Class of Non-Neutralizing mAb Potentiates the Effect of Anti-PfRH5, -PfCyRPA and -PfAMA1 Antibodies
[0320] Having observed one example of antagonism, functional assessment was continued in relation to alternative mAb pairs that bind non-overlapping epitopes on PfRH5 and which do not apparently compete for binding. Combinations of mAbs were tested in the GIA assay to determine whether such mAb combinations lead to improved inhibition of invasion either additively or synergistically.
[0321] Remarkably, we determined that mAb R5.011 (also referred to as mAb11) potentiated the inhibitory effect of all eight of the most potent nAbs against 3D7 clone parasites, showing a clear synergistic effect despite showing no neutralizing capacity when tested alone. This effect did not extend to GIA-low mAbs R5.001 and R5.015 or any GIA-negative mAbs (
[0322] R5.011 shares the same green epitope bin as R5.014 and R5.010 (
[0323] The synergistic effect of mAb R5.011 was investigated further. Interestingly, this was maintained when using a nAb Fab fragment or a R5.011 Fab fragment, ruling out mechanisms linked to IgG bivalency or the Fc (
[0324] Dilutions of nAb in the presence of a large excess of R5.011 revealed the maximum possible synergistic effect. Under these conditions, the EC.sub.80 of R5.016 is reduced from 500 μg/mL to ˜55 μg/mL and, likewise, the EC.sub.80 of R5.004 is reduced from 550 μg/mL to ˜55 μg/mL (
[0325] It was also investigated whether the effect of R5.011 was PfRH5-specific and the potential for synergy with antibodies targeting merozoite invasion ligands involved in chronologically distinct steps of the RBC invasion process. The addition of R5.011 mAb to polyclonal IgG from rabbits or rats immunized with PfRH4, PfRipr, PfAMA1 or PfCyRPA leads to substantially increased GIA (
[0326] Finally, it was investigated whether the functionality of R5.016 and R5.011 can be combined into a single molecule, by production of a bispecific dual variable domain immunoglobulin (DVD-Ig™) containing both the variable domains of R5.011 and R5.016. To achieve high levels of growth inhibition, a R5.016+R5.011 mAb combination required fewer total molecules than R5.016 alone (
[0327] Overall, these data identify R5.011 as an example of a class of antimalarial mAb that displays a new functionality by potentiating the effect of all tested anti-PfRH5 nAbs and pAb, as well as pAb directed against other merozoite antigens, despite having no intrinsic neutralizing properties when tested alone. This raises the critical importance of inducing such antibodies in next-generation PfRH5-based vaccination strategies.
Example 6—the Epitope for Potentiating mAb R5.011 Lies at the N-Terminus of PfRH5ΔNL
[0328] To identify the R5.011 epitope, a crystal structure of PfRH5ΔNL bound to one R5.011 Fab fragment and one R5.016 Fab fragment was determined to a resolution of 3.6 Å, with all CDR loops clearly resolved (
[0329] The position of R5.016 in PfRH5ΔNL:R5.011:R5.016 is equivalent to that in PfRH5ΔNL:R5.004:R5.016. There is no structural change in the binding site of R5.016 or R5.004 when R5.011 is bound, ruling out an allosteric mechanism for potentiation.
TABLE-US-00039 TABLE 6 Proposed interactions between R5.011 and PfRH5, related to FIG. 7 R5.011 PfRH5 FWR/CDR region Residue (chain) Group Structural element Residue (chain) Group Interaction type CDR H1 Thr 30 (C/H) Main chain N-terminal coil Asn 154 (A/F) Side chain Hydrogen CDR H1 Ser 31 (C/H) Side chain N-terrninal coil Ser 153 (A/F) Main chain Hydrogen CDR H1 Ser 31 (C/H) Main chain N-terminal coil Tyr 155 (A/F) Main chain Hydrogen CDR H1 Tyr 32 (C/H) Side chain N-terminal coil Tyr 155 (A/F) Side chain Hydrophobic CDR H2 Asn 52 (C/H) Side chain N-terminal coil Asn 156 (A/F) Side chain Hydrogen CDR H2 Thr 53 (C/H) Main chain N-terminal coil Asn 156 (A/F) Side chain Hydrogen CDR H2 Thr 53 (C/H) Side chain N-terminai coil Asn 156 (A/F) Side chain Hydrogen CDR H2 Asn 54 (C/H) Main chain N-terminal coil Asn 156 (A/F) Side chain Hydrogen CDR H3 Asn 102 (C/H) Main chain N-terminai coil Asn 159 (A/F) Main chain Hydrogen CDR H3 Tyr 104 (C/H) Main chain Beta-strand 1 Ile 161 (A/F) Main chain Hydrogen CDR H3 Ser 106 (C/H) Main chain Beta-strand 1 Ile 161 (A/F) Main chain Hydrogen CDR H3 Ser 106 (C/H) Side chain Beta-strand 1 Ile 163 (A/F) Main chain Hydrogen CDR H3 Ser 107 (C/H) Side chain Helix 3 Lys 311 (A/F) Side chain Hydrogen CDR H3 Tyr 109 (C/H) Side chain Helix 3 Asn 308 (A/F) Side chain Hydrogen CDR H3 Ser 111 (C/H) Side chain Helix 3 Lys 319 (A/F) Side chain Hydrogen CDR H3 Tyr 114 (C/H) Side chain Helix 3 Lys 319 (A/F) Side chain Hydrogen CDR L1 Gly 28 (B/G) Main chain Helix 3 Lys 312 (A/F) Side chain Hydrogen CDR L1 Gly 28 (B/G) Main chain Helix 3 Asn 308 (A/F) Side chain Hydrogen CDR L1 Ser 29 (B/G) Side chain Helix 3 Asn 308 (A/F) Side chain Hydrogen CDR L2 Asp 49 (B/G) Side chain Helix 3 Lys 316 (A/F) Side chain Hydrogen CDR L2 Asp 50 (B/G) Side chain Helix 3 Lys 312 (A/F) Side chain Hydrogen CDR L2 Asp 52 (B/G) Main chain Helix 3 Lys 316 (A/F) Main chain Hydrogen Light chain FWR3 Asn 65 (8/G) Side chain Helix 3 Lys 312 (A/F) Side chain Hydrogen Light chain FWR3 Gly 67 (B/G) Main chain Helix 3 Asp 305 (A/F) Side chain Hydrogen
Example 6—mAb R5.011 Potentiates Anti-Merozoite nAbs by Increasing the Time Required for Invasion
[0330] Examples 4 demonstrates the ability of R5.011 to potentiate the activity of nAbs which bind to various merozoite invasion proteins, and Example 2 demonstrates that antibody on-rate is likely a critical determinant of neutralizing efficacy. Therefore, it was next decided to investigate whether this mAb slows down the invasion process, thus giving longer for these many different nAbs to reach their binding sites.
[0331] Live-cell imaging revealed that the time taken for merozoites to invade RBC is significantly longer (around three-fold) in the presence of R5.011 versus a control mAb targeting Ebolavirus surface protein (
Discussion
[0332] The Examples herein determine the features of a desirable human antibody response to the most advanced blood-stage malaria vaccine candidate antigen, by relating the functions of mAbs to their binding sites on PfRH5. The existence of different classes of anti-PfRH5 mAb are revealed including highly-neutralizing mAbs and a novel class of synergistic non-neutralizing mAbs with the unexpected ability to potentiate the invasion inhibition properties of all other neutralizing mAbs, including others that target different invasion proteins such as PfCyRPA and PfAMA1, by slowing invasion.
[0333] All of these mAb clones were elicited by PfRH5FL vaccination in humans using a modestly immunogenic viral-vectored vaccine delivery platform. Indeed, the panel of mAbs was limited in size as a result of relatively low B cell induction, a feature typical of viral-vectored vaccination. It is therefore possible that not all mAb classes have been explored and, furthermore, that more potent members of each mAb class may exist, as determined by their association-rate within that class. However, more potent mAbs may be uncommon, as K.sub.on values for the mAbs identified here approach the kinetic limits commonly seen in normal B cell development post-vaccination and there is no particular inbuilt in vivo mechanism to select for B cells expressing ultra-high association-rate mAbs (or indeed ultra-slow dissociation-rate mAbs) during affinity maturation. The fact that antibody association-rate, as opposed to the often-measured dissociation-rate, emerged as a key indicator of antibody potency implies highly dynamic processes are involved in invasion. This relationship has been noted before for a viral pathogen; nevertheless, this is an often-neglected parameter that appears highly relevant to malaria vaccine design. Minimal deviation from germline sequences was noted in these mAb clones, potentially related to: i) their isolation from plasmablasts 7 days post-booster vaccination rather than the memory B cell pool, or ii) their isolation after only two PfRH5 vaccinations, and/or iii) their induction by a modestly immunogenic vaccine delivery platform.
[0334] Three epitope bins contained GIA-high mAbs: red, blue and olive. The mechanism of action of those contained in the blue and olive bins is undoubtedly blockade of BSG binding, supported by in vitro SPR and AVEXIS assays as well as X-ray crystallography data for exemplar mAb R5.004. However, the crystal structure showed that, unlike R5.004, mAb R5.016 (from the more potent red bin) and BSG can simultaneously bind PfRH5 in solution. The question of why nAbs such as R5.016 are more potent than overt BSG-blocking nAbs such as R5.004 leaves room for additional biological mechanisms to be defined. Experiments in
[0335] R5.011 is not inhibitory in the time scale of a GIA experiment (one single cycle of blood-stage invasion and growth), it probably mediates its function by increasing the likelihood of nAb binding to PfRH5. This effect is not due to an R5.011-induced increase in the binding affinity for nAbs, as the crystal structures revealed that the R5.004 and R5.016 binding sites are unaltered (<0.5 Å RMSD aligned over 39 and 30 α-carbon atoms, respectively) by the presence of R5.011. Furthermore, the binding affinity and K.sub.on of nAbs R5.004 and R5.016 for PfRH5 are unchanged by R5.011 binding, dismissing structural allostery as a mechanism of anti-PfRH5 nAb potentiation. Thus, R5.011 accesses an epitope largely devoid of secondary structure at a new site on PfRH5. Moreover, the effect occurs for all GIA-high nAbs tested as well as R5.007, and these bind four distinct epitope regions on PfRH5.Instead R5.011 reduces the rate of RBC invasion by the merozoite, such that nAbs have longer to access to their epitopes on PfRH5 and are thus more likely to mediate their function. In agreement with this view, R5.011 enhances the effect of antibodies binding merozoite proteins thought to act at the time of PfRH5-BSG binding or afterwards, but not before, consistent with R5.011 causing a retardation in the merozoite invasion process. This is supported by the data which demonstrate that R5.011 significantly slows the invasion process, allowing more time for nAb to bind to their epitopes on various merozoite surface proteins. The ability to delay parasite invasion would represent a highly novel and attractive means of improving vaccine-induced neutralizing antibody efficacy.
[0336] One possible mechanism is suggested by the proximity of the R5.011 binding site to the predicted N-terminal cleavage site of PfRH5, the processing of which yields the ˜45 kDa fragment. Indeed, if proteolytic cleavage of PfRH5 is necessary for successful merozoite invasion and if R5.011 binding reduces this cleavage rate but not below the rate necessary for successful invasion, protease occlusion would be a plausible mechanism to explain this synergistic cooperation between antibodies (again, not being bound by this theory). Cooperativity between pairs of mAbs targeting a single pathogen protein has been described before, whereby two mAbs specific for the same protein display synergistic neutralizing effects. For instance, cooperativity involving non-neutralizing mAbs to Ebolavirus glycoprotein has been described, as it has previously been with Neisseria meningitidis fHBP. However, to the inventors' knowledge, non-neutralizing antibodies like R5.011 that specifically potentiate multiple neutralizing antibodies against the same and other antigenic targets have not been described for other pathogens.
[0337] Whatever the mechanism (and the present invention is not bound by theory in this regard), R5.011-like mAbs may explain the high potency of anti-PfRH5 pAb. Indeed the 3D7 P. falciparum GIA EC.sub.50 of anti-PfRH5-specific polyclonal IgG has previously been reported to be ˜9 μg/mL across eight vaccinated volunteers, equivalent to that of the most potent of all known anti-PfRH5 mAbs (red epitope bin) and substantially lower than reported for historical vaccine candidates such as PfMSP1 and PfAMA1. The possibility of ultra-potent serum antibody clones contributing most of the GIA at low concentrations in all eight volunteers cannot be excluded, however, synergistic functional interactions between mAbs in the polyclonal IgG seems a more likely explanation. Given that two of the seventeen mAbs in this study displayed potentiating activity, the induction of such clones does not appear to be a rare event following human immunization with PfRH5. Notably, the results herein demonstrate there was still substantial room for improvement through spiking in mAb R5.011 to all the vaccine-induced human pAb samples, suggesting new avenues to maximize the potency of next-generation PfRH5-based vaccines destined for clinical development.
[0338] Overall, the data presented here support the view that vaccine-induced anti-PfRH5 pAb growth inhibition represents a synthesis between the neutralizing effect of nAb and synergy from R5.011-type antibodies. Immuno-focusing on these key epitope regions will be critical for next-generation PfRH5 vaccine design, and the ability of the GIA assay to correlate with in vivo protection in NHP, as well as identify anti-PfRH5 mAb clones with in vivo efficacy against P. falciparum in a humanized mouse model, further underpins this strategy.
[0339] Notably, we demonstrated there was still substantial room for improvement through spiking in mAb R5.011 to all the vaccine-induced human pAb samples, suggesting new avenues to maximize the potency of next-generation PfRH5-based vaccines destined for clinical development. Although relatively high concentrations (around 200 μg/mL) of R5.011 are needed to leverage this effect to its fullest, antigen-specific antibody titers of this magnitude can be achieved in humans. Alternatively, delivering potentiating antibody clones alongside a traditional vaccine using vectored immunoprophylaxis could be a viable alternative.
[0340] The development of synergistic and functionally important “non-neutralizing” epitopes challenges the paradigm of structural vaccinology which traditionally sees the advancement of epitopes against which overtly neutralizing antibodies are directed. It is therefore important that future immunogen design strategies for the development of PfRH5-based vaccines use the structural insights obtained here to focus the human immune response to generate both neutralizing and potentiating antibodies. These data thus provide a strategy to design effective PfRH5-based blood-stage malaria vaccines that provide functional anti-merozoite immunity at lower overall concentrations of PfRH5-specific human IgG.