ANTI-CD39 ANTIBODIES, COMPOSITIONS COMPRISING ANTI-CD39 ANTIBODIES AND METHODS OF USING ANTI-CD39 ANTIBODIES
20210403593 · 2021-12-30
Inventors
- Vanessa Soros (South San Francisco, CA, US)
- Maria Kovalenko (South San Francisco, CA, US)
- John Corbin (South San Francisco, CA, US)
- Courtney Beers (South San Francisco, CA, US)
- Paul Fredrick Widboom (Lebanon, NH, US)
- Joseph Robert Warfield (Lebanon, NH, US)
Cpc classification
A61K45/06
HUMAN NECESSITIES
G01N33/566
PHYSICS
C12N15/11
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
G01N2333/70596
PHYSICS
G01N2500/04
PHYSICS
A61K39/3955
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C07K16/2896
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K39/395
HUMAN NECESSITIES
C12N15/11
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
Abstract
Provided herein are antibodies that selectively bind to CD39 and its isoforms and homologs, and compositions comprising the antibodies. Also provided are methods of using the antibodies, such as therapeutic and diagnostic methods.
Claims
1. An antigen binding protein that binds specifically to a human CD39 (hCD39) and is capable of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 of the following: a) inhibiting binding of CD39 to ATP; b) inhibiting conversion by CD39 of ATP to ADP and/or ADP to AMP; c) decreasing affinity of CD39 for ATP or ADP; d) inhibiting or impeding release of ADP or AMP from CD39; e) impeding or inhibiting CD39 processivity; f) inhibiting platelet aggregation; g) decreasing levels of phosphate, ADP, AMP, and/or adenosine and/or increasing levels of ATP; h) increasing T effector cell function; i) decreasing the number of regulatory T cells in tissues or in circulation; j) suppressing regulatory T cells or regulatory T cell activity; k) increasing B cell function; l) increasing antigen presenting cell function; m) inhibiting CD39 function on tumor cells; n) inhibiting processing of at least one of phospho-antigen from phosphorylated isoprenoid, phosphorylated vitamin B metabolite, and/or phosphorylated riboflavin; o) decreasing or preventing activation of phospho antigen specific T cells selected from MAIT cells and γδ T cells; p) inhibiting angiogenesis; q) increasing proliferation of stimulated CD4.sup.+ and CD8.sup.+ T cells; r) increasing stimulated PBMC Secretion of INF-γ, TNF-α, IL-2 and/or IL-1β.
2. The antigen binding protein of claim 1, wherein the antigen binding protein has 1, 2, 3, 4, 5, 6, or 7 of the following characteristics: a) is a monoclonal antibody; b) is a human antibody, a humanized antibody, or a chimeric antibody; c) is a bispecific antibody, a multi-specific antibody, a diabody, or a multivalent antibody; d) is of the IgG1, IgG2, IgG3, IgG4, or IgM type; e) is an antigen-binding antibody fragment; f) is a Fab fragment, a Fab′ fragment, a F(ab′)2 fragment, or an Fv fragment; and/or g) is a single chain antibody, a single domain antibody, or a nanobody.
3. A pharmaceutical composition comprising an effective amount of an antibody which binds to hCD39 and has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16 of the following of characteristics: a) blocks or decreases hydrolysis of ATP to ADP and/or ADP to AMP as determined by at least one of: (i) a decreased phosphate release (Pi), (ii) an increase in ATP levels, and (iii) a decrease of ADP, AMP, and/or adenosine levels, b) increases T effector cell activity; c) suppresses regulatory T cell or decreases a regulatory T cell activity; d) decreases number of regulatory T cells in tissues or in circulation; e) increases B cell function; f) increases antigen presenting cell function; g) inhibits CD39 function on tumor cells; h) blocks or inhibits processing of at least one of phospho-antigen from a phosphorylated isoprenoid, phosphorylated vitamin B metabolite, and phosphorylated riboflavin; i) decreases or prevents activation of phospho antigen specific T cells selected from MAIT cells and γβ T cells; k) inhibits angiogenesis; l) decreases affinity for ATP and/or ADP; m) inhibits release of ADP or AMP from CD39; n) impedes or inhibits CD39 processivity; o) inhibits platelet aggregation; p) increases proliferation of stimulated CD4.sup.+ and CD8.sup.+ T cells; r) increases stimulated PBMC Secretion of INF-γ, TNF-α, IL-2, and/or IL-1β.
4. A pharmaceutical composition comprising the antigen-binding protein of claim 1 or claim 2.
5. The pharmaceutical composition of claim 4, further comprising an effective amount of at least one of the following a) an anti-PD-1 antibody, b) an anti-PD-L1 antibody, c) an anti-CD73 antibody, d) an anti-CD38 antibody, e) an anti-A2A receptor antibody, f) an anti-A2B receptor antibody, g) an anti-A2A/A2B dual receptor antibody, or any combination thereof, or h) a small molecule inhibitor, or a combination thereof.
6. The pharmaceutical composition of claim 4 or claim 5, further comprising one or both of a) an antibody to an inhibitory receptor or ligand and/or b) an antibody to a costimulatory receptor or ligand, or a combination thereof.
7. The pharmaceutical composition of claim 6, wherein (i) the inhibitory receptor or ligand is at least one of CTLA-4, PD-L2, LAG-3, Tim3, neuritin, BTLA, CECAM-1, CECAM-5, VISTA, LAIR1, CD160, 2B4, TGF-R, HHLA2, ILT2, ILT3, ILT4, HLA-G, HLA-C, and/or a Killer-cell immunoglobulin-like receptor (KIR) and/or (ii) the costimulatory receptor or ligand is at least one of OX40, CD2, CD27, CDS, ICAM-1, LFA-1, ICOS (CD278), 4-1BB (CD137), GITR, CD28, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, and/or CD83.
8. The pharmaceutical composition of claim 7, wherein the costimulatory receptor or ligand LFA-1 further comprises an LFA-1 β-chain CD18 and/or an LFA-1 α-chain CD11a.
9. The antigen binding protein of claim 1, wherein the antigen binding protein has one or more of the following characteristics: a) binds to a human CD39 polypeptide or a variant thereof with a KD of less than about 20 nM; b) binds to a cyno CD39 polypeptide or a variant thereof with a KD of less than about 200 nM; c) binds to a murine CD39 polypeptide or a variant thereof with a KD of less than about 200 nM; or d) a combination of at least 2 of a), b), and c).
10. An antigen binding protein that competes or is capable of competing for binding to human CD39 with a reference antigen binding protein, wherein the reference antigen binding protein is the antigen binding protein of claim 1.
11. An antigen binding protein that binds to or is capable of competing for binding to human CD39 with a reference antigen binding protein, wherein the reference antigen binding protein binds to an epitope at positions 143-158 or 274-277 of SEQ ID NO: 249 on a human CD39 polypeptide, including, but not limited to, D150, E153, R154 or N99 alone or in combination with D150, E153, R154 or any combination thereof.
12. The antigen binding protein of claim 10 or claim 11, wherein the antigen binding protein and the reference antibody cross-compete or are capable of cross-competing for binding to a human CD39.
13. The antigen binding protein of claim 1, comprising a human heavy chain constant region or fragment or a variant thereof, wherein the constant region variant comprises up to 20 conservatively modified amino acid substitutions from any sequence set forth SEQ ID NOs: 179-218.
14. An isolated antibody molecule capable of binding to human CD39 (hCD39), comprising a heavy chain variable region (VH) and a light chain variable region (VL), VH and/or VL comprising 1, 2, 3, 4, 5, or 6 of: a) a VHCDR1 having the sequence set forth in SEQ ID NOs: 1-45, b) a VHCDR2 having the sequence set forth in SEQ ID NOs: 46-81, c) a VHCDR3 having the sequence set forth in SEQ ID NOs: 82-109, d) a VLCDR1 having the sequence set forth in SEQ ID NOs: 110-124, e) a VLCDR2 having the sequence set forth in SEQ ID NOs: 125-140, and f) a VLCDR3 having the sequence set forth in SEQ ID NOs: 141-166.
15. An isolated antibody molecule capable of binding to human CD39 (hCD39), comprising a heavy chain variable region (VH) and a light chain variable region (VL), the VH comprising, a) a VHCDR1 having a sequence set forth in SEQ ID NOs: 1-45, b) a VHCDR2 having a sequence set forth in SEQ ID NOs: 46-81, and c) a VHCDR3 having a sequence set forth in SEQ ID NOs: 82-109; and the VL comprising, a) a VLCDR1 having a sequence set forth in SEQ ID NO: 110-124, b) a VLCDR2 having a sequence set forth in SEQ ID NO: 125-140, and c) a VLCDR3 having a sequence set forth in SEQ ID NO: 141-166.
16. An isolated nucleic acid encoding an antigen binding protein according to claim 1, claim 14, or claim 15.
17. An expression vector comprising the nucleic acid according to claim 16.
18. A prokaryotic or eukaryotic host cell comprising the vector of claim 17.
19. An oncolytic virus encoding the nucleic acid of either of claim 16 or 17.
20. A method for the production of a recombinant protein comprising the steps of expressing a nucleic acid according to claim 16 in a prokaryotic or eukaryotic host cell and recovering the protein from the cell or the cell culture supernatant.
21. A method for treatment of a subject suffering from cancer, a chronic infection, or from an inflammatory disease, comprising the step of administering to the subject a pharmaceutical composition comprising an effective amount of the antigen binding protein of claim 1 or the pharmaceutical composition of claim 3.
22. The method of claim 21, wherein the cancer is a solid cancer.
23. The method of claim 21, wherein the cancer is a hematological cancer.
24. A method for modulating immune system function in a subject in need thereof, comprising the step of contacting a population of immune cells of the subject with a pharmaceutical composition comprising an effective amount of the antigen binding protein of claim 1, under conditions such that the immune system is modulated.
25. A method for inducing or enhancing an immune response in a subject in need thereof, comprising the step of administering to the subject a pharmaceutical composition comprising an antigen binding protein, wherein the immune response is generated against a tumor antigen.
26. The method of claim 24 or claim 25, wherein the subject is a human subject.
27. The method of claim 25, wherein the antigen binding protein comprises a bispecific antibody or a complexing antigen binding protein.
28. The method of claim 27, wherein the antigen binding protein, the bispecific antibody, or the complexing antigen binding protein is administered in an amount sufficient to achieve 1, 2, 3, 4, 5, 6, or 7 of the following in the subject: a) reduction of CD39 ATPase activity in a target cell population; b) reduction of regulatory T cells suppression of activity of effector T cells; c) reduction of levels of regulatory T cells; d) activation of effector T cells; e) induction or enhancement of effector T cell proliferation; f) inhibition of tumor growth; and/or g) induction of tumor regression.
29. The method of claim 28, wherein the target cell population comprises T cells, B cells, monocytes, macrophages, dendritic cells, myeloid-derived suppressor cells, and/or tumor cells.
30. The method of claim 25, wherein the method further comprises one or more of the following a) administering chemotherapy; b) administering radiation therapy; and/or c) administering one or more additional therapeutic agents.
31. The method of claim 30, wherein the one or more additional therapeutic agents comprise one or more immunostimulatory agents.
32. The method of claim 31, wherein the one or more immunostimulatory agents comprise an antagonist to an inhibitory receptor of an immune cell.
33. The method of claim 32, wherein the inhibitory receptor is at least one of CTLA-4, PD-1, PD-L1, PD-L2, LAG-3, Tim3, neuritin, BTLA, CECAM-1, CECAM-5, VISTA, LAIR1, CD160, 2B4, TGF-R, and/or a Killer-cell immunoglobulin-like receptor (KIR).
34. The method of claim 31, wherein the one or more immunostimulatory agents comprise an agonist of a co-stimulatory receptor of an immune cell.
35. The method of claim 34, wherein the co-stimulatory receptor is OX40, CD2, CD27, CDS, ICAM-1, LFA-1, ICOS (CD278), 4-1BB (CD137), GITR, CD28, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, or a CD83 ligand.
36. The method of claim 35, wherein the costimulatory receptor or ligand LFA-1 further comprises an LFA-1 β-chains CD18 and/or an LFA-1 α-chain CD11a.
37. The method of claim 31, wherein the one or more immunostimulatory agents comprise a cytokine.
38. The method of claim 37, wherein the cytokine is at least one of IL-2, IL-5, IL-7, IL-12, IL-15, and/or IL-21.
39. The method of claim 31, wherein the one or more immunostimulatory agents comprise an oncolytic virus.
40. The method of claim 39, wherein the oncolytic virus is a Herpes simplex virus, a Vesicular stomatitis virus, an adenovirus, a Newcastle disease virus, a vaccinia virus, or a maraba virus.
41. The method of claim 31, wherein the one or more immunostimulatory agents comprise a chimeric antigen engineered T cell.
42. The method of claim 31, wherein the one or more immunostimulatory agents comprise a bi- or multispecific T cell directed antibody.
43. The method of claim 25, wherein the one or more additional therapeutic agents comprise at least one trap for an immune suppressive agent.
44. The method of claim 43, wherein the at least one trap for an immune suppressive agent comprises at least one of an anti-TGF-beta antibody, a TGFb receptor trap, an anti-IL-10 antibody and/or anti-IL-10 receptor trap, and/or an anti-IL-35 antibody trap and/or an anti-IL-35 receptor trap.
45. The method of any one of any of claims 3-44, wherein administration of the pharmaceutical composition results in induction or enhancement of proliferation of a T-effector cell, or modulation of I-kappaB and/or NF-κB in the T cell, or modulation of CD39 activity in the T cell, or T cell receptor induced signaling in a T-effector cell, or a combination thereof.
46. A method of screening for a test compound comprising an antigen binding protein of claim 1 capable of inhibiting an activity of CD39, comprising the steps of: contacting a test sample containing CD39 with a test compound; comparing the activity of the test sample to a control sample; whereby a decrease in the activity of CD39 in the test sample compared to the control sample identifies the compound as one that inhibits the activity of CD39.
47. The method of claim 46, wherein the control sample comprises a sample not contacted with a test compound.
48. An isolated antibody molecule capable of binding to human CD39 (hCD39), comprising a heavy chain variable region (VH) and a light chain variable region (VL), VH comprising at least one of: a) a VHCDR1 having an amino acid sequence that is at least 90% identical to the sequence set forth in SEQ ID NOs: 1-45, b) a VHCDR2 having an amino acid sequence that is at least 90% identical to the sequence set forth in SEQ ID NOs: 46-81, and c) a VHCDR3 having an amino acid sequence that is at least 90% identical to the sequence set forth in SEQ ID NOs: 82-109; and VL comprising at least one of: a) a VLCDR1 having an amino acid sequence that is at least 90% identical to the sequence set forth in SEQ ID NOs: 110-124, b) a VLCDR2 having an amino acid sequence that is at least 90% identical to the sequence set forth in SEQ ID NOs: 125-140, and c) a VLCDR3 having an amino acid sequence that is at least 90% identical to the sequence set forth in SEQ ID NOs 141-166.
49. An isolated antibody molecule capable of binding to human CD39 (hCD39), comprising a heavy chain variable region (VH) and a light chain variable region (VL), VH comprising at least one of: a) a VHCDR1 having an amino acid sequence that is homologous to the sequence set forth in SEQ ID NOs: 1-45, b) a VHCDR2 having an amino acid sequence that is homologous to the sequence set forth in SEQ ID NOs: 46-81, and c) a VHCDR3 having an amino acid sequence that is homologous to the sequence set forth in SEQ ID NOs: 82-109; and VL comprising at least one of: a) a VLCDR1 having an amino acid sequence that is homologous to the sequence set forth in SEQ ID NOs: 110-124, b) a VLCDR2 having an amino acid sequence that is homologous to the sequence set forth in SEQ ID NOs: 125-140, and c) a VLCDR3 having an amino acid sequence that is homologous to the sequence set forth in SEQ ID NOs: 141-166.
50. An isolated antibody molecule capable of binding to human CD39 (hCD39), comprising a heavy chain and a light chain, the heavy chain comprising one or more molecules having a sequence consisting of one of SEQ ID NO: 255, SEQ ID NO: 257, SEQ ID NO: 259, SEQ ID NO: 261, SEQ ID NO: 263, SEQ ID NO: 265, SEQ ID NO: 267, SEQ ID NO: 269, SEQ ID NO: 271, SEQ ID NO: 273, SEQ ID NO: 275, SEQ ID NO: 277, SEQ ID NO: 279, SEQ ID NO: 281, SEQ ID NO: 283, SEQ ID NO: 285, SEQ ID NO: 287, SEQ ID NO: 289, SEQ ID NO: 291, SEQ ID NO: 293, or SEQ ID NO: 295 and the light chain comprising one or more molecules having a sequence consisting of one of SEQ ID NO: 256, SEQ ID NO: 258, SEQ ID NO: 260, SEQ ID NO: 262, SEQ ID NO: 264, SEQ ID NO: 266, SEQ ID NO: 268, SEQ ID NO: 270, SEQ ID NO: 272, SEQ ID NO: 274, SEQ ID NO: 276, SEQ ID NO: 278, SEQ ID NO: 280, SEQ ID NO: 282, SEQ ID NO: 284, SEQ ID NO: 286, SEQ ID NO: 288, SEQ ID NO: 290, SEQ ID NO: 292, SEQ ID NO: 294, or SEQ ID NO: 296.
51. An isolated antibody molecule capable of binding to human CD39 (hCD39), comprising a heavy chain and a light chain, a) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 255 and the light chain comprising one or more, each molecule having a sequence consisting of SEQ ID NO: 256; b) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 257 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 258; c) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 259 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 260; d) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 261 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 262; e) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 263 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 264; f) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 265 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 266; g) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 267 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 268; h) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 269 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 270; i) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 271 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 272; j) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 273 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 274; k) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 275 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 276; l) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 277 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 278 m) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 279 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 280; n) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 281 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 282; o) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 283 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 284; p) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 285 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 286; q) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 287 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 288; r) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 289 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 290; s) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 291 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 292; t) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 293 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 294; or u) the heavy chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 295 and the light chain comprising one or more molecules, each molecule having a sequence consisting of SEQ ID NO: 296.
52. An isolated nucleic acid encoding an antigen binding protein according to any one of claims 48-51.
53. An isolated antibody molecule capable of binding to human CD39 (hCD39), comprising a heavy chain variable region (VH) and a light chain variable region (VL), VH and/or VL comprising 1, 2, 3, 4, 5, or 6 of: a) a VHCDR1 sequence comprising: (i) a Kabat CDRH1 sequence defined by the consensus sequence S-Y-Δ.sub.3-M-Δ.sub.5 (SEQ ID NOS: 25-29 and 44-45), where Δ.sub.3 is E, F, Q, or Y and Δ.sub.5 is H or Y; (ii) a Kabat CDR-H1 sequence defined by the consensus sequence θ.sub.1-θ.sub.2-θ.sub.3-I-S (SEQ ID NOS: 30-37), where θ.sub.1 is A, H, K, L, S, or W; θ.sub.2 is L, M, N, or T; and θ.sub.3 is A or P; (iii) a Kabat CDR-H1 sequence defined by the consensus sequence η.sub.1-Y-η.sub.3-I-S SEQ ID NOS: 38-41), where η.sub.1 is S, K, N, or R and η.sub.3 is A or G; (iv) a Chothia CDR-H1 sequence defined by the consensus sequence G-Y-T-F-Ω.sub.5-S-Y (SEQ ID NOS: 1-2 and 4-6), where Ω.sub.5 is T, K, Q, F, or V; (v) a Chothia CDR-H1 sequence defined by the consensus sequence G-G-T-F-ν.sub.5-ν.sub.6-Y (SEQ ID NOS: 17-22 and 24), where ν.sub.5 is S, G, or E and ν.sub.6 is S, K, R, or S; or (vi) a Chothia CDR-H1 consensus sequence defined by the consensus sequence G-G-T-F-κ.sub.5-κ.sub.6-κ.sub.7 (SEQ ID NOS: 7-16), where κ.sub.5 is S, Q, P, or A; κ.sub.6 is S, K, H, L, A, or W; and κ.sub.7 is Y, L, T, N, or M, b) a VHCDR2 sequence comprising: (i) a Kabat CDR-H2 sequence defined by the consensus sequence ε.sub.1-I-N-P-ε.sub.5-ε.sub.6-G-S-T-ε.sub.10-Y-A-Q-K-F-Q-G (SEQ ID NOS: 63-66 and 68), where ε.sub.1 is K, S, R, or V; as is L, R, or S; ε.sub.6 is G or V; and ε.sub.10 is S or W; (ii) a Kabat CDR-H2 sequence defined by the consensus sequence G-I-α.sub.3-α.sub.4-α.sub.5-α.sub.6-G-T-A-N-Y-A-Q-K-F-Q-G (SEQ ID NOS: 69-72), where α.sub.3 is I or L or is absent; α.sub.4 is P or is absent; and as is I, G, or R; and α.sub.6 is A, F, or G; (iii) a Kabat CDR-H2 sequence defined by the consensus sequence β.sub.1-I-I-P-β.sub.5-β.sub.6-G-β.sub.8-A-N-Y-A-Q-K-F-G-Q (SEQ ID NOS: 74 and 76-79), where β.sub.1 is S or G; β.sub.5 is I, E, S, or T; β.sub.6 is F, I, or S; and β.sub.8 is I or T; (iv) a Chothia CDR-H2 sequence defined by the consensus sequence N-P-ε.sub.5-ε.sub.6-G-S-T (SEQ ID NOS: 46-48), where ε.sub.5 is L, R, or S and ε.sub.6 is G or V; (v) a Chothia CDR-H2 sequence defined by the consensus sequence α.sub.3-α.sub.4-α.sub.5-α.sub.6-G-T-A (SEQ ID NOS: 51-54), where α.sub.3 is I or L or is absent; α.sub.4 is P or is absent; and as is I, G, or R; and α.sub.6 is A, F, or G; or (vi) a Chothia CDR-H2 sequence defined by the consensus sequence I-P-β.sub.5-β.sub.6-G-β.sub.8-A (SEQ ID NOS: 56-60), where β.sub.5 is I, E, S, or T; β.sub.6 is F, I, or S; and β.sub.8 is I or T, c) a VHCDR3 sequence comprising: (i) a CDR-H3 sequence defined by the consensus sequence G-K-R-E-G-G-T-E-Y-L-R-γ.sub.12 (SEQ ID NOS: 82-86), where γ.sub.12 is H, K, S, N, or V; (ii) a CDR-H3 sequence defined by the consensus sequence E-S-G-Φ.sub.4-Y-R-D-H-R-L-Φ.sub.11-V (SEQ ID NOS: 94-96), where Φ.sub.4 is G or T and Φ.sub.11 is D or G; or (iii) a CDR-H3 sequence defined by the consensus sequence G-G-A-K-Y-A-.sub.7-
.sub.8-
.sub.9-G-M-D-V (SEQ ID NOS: 87-93), where
.sub.7 is S, V, G, or R;
.sub.8 is T, Q, K, G, or R; and
.sub.9 is Y, H, L, or W, d) a VLCDR1 sequence comprising: (i) a CDR-L1 sequence defined by the consensus sequence ϕ.sub.1-A-S-ϕ.sub.4-ϕ.sub.5-V-ϕ.sub.7-ϕ.sub.8-ϕ.sub.9-Y-L-A (SEQ ID NOS: 1101-114), where ϕ.sub.1 is E, K, or R; ϕ.sub.4 is Q or E; ϕ.sub.5 is S or Y; ϕ.sub.7 is S or A; ϕ.sub.8 is S or Y; and ϕ.sub.9 is D or S; (ii) a CDR-L1 sequence defined by the consensus sequence ∂.sub.1-A-S-Q-∂.sub.5-∂.sub.6-∂.sub.7-∂.sub.8-∂.sub.9-L-∂.sub.11 (SEQ ID NOS: 118 and 120-123), where ∂.sub.1 is Q or R1; ∂.sub.5 is D or S; ∂.sub.6 is I or V; ∂.sub.7 is G or S; ∂.sub.8 is N, R, or S; ∂.sub.9 is N, Y, or W; and ∂.sub.11 is A or N; or (iii) a CDR-L1 sequence defined by the consensus sequence K-S-S-Γ.sub.4-S-V-L-Γ.sub.8-S-Γ.sub.10-N-N-K-N-Y-L-A (SEQ ID NOS: 115-117), where Γ.sub.4 is Q, R or K; Γ.sub.8 is F or Y; and Γ.sub.10 is S or N, e) a VLCDR2 sequence comprising: (i) a CDR-L2 sequence defined by the consensus sequence ψ.sub.1-A-S-ψ.sub.4-R-ψ.sub.6-ψ.sub.7 (SEQ ID NOS: 125-136), where ψ.sub.1 is G or Y, ψ.sub.4 is S or N; ψ.sub.6 is A or H; and ψ.sub.7 is T, Y, or N; (ii) a CDR-L2 sequence defined by the consensus sequence D-A-S-χ.sub.4-R-A-T (SEQ ID NOS: 138 and 139), where £.sub.4 is N or K; or (iii) a CDR-L2 sequence defined by the consensus sequence W-A-S-T-R-σ.sub.6-S (SEQ ID NOS: 131 and 133-134), where σ.sub.6 is A, E, or Q, and f) a VLCDR3 sequence comprising: (i) a CDR-L3 sequence defined by the consensus sequence Q-Q-Y-π.sub.4-π.sub.5-π.sub.6-π.sub.7-T (SEQ ID NOS: 141-147), where π.sub.4 is G, H, or Y; π.sub.5 is S, N, F, G, or R; π.sub.6 is S, Y, A, G, or R; and its is P, I, or L; (ii) a CDR-L3 sequence defined by consensus sequence Q-Q-λ.sub.3-λ.sub.4-λ.sub.5-λ.sub.6-P-T (SEQ ID NOS: 148-150), where λ.sub.3 is R, F, H, S, L, D, Y, or V; λ.sub.4 is S, V, T, G, L, Y, or N; λ.sub.5 is N, L, F, K, or V; and λ.sub.6 is W, F, Y, or L; (iii) a CDR-L3 sequence defined by the consensus sequence Q-Q-Y-ρ.sub.3-ρ.sub.4-W-P-L-T (SEQ ID NOS: 151 and 152), where ρ.sub.3 is N or L and ρ.sub.4 is N or L; or (iv) a CDR-L3 sequence defined by the consensus sequence Q-Q-ω.sub.3-ω.sub.4-ω.sub.5-ω.sub.6-P-ω.sub.5-T (SEQ ID NOS: 153-156), where ω.sub.3 is Y or F; ω.sub.4 is Y or W; ω.sub.5 is S, L, T, or F; ω.sub.6 is T, Y, or F; and ω.sub.8 is L or P.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
DETAILED DESCRIPTION
1. Definitions
[0036] Unless otherwise defined, all terms of art, notations and other scientific terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a difference over what is generally understood in the art. The techniques and procedures described or referenced herein are generally well understood and commonly employed using conventional methodologies by those skilled in the art, such as, for example, the widely utilized molecular cloning methodologies described in Sambrook et al., Molecular Cloning: A Laboratory Manual 2nd ed. (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. As appropriate, procedures involving the use of commercially available kits and reagents are generally carried out in accordance with manufacturer defined protocols and/or parameters unless otherwise noted.
[0037] As used herein, the singular forms “a,” “an,” and “the” include the plural referents unless the context clearly indicates otherwise.
[0038] The term “about” indicates and encompasses an indicated value and a range above and below that value. In certain embodiments, the term “about” indicates the designated value ±10%, ±5%, or ±1%. In certain embodiments, the term “about” indicates the designated value ±one standard deviation of that value.
[0039] The term “combinations thereof” includes every possible combination of elements to which the term refers.
[0040] The terms “CD39” and “CD39 antigen” and “Cluster of Differentiation 39” are used interchangeably herein. CD39 is also known as also known as ectonucleoside triphosphate diphosphohydrolase-1 (gene: ENTPD1; protein: NTPDase1, See www.ncbi.nlm.nih.gov/gene/953). CD39 has also been referred to as ATPDase and SPG64. Each of the terms set forth may be used interchangeably. Unless specified otherwise, the terms include any variants, isoforms and species homologs of human CD39 that are naturally expressed by cells, or that are expressed by cells transfected with a CD39 gene. In some embodiments, CD39 proteins include murine CD39. In some embodiments, CD39 proteins include cynomolgus CD39.
[0041] The term “immunoglobulin” refers to a class of structurally related proteins generally comprising two pairs of polypeptide chains: one pair of light (L) chains and one pair of heavy (H) chains. In an “intact immunoglobulin,” all four of these chains are interconnected by disulfide bonds. The structure of immunoglobulins has been well characterized. See, e.g., Paul, Fundamental Immunology 7th ed., Ch. 5 (2013) Lippincott Williams & Wilkins, Philadelphia, Pa. Briefly, each heavy chain typically comprises a heavy chain variable region (V.sub.H) and a heavy chain constant region (C.sub.H). The heavy chain constant region typically comprises three domains, C.sub.H1, C.sub.H2, and C.sub.H3. Each light chain typically comprises a light chain variable region (V.sub.L) and a light chain constant region. The light chain constant region typically comprises one domain, abbreviated CL.
[0042] The term “antibody” describes a type of immunoglobulin molecule and is used herein in its broadest sense. An antibody specifically includes intact antibodies (e.g., intact immunoglobulins), and antibody fragments. Antibodies comprise at least one antigen-binding domain. One example of an antigen-binding domain is an antigen binding domain formed by a V.sub.H-V.sub.L dimer. A “CD39 antibody,” “anti-CD39 antibody,” “CD39 Ab,” “CD39-specific antibody” or “anti-CD39 Ab” is an antibody, as described herein, which binds specifically to the antigen CD39. In some embodiments, the antibody binds the extracellular domain of CD39.
[0043] The V.sub.H and V.sub.L regions may be further subdivided into regions of hypervariability (“hypervariable regions (HVRs);” also called “complementarity determining regions” (CDRs)) interspersed with regions that are more conserved. The more conserved regions are called framework regions (FRs). Each V.sub.H and V.sub.L generally comprises three CDRs and four FRs, arranged in the following order (from N-terminus to C-terminus): FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. The CDRs are involved in antigen binding, and confer antigen specificity and binding affinity to the antibody. See Kabat et al., Sequences of Proteins of Immunological Interest 5th ed. (1991) Public Health Service, National Institutes of Health, Bethesda, Md., incorporated by reference in its entirety.
[0044] The light chain from any vertebrate species can be assigned to one of two types, called kappa and lambda, based on the sequence of the constant domain.
[0045] The heavy chain from any vertebrate species can be assigned to one of five different classes (or isotypes): IgA, IgD, IgE, IgG, and IgM. These classes are also designated α, δ, ε, γ, and μ, respectively. The IgG and IgA classes are further divided into subclasses on the basis of differences in sequence and function. Humans express the following subclasses: IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2.
[0046] The amino acid sequence boundaries of a CDR can be determined by one of skill in the art using any of a number of known numbering schemes, including those described by Kabat et al., supra (“Kabat” numbering scheme); Al-Lazikani et al., 1997, J Mol. Biol., 273:927-948 (“Chothia” numbering scheme); MacCallum et al., 1996, J Mol. Biol. 262:732-745 (“Contact” numbering scheme); Lefranc et al., Dev. Comp. Immunol., 2003, 27:55-77 (“IMGT” numbering scheme); and Honegge and Plückthun, J. Mol. Biol., 2001, 309:657-70 (“AHo” numbering scheme), each of which is incorporated by reference in its entirety.
[0047] Table 1 provides the positions of CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3 as identified by the Kabat and Chothia schemes. For CDR-H1, residue numbering is provided using both the Kabat and Chothia numbering schemes.
[0048] Unless otherwise specified, the numbering scheme used for identification of a particular CDR herein is the Kabat/Chothia numbering scheme. Where the residues encompassed by these two numbering schemes diverge, the numbering scheme is specified as either Kabat or Chothia.
TABLE-US-00001 TABLE 1 Residues in CDRs according to Kabat and Chothia numbering schemes. CDR Kabat Chothia L1 L24-L34 L24-L34 L2 L50-L56 L50-L56 L3 L89-L97 L89-L97 H1 (Kabat H31-H35B H26-H32 or Numbering) H34* H1 (Chothia H31-H35 H26-H32 Numbering) H2 H50-H65 H52-H56 H3 H95-H102 H95-H102 *The C-terminus of CDR-H1, when numbered using the Kabat numbering convention, varies between H32 and H34, depending on the length of the CDR, as illustrated in FIG. 1.
[0049] The “EU numbering scheme” is generally used when referring to a residue in an antibody heavy chain constant region (e.g., as reported in Kabat et al., supra). Unless stated otherwise, the EU numbering scheme is used to refer to residues in antibody heavy chain constant regions described herein.
[0050] An “antibody fragment” comprises a portion of an intact antibody, such as the antigen binding or variable region of an intact antibody. Antibody fragments include, for example, Fv fragments, Fab fragments, F(ab′)2 fragments, Fab′ fragments, scFv (sFv) fragments, and scFv-Fc fragments.
[0051] “Fv” fragments comprise a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain.
[0052] “Fab” fragments comprise, in addition to the heavy and light chain variable domains, the constant domain of the light chain and the first constant domain (C.sub.H1) of the heavy chain. Fab fragments may be generated, for example, by papain digestion of a full-length antibody.
[0053] “F(ab′).sub.2” fragments contain two Fab′ fragments joined, near the hinge region, by disulfide bonds. F(ab′).sub.2 fragments may be generated, for example, by pepsin digestion of an intact antibody. The F(ab′) fragments can be dissociated, for example, by treatment with β-mercaptoethanol.
[0054] “Single-chain Fv” or “sFv” or “scFv” antibody fragments comprise a V.sub.H domain and a V.sub.L domain in a single polypeptide chain. The V.sub.H and V.sub.L are generally linked by a peptide linker. See Plückthun A. (1994). Antibodies from Escherichia coli. In Rosenberg M. & Moore G. P. (Eds.), The Pharmacology of Monoclonal Antibodies vol. 113 (pp. 269-315). Springer-Verlag, New York, incorporated by reference in its entirety. “scFv-Fc” fragments comprise an scFv attached to an Fc domain. For example, an Fc domain may be attached to the C-terminal of the scFv. The Fc domain may follow the V.sub.H or V.sub.L, depending on the orientation of the variable domains in the scFv (i.e., V.sub.H-V.sub.L or V.sub.L-V.sub.H). Any suitable Fc domain known in the art or described herein may be used.
[0055] The term “monoclonal antibody” refers to an antibody from a population of substantially homogeneous antibodies. A population of substantially homogeneous antibodies comprises antibodies that are substantially similar and that bind the same epitope(s), except for variants that may normally arise during production of the monoclonal antibody. Such variants are generally present in only minor amounts. A monoclonal antibody is typically obtained by a process that includes the selection of a single antibody from a plurality of antibodies. For example, the selection process can be the selection of a unique clone from a plurality of clones, such as a pool of hybridoma clones, phage clones, yeast clones, bacterial clones, or other recombinant DNA clones. The selected antibody can be further altered, for example, to improve affinity for the target (“affinity maturation”), to humanize the antibody, to improve its production in cell culture, and/or to reduce its immunogenicity in a subject.
[0056] The term “chimeric antibody” refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
[0057] “Humanized” forms of non-human antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. A humanized antibody is generally a human immunoglobulin (recipient antibody) in which residues from one or more CDRs are replaced by residues from one or more CDRs of a non-human antibody (donor antibody). The donor antibody can be any suitable non-human antibody, such as a mouse, rat, rabbit, chicken, or non-human primate antibody having a desired specificity, affinity, or biological effect. In some instances, selected framework region residues of the recipient antibody are replaced by the corresponding framework region residues from the donor antibody. Humanized antibodies may also comprise residues that are not found in either the recipient antibody or the donor antibody. Such modifications may be made to further refine antibody function. For further details, see Jones et al., Nature, 1986, 321:522-525; Riechmann et al., Nature, 1988, 332:323-329; and Presta, Curr. Op. Struct. Biol., 1992, 2:593-596, each of which is incorporated by reference in its entirety.
[0058] A “human antibody” is one which possesses an amino acid sequence corresponding to that of an antibody produced by a human or a human cell, or derived from a non-human source that utilizes a human antibody repertoire or human antibody-encoding sequences (e.g., obtained from human sources or designed de novo). Human antibodies specifically exclude humanized antibodies.
[0059] An “isolated antibody” is one that has been separated and/or recovered from a component of its natural environment. Components of the natural environment may include enzymes, hormones, and other proteinaceous or nonproteinaceous materials. In some embodiments, an isolated antibody is purified to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence, for example by use of a spinning cup sequenator. In some embodiments, an isolated antibody is purified to homogeneity by gel electrophoresis (e.g., SDS-PAGE) under reducing or nonreducing conditions, with detection by Coomassie blue or silver stain. An isolated antibody includes an antibody in situ within recombinant cells, since at least one component of the antibody's natural environment is not present. In some aspects, an isolated antibody is prepared by at least one purification step.
[0060] In some embodiments, an isolated antibody is purified to at least 80%, 85%, 90%, 95%, or 99% by weight. In some embodiments, an isolated antibody is provided as a solution comprising at least 85%, 90%, 95%, 98%, 99% to 100% by weight of an antibody, the remainder of the weight comprising the weight of other solutes dissolved in the solvent.
[0061] “Affinity” refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K.sub.D). Affinity can be measured by common methods known in the art, including those described herein. Affinity can be determined, for example, using surface plasmon resonance (SPR) technology, such as a Biacore® instrument.
[0062] With regard to the binding of an antibody to a target molecule, the terms “specific binding,” “specifically binds to,” “specific for,” “selectively binds,” and “selective for” a particular antigen (e.g., a polypeptide target) or an epitope on a particular antigen mean binding that is measurably different from a non-specific or non-selective interaction. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule. Specific binding can also be determined by competition with a control molecule that is similar to the target, such as an excess of non-labeled target. In that case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by the excess non-labeled target.
[0063] The term “k.sub.d” (sec.sup.−1), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. This value is also referred to as the koff value.
[0064] The term “k.sub.a” (M.sup.−1×sec.sup.−1), as used herein, refers to the association rate constant of a particular antibody-antigen interaction. This value is also referred to as the k.sub.on value.
[0065] The term “K.sub.D” (M), as used herein, refers to the dissociation equilibrium constant of a particular antibody-antigen interaction. K.sub.D=k.sub.d/k.sub.a.
[0066] The term “K.sub.A” (M.sup.−1), as used herein, refers to the association equilibrium constant of a particular antibody-antigen interaction. K.sub.A=k.sub.a/k.sub.d.
[0067] An “affinity matured” antibody is one with one or more alterations in one or more CDRs or FRs that result in an improvement in the affinity of the antibody for its antigen, compared to a parent antibody which does not possess the alteration(s). In one embodiment, an affinity matured antibody has nanomolar or picomolar affinity for the target antigen. Affinity matured antibodies may be produced using a variety of methods known in the art. For example, Marks et al. (Bio/Technology, 1992, 10:779-783, incorporated by reference in its entirety) describes affinity maturation by V.sub.H and V.sub.L domain shuffling. Random mutagenesis of CDR and/or framework residues is described by, for example, Barbas et al. (Proc. Nat. Acad. Sci. USA., 1994, 91:3809-3813); Schier et al., Gene, 1995, 169:147-155; Yelton et al., J. Immunol., 1995, 155:1994-2004; Jackson et al., J. Immunol., 1995, 154:3310-33199; and Hawkins et al, J. Mol. Biol., 1992, 226:889-896, each of which is incorporated by reference in its entirety.
[0068] When used herein in the context of two or more antibodies, the term “competes with” or “cross-competes with” indicates that the two or more antibodies compete for binding to an antigen (e.g., CD39). In one exemplary assay, CD39 is coated on a plate and allowed to bind a first antibody, after which a second, labeled antibody is added. If the presence of the first antibody reduces binding of the second antibody, then the antibodies compete. The term “competes with” also includes combinations of antibodies where one antibody reduces binding of another antibody, but where no competition is observed when the antibodies are added in the reverse order. However, in some embodiments, the first and second antibodies inhibit binding of each other, regardless of the order in which they are added. In some embodiments, one antibody reduces binding of another antibody to its antigen by at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%.
[0069] The term “epitope” means a portion of an antigen capable of specific binding to an antibody. Epitopes frequently consist of surface-accessible amino acid residues and/or sugar side chains and may have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents. An epitope may comprise amino acid residues that are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding. The epitope to which an antibody binds can be determined using known techniques for epitope determination such as, for example, testing for antibody binding to CD39 variants with different point-mutations.
[0070] Percent “identity” between a polypeptide sequence and a reference sequence is defined as the percentage of amino acid residues in the polypeptide sequence that are identical to the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, MEGALIGN (DNASTAR), CLUSTALW, or CLUSTAL OMEGA software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
[0071] A “conservative substitution” or a “conservative amino acid substitution,” refers to the substitution of one or more amino acids with one or more chemically or functionally similar amino acids. Conservative substitution tables providing similar amino acids are well known in the art. Polypeptide sequences having such substitutions are known as “conservatively modified variants.” Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles. By way of example, the following groups of amino acids are considered conservative substitutions for one another.
TABLE-US-00002 Acidic Residues D and E Basic Residues K, R, and H Hydrophilic Uncharged Residues S, T, N, and Q Aliphatic Uncharged Residues G, A, V, L, and I Non-polar Uncharged Residues C, M, and P Aromatic Residues F, Y, and W Alcohol Group-Containing Residues S and T Aliphatic Residues I, L, V, and M Cycloalkenyl-associated Residues F, H, W, and Y Hydrophobic Residues A, C, F, G, H, I, L, M, R, T, V, W, and Y Negatively Charged Residues D and E Polar Residues C, D, E, H, K, N, Q, R, S, and T Positively Charged Residues H, K, and R Small Residues A, C, D, G, N, P, S, T, and V Very Small Residues A, G, and S Residues Involved in Turn A, C, D, E, G, H, K, Formation N, Q, R, S, P, and T Flexible Residues Q, T, K, S, G, P, D, E, and R Group 1 A, S, and T Group 2 D and E Group 3 N and Q Group 4 R and K Group 5 I, L, and M Group 6 F, Y, and W Group A A and G Group B D and E Group C N and Q Group D R, K, and H Group E I, L, M, V Group F F, Y, and W Group G S and T Group H C and M
Additional conservative substitutions may be found, for example, in Creighton, Proteins: Structures and Molecular Properties 2nd ed. (1993) W. H. Freeman & Co., New York, N.Y. An antibody generated by making one or more conservative substitutions of amino acid residues in a parent antibody is referred to as a “conservatively modified variant.”
[0072] The term “amino acid” refers to the twenty common naturally occurring amino acids. Naturally occurring amino acids include alanine (Ala; A), arginine (Arg; R), asparagine (Asn; N), aspartic acid (Asp; D), cysteine (Cys; C); glutamic acid (Glu; E), glutamine (Gln; Q), Glycine (Gly; G); histidine (His; H), isoleucine (Ile; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).
[0073] “Treating” or “treatment” of any disease or disorder refers, in certain embodiments, to ameliorating a disease or disorder that exists in a subject. In another embodiment, “treating” or “treatment” includes ameliorating at least one physical parameter, which may be indiscernible by the subject. In yet another embodiment, “treating” or “treatment” includes modulating the disease or disorder, either physically (e.g., stabilization of a discernible symptom) or physiologically (e.g., stabilization of a physical parameter) or both. In yet another embodiment, “treating” or “treatment” includes delaying or preventing the onset of the disease or disorder.
[0074] As used herein, the term “therapeutically effective amount” or “effective amount” refers to an amount of an antibody or composition that when administered to a subject is effective to treat a disease or disorder.
[0075] As used herein, the term “subject” means a mammalian subject. Exemplary subjects include, but are not limited to humans, monkeys, dogs, cats, mice, rats, cows, horses, camels, avians, goats, and sheep. In certain embodiments, the subject is a human. In some embodiments, the subject has cancer, an autoimmune disease or condition, and/or an infection that can be treated with an antibody provided herein. In some embodiments, the subject is a human that is suspected to have cancer, an autoimmune disease or condition, and/or an infection.
2. Antibodies
[0076] Provided herein are antibodies that selectively bind human CD39, as well as the nucleic acids that encode the antibodies. In some aspects, the antibody selectively binds to the extracellular domain of human CD39.
[0077] In some embodiments, the antibody binds to homologs of human CD39. In some aspects, the antibody binds to a homolog of human CD39 from a species selected from monkeys, mice, dogs, cats, rats, cows, horses, goats, and sheep. In some aspects, the homolog is a cynomolgus monkey homolog. In some aspects, the homolog is a murine homolog.
[0078] In some embodiments, the antibody has one or more CDRs having particular lengths, in terms of the number of amino acid residues. In some embodiments, the Chothia CDR-H1 of the antibody is 6, 7, 8, or 9 residues in length. In some embodiments, the Kabat CDR-H1 of the antibody is 4, 5, 6, or 7 residues in length. In some embodiments, the Chothia CDR-H2 of the antibody is 5, 6, or 7 residues in length. In some embodiments, the Kabat CDR-H2 of the antibody is 15, 16, 17, or 18 residues in length. In some embodiments, the Kabat/Chothia CDR-H3 of the antibody is 5, 6, 7, 8, 9, 10, 11, or 12 residues in length.
[0079] In some aspects, the Kabat/Chothia CDR-L1 of the antibody is 9, 10, 11, 12, 13, 14, 15, or 16 residues in length. In some aspects, the Kabat/Chothia CDR-L2 of the antibody is 6, 7, or 8 residues in length. In some aspects, the Kabat/Chothia CDR-L3 of the antibody is 8, 9, 10, 11, or 12 residues in length.
[0080] In some embodiments, the antibody comprises a light chain. In some aspects, the light chain is a kappa light chain. In some aspects, the light chain is a lambda light chain.
[0081] In some embodiments, the antibody comprises a heavy chain. In some aspects, the heavy chain is an IgA. In some aspects, the heavy chain is an IgD. In some aspects, the heavy chain is an IgE. In some aspects, the heavy chain is an IgG. In some aspects, the heavy chain is an IgM. In some aspects, the heavy chain is an IgG1. In some aspects, the heavy chain is an IgG2. In some aspects, the heavy chain is an IgG3. In some aspects, the heavy chain is an IgG4. In some aspects, the heavy chain is an IgA1. In some aspects, the heavy chain is an IgA2.
[0082] In some embodiments, the antibody is an antibody fragment. In some aspects, the antibody fragment is an Fv fragment. In some aspects, the antibody fragment is a Fab fragment. In some aspects, the antibody fragment is a F(ab′).sub.2 fragment. In some aspects, the antibody fragment is a Fab′ fragment. In some aspects, the antibody fragment is an scFv (sFv) fragment. In some aspects, the antibody fragment is an scFv-Fc fragment.
[0083] In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the antibody is a polyclonal antibody.
[0084] In some embodiments, the antibody is a chimeric antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, the antibody is a human antibody.
[0085] In some embodiments, the antibody is an affinity matured antibody. In some aspects, the antibody is an affinity matured antibody derived from an illustrative sequence provided in this disclosure.
[0086] In some aspects, the antibody inhibits conversion by CD39 of ATP to ADP and/or ADP to AMP. In some aspects, the antibody decreases the levels of phosphate, ADP, AMP, and/or adenosine and/or increases the levels of ATP.
[0087] In some embodiments, the antibody increases proliferation of stimulated CD4.sup.+ and CD8.sup.+ T cells. In some embodiments, the antibody increases stimulated PBMC secretion of INF-γ, TNF-α, IL-2, and/or IL-1β.
[0088] In some embodiments, the antibody increases a T effector cell function. In some embodiments, the antibody decreases the number of regulatory T cells in tissues or in circulation. In some embodiments, the antibody suppresses a regulatory or T cell activity. In some embodiments, the antibody increase B cell function. In some embodiments, the antibody increases antigen presenting cell function. In some embodiments, the antibody decreases or prevents activation of phospho antigen specific T cells selected from MAIT cells and gamma delta T cells.
[0089] In some aspects, the decrease is about or less than a 10% decrease, about or less than a 20% decrease, about or less than a 30% decrease, about or less than a 40% decrease, about or less than a 50% decrease, about or less than a 60% decrease, about or less than a 70% decrease, about or less than an 80% decrease, about or less than a 90% decrease, or about a complete decrease. In some aspects, the increase is about or greater than a 10% increase, about or greater than a 20% increase, about or greater than a 30% increase, about or greater than a 40% increase, about or greater than a 50% increase, about or greater than a 60% increase, about or greater than a 70% increase, about or greater than an 80% increase, about or greater than a 90% increase, or a complete increase.
[0090] Given that CD39 degrades ATP and ADP to adenosine, CD39 can be viewed as an immunological switch that shifts ATP-driven pro-inflammatory immune cell activity toward an anti-inflammatory state mediated by adenosine. CD39 has a role in regulating the function of several immune cell types, including lymphocytes, neutrophils, monocytes/macrophages, dendritic cells, and endothelial cells and shifting the switch can have a significant impact on disease. For example, the generation of adenosine via CD39 is recognized as a major mechanism of regulatory T cell (Treg) immunosuppressive function.
[0091] The antibodies provided herein may be useful for the treatment of a variety of diseases and conditions, including cancers, autoimmune diseases, and infections. In some embodiments, the antibody inhibits CD39 function on tumor cells. In some embodiments, the antibody inhibits angiogenesis.
[0092] The frequency of CD39.sup.+ Tregs and the expression on the cell surface is increased in some human cancers, and the importance of CD39.sup.+ Tregs in promoting tumor growth and metastasis has been demonstrated using several in vivo models. Immunohistochemical staining of normal and tumor tissues has revealed that CD39 expression is significantly higher in several types of human cancer than in normal tissues. In cancer specimens, CD39 is expressed by infiltrating lymphocytes, the tumor stroma, and/or tumor cells. CD39 in cancer cells displays ATPase activity and generates adenosine. CD39.sup.+ cancer cells inhibited the proliferation of CD4 and CD8 T cells and the generation of cytotoxic effector CD8 T cells (CTL) in a CD39− and adenosine-dependent manner.
2.1. CDR-H3 Sequences
[0093] In some embodiments, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 82-109. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 93. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 96. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 102. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 103. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 104. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109.
[0094] In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.2. V.SUB.H .Sequences Comprising Illustrative CDRs
[0095] In some embodiments, the antibody comprises a V.sub.H sequence comprising one or more CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-H sequences provided in this disclosure, and variants thereof.
2.2.1. V.SUB.H .Sequences Comprising Illustrative Kabat CDRs
[0096] In some embodiments, the antibody comprises a V.sub.H sequence comprising one or more Kabat CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Kabat CDR-H sequences provided in this disclosure, and variants thereof.
2.2.1.1. Kabat CDR-H3
[0097] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 82-109. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 93. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 96. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 102. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 103. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 104. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109.
2.2.1.2. Kabat CDR-H2
[0098] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 63-81. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 63. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 64. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 65. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 66. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 67. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 68. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 69. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 70. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 71. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 72. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 73. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 74. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 75. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 76. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 77. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 78. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 79. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 80. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 81.
2.2.1.3. Kabat CDR-H1
[0099] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 25-45. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 25. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 26. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 27. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 28. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 29. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 30. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 31. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 32. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 33. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 34. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 35. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 36. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 37. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 38. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 39. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 40. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 41. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 42. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 43. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 44. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 45.
2.2.1.4. Kabat CDR-H3+Kabat CDR-H2
[0100] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 82-109, and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 63-81. In some aspects, the Kabat CDR-H3 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V.sub.H sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H3 and Kabat CDR-H2 are both from a single illustrative V.sub.H sequence selected from SEQ ID NOs: 179-218.
2.2.1.5. Kabat CDR-H3+Kabat CDR-H1
[0101] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 82-109, and a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 25-45. In some aspects, the Kabat CDR-H3 sequence and the Kabat CDR-H1 sequence are both from a single illustrative V.sub.H sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H3 and Kabat CDR-H1 are both from a single illustrative V.sub.H sequence selected from SEQ ID NOs: 179-218.
2.2.1.6. Kabat CDR-H1+Kabat CDR-H2
[0102] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 25-45 and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 63-81. In some aspects, the Kabat CDR-H1 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V.sub.H sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H1 and Kabat CDR-H2 are both from a single illustrative V.sub.H sequence selected from SEQ ID NOs: 179-218.
2.2.1.7. Kabat CDR-H1+Kabat CDR-H2+Kabat CDR-H3
[0103] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 25-45, a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 63-81, and a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 82-109. In some aspects, the Kabat CDR-H1 sequence, Kabat CDR-H2 sequence, and Kabat CDR-H3 sequence are all from a single illustrative V.sub.H sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H1, Kabat CDR-H2, and Kabat CDR-H3 are all from a single illustrative V.sub.H sequence selected from SEQ ID NOs: 179-218.
[0104] In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 83. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 27, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 84. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 85. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 86. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 66, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 27, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 28, a Kabat CDR-H2 sequence comprising SEQ ID NO: 67, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 29, a Kabat CDR-H2 sequence comprising SEQ ID NO: 68, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 88. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 32, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 89. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 34, a Kabat CDR-H2 sequence comprising SEQ ID NO: 72, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 91. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 92. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 35, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 93. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 92. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 36, a Kabat CDR-H2 sequence comprising SEQ ID NO: 72, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 73, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 37, a Kabat CDR-H2 sequence comprising SEQ ID NO: 74, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 75, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 94. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 39, a Kabat CDR-H2 sequence comprising SEQ ID NO: 76, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 95. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 40, a Kabat CDR-H2 sequence comprising SEQ ID NO: 76, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 96. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 39, a Kabat CDR-H2 sequence comprising SEQ ID NO: 76, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 94. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 97. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 41, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 98. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 41, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 99. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 41, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 100. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 75, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 101. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 42, a Kabat CDR-H2 sequence comprising SEQ ID NO: 78, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 102. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 75, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 103. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 43, a Kabat CDR-H2 sequence comprising SEQ ID NO: 79, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 104. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 103. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 106. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 107. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 44, a Kabat CDR-H2 sequence comprising SEQ ID NO: 80, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 108. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 45, a Kabat CDR-H2 sequence comprising SEQ ID NO: 81, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 109.
[0105] In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 83. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 84. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 85. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 86. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 84. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 86. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 27, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 83. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 27, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 86. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 93. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 73, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 72, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 32, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 72, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 93. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 93. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 34, a Kabat CDR-H2 sequence comprising SEQ ID NO: 72, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 35, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 35, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 39, a Kabat CDR-H2 sequence comprising SEQ ID NO: 76, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 94.
2.2.1.8. Variants of V.SUB.H .Sequences Comprising Illustrative Kabat CDRs
[0106] In some embodiments, the V.sub.H sequences provided herein comprise a variant of an illustrative Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.
[0107] In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H3 sequence provided in this disclosure. In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H3 sequences provided in this disclosure. In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
[0108] In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H2 sequence provided in this disclosure. In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H2 sequences provided in this disclosure. In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
[0109] In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H1 sequence provided in this disclosure. In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H1 sequences provided in this disclosure. In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.2.2. V.SUB.H .Sequences Comprising Illustrative Chothia CDRs
[0110] In some embodiments, the antibody comprises a V.sub.H sequence comprising one or more Chothia CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Chothia CDR-H sequences provided in this disclosure, and variants thereof.
2.2.2.1. Chothia CDR-H3
[0111] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 82-109. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 93. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 96. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 102. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 103. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 104. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109.
2.2.2.2. Chothia CDR-H2
[0112] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 46-62. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 46. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 47. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 48. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 49. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 50. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 51. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 52. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 53. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 54. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 55. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 56. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 57. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 58. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 59. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 60. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 61. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 62.
2.2.2.3. Chothia CDR-H1
[0113] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 1-24. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 1. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 2. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 3. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 4. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 5. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 6. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 7. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 8. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 9. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 10. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 11. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 12. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 13. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 14. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 15. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 16. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 17. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 18. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 19. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 20. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 21. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 22. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 23. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 24.
2.2.2.4. Chothia CDR-H3+Chothia CDR-H2
[0114] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 82-109, and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 46-62. In some aspects, the Chothia CDR-H3 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V.sub.H sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H3 and Chothia CDR-H2 are both from a single illustrative V.sub.H sequence selected from SEQ ID NOs: 179-218.
2.2.2.5. Chothia CDR-H3+Chothia CDR-H1
[0115] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 82-109, and a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 1-24. In some aspects, the Chothia CDR-H3 sequence and the Chothia CDR-H1 sequence are both from a single illustrative V.sub.H sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H3 and Chothia CDR-H1 are both from a single illustrative V.sub.H sequence selected from SEQ ID NOs: 179-218.
2.2.2.6. Chothia CDR-H1+Chothia CDR-H2
[0116] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 1-24 and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 46-62. In some aspects, the Chothia CDR-H1 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V.sub.H sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H1 and Chothia CDR-H2 are both from a single illustrative V.sub.H sequence selected from SEQ ID NOs: 179-218.
2.2.2.7. Chothia CDR-H1+Chothia CDR-H2+Chothia CDR-H3
[0117] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 1-24, a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 46-62, and a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 82-109. In some aspects, the Chothia CDR-H1 sequence, Chothia CDR-H2 sequence, and Chothia CDR-H3 sequence are all from a single illustrative V.sub.H sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H1, Chothia CDR-H2, and Chothia CDR-H3 are all from a single illustrative V.sub.H sequence selected from SEQ ID NOs: 179-218.
[0118] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 83. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 84. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 85. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 86. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 4, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 5, a Chothia CDR-H2 sequence comprising SEQ ID NO: 49, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 50, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 88. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 9, a Chothia CDR-H2 sequence comprising SEQ ID NO: 53, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 89. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 54, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 91. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 12, a Chothia CDR-H2 sequence comprising SEQ ID NO: 53, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 92. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 13, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 93. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 92. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 14, a Chothia CDR-H2 sequence comprising SEQ ID NO: 54, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 15, a Chothia CDR-H2 sequence comprising SEQ ID NO: 55, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 16, a Chothia CDR-H2 sequence comprising SEQ ID NO: 56, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 94. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 18, a Chothia CDR-H2 sequence comprising SEQ ID NO: 57, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 95. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 19, a Chothia CDR-H2 sequence comprising SEQ ID NO: 57, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 96. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 21, a Chothia CDR-H2 sequence comprising SEQ ID NO: 57, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 94. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 97. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 22, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 98. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 22, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 99. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 22, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 100. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 101. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 59, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 102. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 103. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 23, a Chothia CDR-H2 sequence comprising SEQ ID NO: 60, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 104. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 105. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 106. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 107. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 61, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 108. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 62, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 109.
[0119] In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 83. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 84. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 85. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 86. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 84. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 86. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 83. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 86. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 53, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 93. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 55, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 54, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 53, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 9, a Chothia CDR-H2 sequence comprising SEQ ID NO: 53, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 53, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 54, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 53, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 93. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 93. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 54, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 12, a Chothia CDR-H2 sequence comprising SEQ ID NO: 53, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 13, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 13, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 15, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 18, a Chothia CDR-H2 sequence comprising SEQ ID NO: 57, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 94.
2.2.2.8. Variants of V.SUB.H .Sequences Comprising Illustrative Chothia CDRs
[0120] In some embodiments, the V.sub.H sequences provided herein comprise a variant of an illustrative Chothia CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.
[0121] In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H3 sequence provided in this disclosure. In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H3 sequences provided in this disclosure. In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
[0122] In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H2 sequence provided in this disclosure. In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H2 sequences provided in this disclosure. In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
[0123] In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H1 sequence provided in this disclosure. In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H1 sequences provided in this disclosure. In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.3. V.SUB.H .Sequences
[0124] In some embodiments, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 179-218. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 179. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 180. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 181. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 182. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 183. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 184. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 185. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 186. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 187. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 188. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 189. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 190. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 191. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 192. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 193. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 194. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 195. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 196. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 197. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 198. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 199. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 200. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 201. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 202. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 203. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 204. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 205. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 206. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 207. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 208. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 209. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 210. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 211. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 212. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 213. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 214. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 215. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 216. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 217. In some aspects, the antibody comprises a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 218.
2.3.1. Variants of V.SUB.H .Sequences
[0125] In some embodiments, the V.sub.H sequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V.sub.H sequence provided in this disclosure.
[0126] In some aspects, the V.sub.H sequence comprises, consists of, or consists essentially of a variant of an illustrative V.sub.H sequence provided in this disclosure. In some aspects, the V.sub.H sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of the illustrative V.sub.H sequences provided in this disclosure.
[0127] In some embodiments, the V.sub.H sequence comprises, consists of, or consists essentially of any of the illustrative V.sub.H sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.4. CDR-L3 Sequences
[0128] In some embodiments, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 141-166. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 141. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 142. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 143. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 144. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 145. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 146. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 147. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 148. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 149. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 150. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 151. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 152. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 153. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 154. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 155. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 156. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 157. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 158. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 159. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 160. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 161. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 162. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 163. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 164. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 165. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 166.
[0129] In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.5. V.SUB.L .Sequences Comprising Illustrative CDRs
[0130] In some embodiments, the antibody comprises a V.sub.L sequence comprising one or more CDR-L sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-L sequences provided in this disclosure, and variants thereof 2.5.1. CDR-L3
[0131] In some embodiments, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 141-166. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 142. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 143. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 144. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 145. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 146. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 147. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 149. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 150. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 151. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 152. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 153. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 154. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 155. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 156. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 157. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 158. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 159. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 160. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 161. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 162. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 163. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 164. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 165. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 166.
2.5.2. CDR-L2
[0132] In some embodiments, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 125-140. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 125. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 126. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 127. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 128. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 129. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 130. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 131. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 132. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 133. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 134. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 135. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 136. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 137. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 138. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 139. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 140.
2.5.3. CDR-L1
[0133] In some embodiments, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 110-124. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 110. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 111. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 112. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 113. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 114. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 115. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 116. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 117. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 118. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 119. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 120. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 121. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 122. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 123. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 124.
2.5.4. CDR-L3+CDR-L2
[0134] In some embodiments, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 141-166 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 125-140. In some aspects, the CDR-L3 sequence and the CDR-L2 sequence are both from a single illustrative V.sub.L sequence provided in this disclosure. For example, in some aspects, the CDR-L3 and CDR-L2 are both from a single illustrative V.sub.L sequence selected from SEQ ID NOs: 219-248.
2.5.5. CDR-L3+CDR-L1
[0135] In some embodiments, the antibody comprises a V.sub.L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 141-166 and a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 110-124. In some aspects, the CDR-L3 sequence and the CDR-L1 sequence are both from a single illustrative V.sub.L sequence provided in this disclosure. For example, in some aspects, the CDR-L3 and CDR-L1 are both from a single illustrative V.sub.L sequence selected from SEQ ID NOs: 219-248.
2.5.6. CDR-L1+CDR-L2
[0136] In some embodiments, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 110-124 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 125-140. In some aspects, the CDR-L1 sequence and the CDR-L2 sequence are both from a single illustrative V.sub.L sequence provided in this disclosure. For example, in some aspects, the CDR-L1 and CDR-L2 are both from a single illustrative V.sub.L sequence selected from SEQ ID NOs: 219-248.
2.5.7. CDR-L1+CDR-L2+CDR-L3
[0137] In some embodiments, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 110-124, a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 125-140, and a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L1 sequence, CDR-L2 sequence, and CDR-L3 sequence are all from a single illustrative V.sub.L sequence provided in this disclosure. For example, in some aspects, the CDR-L1, CDR-L2, and CDR-L3 are all from a single illustrative V.sub.L sequence selected from SEQ ID NOs: 219-248.
[0138] In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 126, and a CDR-L3 sequence comprising SEQ ID NO: 142. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 127, and a CDR-L3 sequence comprising sequence selected from SEQ ID NO: 142. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence comprising SEQ ID NO: 143. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence comprising SEQ ID NO: 144. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 126, and a CDR-L3 sequence comprising SEQ ID NO: 145. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence comprising SEQ ID NO: 146. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence comprising SEQ ID NO: 147. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence comprising SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence comprising SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence comprising SEQ ID NO: 149. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence comprising SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence comprising SEQ ID NO: 149. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence comprising SEQ ID NO: 150. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence comprising SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence comprising SEQ ID NO: 151. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence comprising SEQ ID NO: 152. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence comprising SEQ ID NO: 152. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence comprising SEQ ID NO: 153. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence comprising SEQ ID NO: 154. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence comprising SEQ ID NO: 155. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence comprising SEQ ID NO: 156. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence comprising SEQ ID NO: 157. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence comprising SEQ ID NO: 158. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence comprising SEQ ID NO: 159. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence comprising SEQ ID NO: 160. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence comprising SEQ ID NO: 161. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence comprising SEQ ID NO: 162. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence comprising SEQ ID NO: 163. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence comprising SEQ ID NO: 164. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence comprising SEQ ID NO: 165. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence comprising SEQ ID NO: 166.
[0139] In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 144. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence comprising SEQ ID NO: 144. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 126, and a CDR-L3 sequence comprising sequence selected from SEQ ID NO: 144. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence comprising SEQ ID NO: 150. In some aspects, the antibody comprises a V.sub.L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence comprising SEQ ID NO: 150.
2.5.8. Variants of V.SUB.L .Sequences Comprising Illustrative CDR-Ls
[0140] In some embodiments, the V.sub.L sequences provided herein comprise a variant of an illustrative CDR-L3, CDR-L2, and/or CDR-L1 sequence provided in this disclosure.
[0141] In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
[0142] In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L2 sequence provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L2 sequences provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
[0143] In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L1 sequence provided in this disclosure. In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L1 sequences provided in this disclosure. In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.6. V.SUB.L .Sequences
[0144] In some embodiments, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 219-248. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 219. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 220. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 221. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 222. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 223. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 224. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 225. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 226. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 227. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 228. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 229. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 230. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 231. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 232. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 233. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 234. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 235. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 236. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 237. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 238. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 239. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 240. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 241. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 242. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 243. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 244. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 245. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 246. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 247. In some aspects, the antibody comprises a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 248.
2.6.1. Variants of V.SUB.L .Sequences
[0145] In some embodiments, the V.sub.L sequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V.sub.L sequence provided in this disclosure.
[0146] In some aspects, the V.sub.L sequence comprises, consists of, or consists essentially of a variant of an illustrative V.sub.L sequence provided in this disclosure. In some aspects, the V.sub.L sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.05% identity with any of the illustrative V.sub.L sequences provided in this disclosure.
[0147] In some embodiments, the V.sub.L sequence comprises, consists of, or consists essentially of any of the illustrative V.sub.L sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.7. Pairs
2.7.1. CDR-H3-CDR-L3 Pairs
[0148] In some embodiments, the antibody comprises a CDR-H3 sequence and a CDR-L3 sequence. In some aspects, the CDR-H3 sequence is part of a V.sub.H and the CDR-L3 sequence is part of a VL.
[0149] In some aspects, the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 82-109, and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 141-166.
[0150] In some aspects, the CDR-H3 sequence is SEQ ID NO: 82 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0151] In some aspects, the CDR-H3 sequence is SEQ ID NO: 83 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0152] In some aspects, the CDR-H3 sequence is SEQ ID NO: 84 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0153] In some aspects, the CDR-H3 sequence is SEQ ID NO: 85 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0154] In some aspects, the CDR-H3 sequence is SEQ ID NO: 86 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0155] In some aspects, the CDR-H3 sequence is SEQ ID NO: 87 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0156] In some aspects, the CDR-H3 sequence is SEQ ID NO: 88 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0157] In some aspects, the CDR-H3 sequence is SEQ ID NO: 89 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0158] In some aspects, the CDR-H3 sequence is SEQ ID NO: 90 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0159] In some aspects, the CDR-H3 sequence is SEQ ID NO: 91 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0160] In some aspects, the CDR-H3 sequence is SEQ ID NO: 92 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0161] In some aspects, the CDR-H3 sequence is SEQ ID NO: 93 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0162] In some aspects, the CDR-H3 sequence is SEQ ID NO: 94 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0163] In some aspects, the CDR-H3 sequence is SEQ ID NO: 95 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0164] In some aspects, the CDR-H3 sequence is SEQ ID NO: 96 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0165] In some aspects, the CDR-H3 sequence is SEQ ID NO: 97 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0166] In some aspects, the CDR-H3 sequence is SEQ ID NO: 98 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0167] In some aspects, the CDR-H3 sequence is SEQ ID NO: 99 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0168] In some aspects, the CDR-H3 sequence is SEQ ID NO: 100 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0169] In some aspects, the CDR-H3 sequence is SEQ ID NO: 101 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0170] In some aspects, the CDR-H3 sequence is SEQ ID NO: 102 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0171] In some aspects, the CDR-H3 sequence is SEQ ID NO: 103 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0172] In some aspects, the CDR-H3 sequence is SEQ ID NO: 104 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0173] In some aspects, the CDR-H3 sequence is SEQ ID NO: 105 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0174] In some aspects, the CDR-H3 sequence is SEQ ID NO: 106 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0175] In some aspects, the CDR-H3 sequence is SEQ ID NO: 107 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0176] In some aspects, the CDR-H3 sequence is SEQ ID NO: 108 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
[0177] In some aspects, the CDR-H3 sequence is SEQ ID NO: 109 and the CDR-L3 sequence is selected from SEQ ID NOs: 141-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 141. In some aspects, the CDR-L3 sequence is SEQ ID NO: 142. In some aspects, the CDR-L3 sequence is SEQ ID NO: 143. In some aspects, the CDR-L3 sequence is SEQ ID NO: 144. In some aspects, the CDR-L3 sequence is SEQ ID NO: 145. In some aspects, the CDR-L3 sequence is SEQ ID NO: 146. In some aspects, the CDR-L3 sequence is SEQ ID NO: 147. In some aspects, the CDR-L3 sequence is SEQ ID NO: 148. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
2.7.1.1. Variants of CDR-H3-CDR-L3 Pairs
[0178] In some embodiments, the CDR-H3-CDR-L3 pairs provided herein comprise a variant of an illustrative CDR-H3 and/or CDR-L1 sequence provided in this disclosure.
[0179] In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
[0180] In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.7.2. V.sub.H-V.sub.L Pairs
[0181] In some embodiments, the antibody comprises a V.sub.H sequence and a V.sub.L sequence.
[0182] In some aspects, the V.sub.H sequence is a V.sub.H sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 179-218 and the V.sub.L sequence is a V.sub.L sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 219-248.
[0183] In some aspects, the V.sub.H sequence is SEQ ID NO: 179 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0184] In some aspects, the V.sub.H sequence is SEQ ID NO: 180 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0185] In some aspects, the V.sub.H sequence is SEQ ID NO: 181 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0186] In some aspects, the V.sub.H sequence is SEQ ID NO: 182 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0187] In some aspects, the V.sub.H sequence is SEQ ID NO: 183 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0188] In some aspects, the V.sub.H sequence is SEQ ID NO: 184 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0189] In some aspects, the V.sub.H sequence is SEQ ID NO: 185 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0190] In some aspects, the V.sub.H sequence is SEQ ID NO: 186 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0191] In some aspects, the V.sub.H sequence is SEQ ID NO: 187 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0192] In some aspects, the V.sub.H sequence is SEQ ID NO: 188 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0193] In some aspects, the V.sub.H sequence is SEQ ID NO: 189 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0194] In some aspects, the V.sub.H sequence is SEQ ID NO: 190 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0195] In some aspects, the V.sub.H sequence is SEQ ID NO: 191 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0196] In some aspects, the V.sub.H sequence is SEQ ID NO: 192 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0197] In some aspects, the V.sub.H sequence is SEQ ID NO: 193 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0198] In some aspects, the V.sub.H sequence is SEQ ID NO: 194 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0199] In some aspects, the V.sub.H sequence is SEQ ID NO: 195 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0200] In some aspects, the V.sub.H sequence is SEQ ID NO: 196 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0201] In some aspects, the V.sub.H sequence is SEQ ID NO: 197 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0202] In some aspects, the V.sub.H sequence is SEQ ID NO: 198 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0203] In some aspects, the V.sub.H sequence is SEQ ID NO: 199 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0204] In some aspects, the V.sub.H sequence is SEQ ID NO: 200 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0205] In some aspects, the V.sub.H sequence is SEQ ID NO: 201 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0206] In some aspects, the V.sub.H sequence is SEQ ID NO: 202 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0207] In some aspects, the V.sub.H sequence is SEQ ID NO: 203 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0208] In some aspects, the V.sub.H sequence is SEQ ID NO: 204 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0209] In some aspects, the V.sub.H sequence is SEQ ID NO: 205 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0210] In some aspects, the V.sub.H sequence is SEQ ID NO: 206 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0211] In some aspects, the V.sub.H sequence is SEQ ID NO: 207 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0212] In some aspects, the V.sub.H sequence is SEQ ID NO: 208 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0213] In some aspects, the V.sub.H sequence is SEQ ID NO: 209 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0214] In some aspects, the V.sub.H sequence is SEQ ID NO: 210 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0215] In some aspects, the V.sub.H sequence is SEQ ID NO: 211 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0216] In some aspects, the V.sub.H sequence is SEQ ID NO: 212 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0217] In some aspects, the V.sub.H sequence is SEQ ID NO: 213 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0218] In some aspects, the V.sub.H sequence is SEQ ID NO: 214 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0219] In some aspects, the V.sub.H sequence is SEQ ID NO: 215 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0220] In some aspects, the V.sub.H sequence is SEQ ID NO: 216 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0221] In some aspects, the V.sub.H sequence is SEQ ID NO: 217 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
[0222] In some aspects, the V.sub.H sequence is SEQ ID NO: 218 and the V.sub.L sequence is selected from SEQ ID NOs: 219-248. In some aspects, the V.sub.L sequence is SEQ ID NO: 219. In some aspects, the V.sub.L sequence is SEQ ID NO: 220. In some aspects, the V.sub.L sequence is SEQ ID NO: 221. In some aspects, the V.sub.L sequence is SEQ ID NO: 222. In some aspects, the V.sub.L sequence is SEQ ID NO: 223. In some aspects, the V.sub.L sequence is SEQ ID NO: 224. In some aspects, the V.sub.L sequence is SEQ ID NO: 225. In some aspects, the V.sub.L sequence is SEQ ID NO: 226. In some aspects, the V.sub.L sequence is SEQ ID NO: 227. In some aspects, the V.sub.L sequence is SEQ ID NO: 228. In some aspects, the V.sub.L sequence is SEQ ID NO: 229. In some aspects, the V.sub.L sequence is SEQ ID NO: 230. In some aspects, the V.sub.L sequence is SEQ ID NO: 231. In some aspects, the V.sub.L sequence is SEQ ID NO: 232. In some aspects, the V.sub.L sequence is SEQ ID NO: 233. In some aspects, the V.sub.L sequence is SEQ ID NO: 234. In some aspects, the V.sub.L sequence is SEQ ID NO: 235. In some aspects, the V.sub.L sequence is SEQ ID NO: 236. In some aspects, the V.sub.L sequence is SEQ ID NO: 237. In some aspects, the V.sub.L sequence is SEQ ID NO: 238. In some aspects, the V.sub.L sequence is SEQ ID NO: 239. In some aspects, the V.sub.L sequence is SEQ ID NO: 240. In some aspects, the V.sub.L sequence is SEQ ID NO: 241. In some aspects, the V.sub.L sequence is SEQ ID NO: 242. In some aspects, the V.sub.L sequence is SEQ ID NO: 243. In some aspects, the V.sub.L sequence is SEQ ID NO: 244. In some aspects, the V.sub.L sequence is SEQ ID NO: 245. In some aspects, the V.sub.L sequence is SEQ ID NO: 246. In some aspects, the V.sub.L sequence is SEQ ID NO: 247. In some aspects, the V.sub.L sequence is SEQ ID NO: 248.
2.7.3. CDR-H1+CDR-H2+CDR-H3+CDR-L1+CDR-L2+CDR-L3
[0223] In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 83 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 126, and a CDR-L3 sequence SEQ ID NO: 142. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 27, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 84 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 85 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 86 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 127, and a CDR-L3 sequence SEQ ID NO: 142. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 66, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 143. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 144. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 27, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 126, and a CDR-L3 sequence SEQ ID NO: 145. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 28, a Kabat CDR-H2 sequence comprising SEQ ID NO: 67, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence SEQ ID NO: 146. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 29, a Kabat CDR-H2 sequence comprising SEQ ID NO: 68, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence SEQ ID NO: 147. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 88 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 32, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 89 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 34, a Kabat CDR-H2 sequence comprising SEQ ID NO: 72, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 91 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 92 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 35, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 93 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence SEQ ID NO: 150. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 92 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 36, a Kabat CDR-H2 sequence comprising SEQ ID NO: 72, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 73, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 37, a Kabat CDR-H2 sequence comprising SEQ ID NO: 74, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 75, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 94 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 39, a Kabat CDR-H2 sequence comprising SEQ ID NO: 76, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 95 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 152. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 40, a Kabat CDR-H2 sequence comprising SEQ ID NO: 76, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 96 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence SEQ ID NO: 152. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 39, a Kabat CDR-H2 sequence comprising SEQ ID NO: 76, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 94 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 152. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 97 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 153. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 41, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 98 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 154. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 41, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 99 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 41, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 100 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 156. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 75, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 101 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 157. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 42, a Kabat CDR-H2 sequence comprising SEQ ID NO: 78, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 102 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 158. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 75, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 103 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 159. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 43, a Kabat CDR-H2 sequence comprising SEQ ID NO: 79, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 104 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 160. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 75, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 103 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 161. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 105 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence SEQ ID NO: 162. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 106 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 163. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 38, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 107 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 164. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 44, a Kabat CDR-H2 sequence comprising SEQ ID NO: 80, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 108 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 165. In some aspects, the antibody comprises a V.sub.H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 45, a Kabat CDR-H2 sequence comprising SEQ ID NO: 81, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 109 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 166.
[0224] In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 83 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 126, and a CDR-L3 sequence SEQ ID NO: 142. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 84 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 85 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 86 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 127, and a CDR-L3 sequence SEQ ID NO: 142. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 4, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 143. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 144. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 126, and a CDR-L3 sequence SEQ ID NO: 145. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 5, a Chothia CDR-H2 sequence comprising SEQ ID NO: 49, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence SEQ ID NO: 146. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 50, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence SEQ ID NO: 147. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 141. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 88 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 9, a Chothia CDR-H2 sequence comprising SEQ ID NO: 53, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 89 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 54, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 91 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 12, a Chothia CDR-H2 sequence comprising SEQ ID NO: 53, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 92 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 13, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 93 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence SEQ ID NO: 150. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 92 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 14, a Chothia CDR-H2 sequence comprising SEQ ID NO: 54, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 15, a Chothia CDR-H2 sequence comprising SEQ ID NO: 55, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 16, a Chothia CDR-H2 sequence comprising SEQ ID NO: 56, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 148. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 94 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 18, a Chothia CDR-H2 sequence comprising SEQ ID NO: 57, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 95 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 135 and a CDR-L3 sequence SEQ ID NO: 152. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 19, a Chothia CDR-H2 sequence comprising SEQ ID NO: 57, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 96 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence SEQ ID NO: 152. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 21, a Chothia CDR-H2 sequence comprising SEQ ID NO: 57, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 94 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 152. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 97 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 153. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 22, a Chothia CDR-H2 sequence comprising SEQ ID NO: 52, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 98 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 154. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 22, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 99 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 22, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 100 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 156. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 101 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 157. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 59, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 102 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 158. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 103 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 159. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 23, a Chothia CDR-H2 sequence comprising SEQ ID NO: 60, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 104 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 160. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 103 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 161. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 105 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence SEQ ID NO: 162. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 106 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 163. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 51, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 107 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 164. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 61, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 108 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 165. In some aspects, the antibody comprises a V.sub.H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 17, a Chothia CDR-H2 sequence comprising SEQ ID NO: 62, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 109 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 125, and a CDR-L3 sequence SEQ ID NO: 166.
2.7.3.1. Variants of V.sub.H-V.sub.L Pairs
[0225] In some embodiments, the V.sub.H-V.sub.L pairs provided herein comprise a variant of an illustrative V.sub.H and/or V.sub.L sequence provided in this disclosure.
[0226] In some aspects, the V.sub.H sequence comprises, consists of, or consists essentially of a variant of an illustrative V.sub.H sequence provided in this disclosure. In some aspects, the V.sub.H sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.1% identity with any of the illustrative V.sub.H sequences provided in this disclosure.
[0227] In some embodiments, the V.sub.H sequence comprises, consists of, or consists essentially of any of the illustrative V.sub.H sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
[0228] In some aspects, the V.sub.L sequence comprises, consists of, or consists essentially of a variant of an illustrative V.sub.L sequence provided in this disclosure. In some aspects, the V.sub.L sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.05% identity with any of the illustrative V.sub.L sequences provided in this disclosure.
[0229] In some embodiments, the V.sub.L sequence comprises, consists of, or consists essentially of any of the illustrative V.sub.L sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.7.4 HC+LC
[0230] In some embodiments, the antibody comprises or consists of one or more heavy chains consisting of an HC sequence and one or more light chains consisting of an LC sequence. In some embodiments, the antibody comprises or consists of two identical heavy chains consisting of an HC sequence and two identical light chains consisting of an LC sequence.
[0231] In some embodiments, the HC sequence is an HC sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 255, SEQ ID NO: 257, SEQ ID NO: 259, SEQ ID NO: 261, SEQ ID NO: 263, SEQ ID NO: 265, SEQ ID NO: 267, SEQ ID NO: 269, SEQ ID NO: 271, SEQ ID NO: 273, SEQ ID NO: 275, SEQ ID NO: 277, SEQ ID NO: 279, SEQ ID NO: 281, SEQ ID NO: 283, SEQ ID NO: 285, SEQ ID NO: 287, SEQ ID NO: 289, SEQ ID NO: 291, SEQ ID NO: 293, SEQ ID NO: 295, or SEQ ID NO: 297 and the LC sequence is a LC sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 256, SEQ ID NO: 258, SEQ ID NO: 260, SEQ ID NO: 262, SEQ ID NO: 264, SEQ ID NO: 266, SEQ ID NO: 268, SEQ ID NO: 270, SEQ ID NO: 272, SEQ ID NO: 274, SEQ ID NO: 276, SEQ ID NO: 278, SEQ ID NO: 280, SEQ ID NO: 282, SEQ ID NO: 284, SEQ ID NO: 286, SEQ ID NO: 288, SEQ ID NO: 290, SEQ ID NO: 292, SEQ ID NO: 294, SEQ ID NO: 296, or SEQ ID NO: 298. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 255, SEQ ID NO: 257, SEQ ID NO: 259, SEQ ID NO: 261, SEQ ID NO: 263, SEQ ID NO: 265, SEQ ID NO: 267, SEQ ID NO: 269, SEQ ID NO: 271, SEQ ID NO: 273, SEQ ID NO: 275, SEQ ID NO: 277, SEQ ID NO: 279, SEQ ID NO: 281, SEQ ID NO: 283, SEQ ID NO: 285, SEQ ID NO: 287, SEQ ID NO: 289, SEQ ID NO: 291, SEQ ID NO: 293, SEQ ID NO: 295, or SEQ ID NO: 297 and the LC sequence is an LC sequence consisting of SEQ ID NO: 256, SEQ ID NO: 258, SEQ ID NO: 260, SEQ ID NO: 262, SEQ ID NO: 264, SEQ ID NO: 266, SEQ ID NO: 268, SEQ ID NO: 270, SEQ ID NO: 272, SEQ ID NO: 274, SEQ ID NO: 276, SEQ ID NO: 278, SEQ ID NO: 280, SEQ ID NO: 282, SEQ ID NO: 284, SEQ ID NO: 286, SEQ ID NO: 288, SEQ ID NO: 290, SEQ ID NO: 292, SEQ ID NO: 294, SEQ ID NO: 296, or SEQ ID NO: 298.
[0232] In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 255 and the LC sequence is an LC sequence consisting of SEQ ID NO: 256. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 257 and the LC sequence is an LC sequence consisting of SEQ ID NO: 258. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 259 and the LC sequence is an LC sequence consisting of SEQ ID NO: 260. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 261 and the LC sequence is an LC sequence consisting of SEQ ID NO: 262. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 263 and the LC sequence is an LC sequence consisting of SEQ ID NO: 264. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 265 and the LC sequence is an LC sequence consisting of SEQ ID NO: 266. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 267 and the LC sequence is an LC sequence consisting of SEQ ID NO: 268. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 269 and the LC sequence is an LC sequence consisting of SEQ ID NO: 270. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 271 and the LC sequence is an LC sequence consisting of SEQ ID NO: 272. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 273 and the LC sequence is an LC sequence consisting of SEQ ID NO: 274. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 275 and the LC sequence is an LC sequence consisting of SEQ ID NO: 276. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 277 and the LC sequence is an LC sequence consisting of SEQ ID NO: 278. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 279 and the LC sequence is an LC sequence consisting of SEQ ID NO: 280. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 281 and the LC sequence is an LC sequence consisting of SEQ ID NO: 282. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 283 and the LC sequence is an LC sequence consisting of SEQ ID NO: 284. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 285 and the LC sequence is an LC sequence consisting of SEQ ID NO: 286. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 287 and the LC sequence is an LC sequence consisting of SEQ ID NO: 288. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 289 and the LC sequence is an LC sequence consisting of SEQ ID NO: 290. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 291 and the LC sequence is an LC sequence consisting of SEQ ID NO: 292. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 293 and the LC sequence is an LC sequence consisting of SEQ ID NO: 294. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 295 and the LC sequence is an LC sequence consisting of SEQ ID NO: 296. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 297 and the LC sequence is an LC sequence consisting of SEQ ID NO: 298.
2.8. Consensus Sequences
[0233] In some embodiments, provided herein are anti-CD39 antibodies comprising one or more sequences defined by consensus sequences. Each consensus sequence is based, at least in part, on one or more alignments of two or more useful anti-CD39 CDR sequences provided in this disclosure. Based on such alignments, a person of skill in the art would recognize that different amino acid residues may useful in certain positions of the CDRs. Accordingly, each consensus sequence encompasses two or more useful anti-CD39 CDR sequences.
2.8.1. CDR-H3 Consensus Sequences
[0234] In some embodiments, the antibody comprises a CDR-H3 sequence defined by the consensus sequence G-K-R-E-G-G-T-E-Y-L-R-γ.sub.12 (SEQ ID NOS: 82-86), where γ.sub.12 is H, K, S, N, or V.
[0235] In some aspects, γ.sub.12 is H. In some aspects, γ.sub.12 is K In some aspects, γ.sub.12 is S. In some aspects, γ.sub.12 is N. In some aspects, γ.sub.12 is V.
[0236] In some embodiments, the antibody comprises a CDR-H3 sequence defined by the consensus sequence E-S-G-Φ.sub.4-Y-R-D-H-R-L-Φ.sub.11-V (SEQ ID NOS: 94-96), where Φ.sub.4 is G or T and Φ.sub.11 is D or G.
[0237] In some aspects, Φ.sub.4 is G when Φ.sub.11 is D or G. In some aspects, Φ.sub.11 is D when Φ.sub.4 is G or T.
[0238] In some aspects, Φ.sub.4 is G and Φ.sub.11 is D. In some aspects, Φ.sub.4 is T and Φ.sub.11 is D. In some aspects, Φ.sub.4 is G and Φ.sub.11 is G.
[0239] In some embodiments, the antibody comprises a CDR-H3 sequence defined by the consensus sequence G-G-A-K-Y-A-.sub.7-
.sub.8-
.sub.9-G-M-D-V (SEQ ID NOS: 87-93), where
.sub.7 is S, V, G, or R;
.sub.8 is T, Q, K, G, or R; and
.sub.9 is Y, H, L, or W.
[0240] In some aspects, .sub.7 is S when
.sub.5 is T, Q, or K and
.sub.9 is Y, H, L, or W. In some aspects,
.sub.8 is T when
.sub.7 is S or R and
.sub.9 is Y or H. In some aspects,
.sub.9 is Y when
.sub.7 is S, V, G, or R and
.sub.8 is T, G, or R.
[0241] In some aspects, .sub.7 is S when
.sub.8 is T and
.sub.9 is Y. In some aspects,
.sub.7 is S when
.sub.8 is T and
.sub.9 is H. In some aspects,
.sub.7 is S when
.sub.8 is Q and
.sub.9 is L. In some aspects,
.sub.7 is S when
.sub.8 is K and
.sub.9 is W. In some aspects,
.sub.7 is V when
.sub.8 is G and
.sub.9 is Y. In some aspects,
.sub.7 is G when
.sub.8 is R and
.sub.9 is Y. In some aspects,
.sub.7 is R when
.sub.8 is T and
.sub.9 is Y.
2.8.2. Chothia CDR-H2 Consensus Sequences
[0242] In some embodiments, the antibody comprises a Chothia CDR-H2 sequence defined by the consensus sequence N-P-ε.sub.5-ε.sub.6-G-S-T (SEQ ID NOS: 46-48), where ε.sub.5 is L, R, or S and ε.sub.6 is G or V.
[0243] In some aspects, when ε.sub.5 is S, ε.sub.6 is G or V. In some aspects, when ε.sub.6 is G, ε.sub.5 is S, L, or R.
[0244] In some aspects, when ε.sub.5 is L, ε.sub.6 is G. In some aspects, when ε.sub.5 is S, ε.sub.6 is G. In some aspects, when ε.sub.5 is S, ε.sub.6 is V. In some aspects, when ε.sub.5 is R, ε.sub.6 is G.
[0245] In some embodiments, the antibody comprises a Chothia CDR-H2 sequence defined by the consensus sequence α.sub.3-α.sub.4-α.sub.5-α.sub.6-G-T-A (SEQ ID NOS: 51-54), where α.sub.3 is I or L or is absent; α.sub.4 is P or is absent; and as is I, G, or R; and α.sub.6 is A, F, or G.
[0246] In some aspects, when α.sub.3, is I, α.sub.4 is P; as is I or R; and α.sub.6 is F or G. In some aspects, when α.sub.3, is L, α.sub.4 is P; as is I; and α.sub.6 is A or G. In some aspects, when α.sub.4, is P, α.sub.3 is I or L; as is I or R; and α.sub.6 is A, F, or G. In some aspects, when as, is I, α.sub.3 is I or L; α.sub.4 is P; and α.sub.6 is A, F, or G. In some aspects, when α.sub.6, is F, α.sub.3 is I or is absent; α.sub.4 is P or is absent; and as is I or G. In some aspects, when α.sub.6, is G, α.sub.3 is I or L; α.sub.4 is P; and as is I or R.
[0247] In some aspects, when α.sub.3 is L, α.sub.4 is P; as is I; and α.sub.6 is A. In some aspects, when α.sub.3 is I, α.sub.4 is P; as is I; and α.sub.6 is F. In some aspects, when α.sub.3 is absent, α.sub.4 is absent; as is G; and α.sub.6 is F. In some aspects, when α.sub.3 is L, α.sub.4 is P; as is I; and α.sub.6 is G. In some aspects, when α.sub.3 is I, α.sub.4 is P; as is R; and α.sub.6 is G.
[0248] In some embodiments, the antibody comprises a Chothia CDR-H2 sequence defined by the consensus sequence I-P-β.sub.5-β.sub.6-G-β.sub.8-A (SEQ ID NOS: 56-60), where β.sub.5 is I, E, S, or T; β.sub.6 is F, I, or S; and β.sub.8 is I or T.
[0249] In some aspects, when β.sub.5 is I, β.sub.6 is F or S and β.sub.8 is T. In some aspects, when β.sub.6 is F, β.sub.5 is E, I, or T and β.sub.8 is I or T. In some aspects, when β.sub.8 is T, β.sub.5 is I, S, or T and β.sub.6 is F, I, or S.
[0250] In some aspects, when β.sub.5 is I, β.sub.6 is F and β.sub.8 is T. In some aspects, when β.sub.5 is E, β.sub.6 is F and β.sub.8 is I. In some aspects, when β.sub.5 is S, β.sub.6 is I and β.sub.8 is T. In some aspects, when β.sub.5 is I, β.sub.6 is S and β.sub.8 is T. In some aspects, when β.sub.5 is T, β.sub.6 is S and β.sub.8 is T.
2.8.3. Chothia CDR-H1 Consensus Sequences
[0251] In some embodiments, the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence G-Y-T-F-Ω.sub.5-S-Y (SEQ ID NOS: 1-2 and 4-6), where Ω.sub.5 is T, K, Q, F, or V.
[0252] In some aspects, Ω.sub.5 is T. In some aspects, Ω.sub.5 is K. In some aspects, Ω.sub.5 is Q. In some aspects, Ω.sub.5 is F. In some aspects, Ω.sub.5 is V.
[0253] In some embodiments, the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence G-G-T-F-ν.sub.5-ν.sub.6-Y (SEQ ID NOS: 17-22 and 24), where ν.sub.5 is S, G, or E and ν.sub.6 is S, K, R, or S.
[0254] In some aspects, ν.sub.5 is S when ν.sub.6 is S or K. In some aspects, ν.sub.6 is S when ν.sub.5 is S or E.
[0255] In some aspects, ν.sub.5 is S when ν.sub.6 is S. In some embodiments, ν.sub.5 is S when ν.sub.6 is K. In some aspects, ν.sub.5 is G when ν.sub.6 is R. In some aspects ν.sub.5 is E when ν.sub.6 is S.
[0256] In some embodiments, the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence G-G-T-F-κ.sub.5-κ.sub.6-κ.sub.7 (SEQ ID NOS: 7-16), where κ.sub.5 is S, Q, P, or A; κ.sub.6 is S, K, H, L, A, or W; and κ.sub.7 is Y, L, T, N, or M.
[0257] In some aspects, when κ.sub.5 is S, κ.sub.6 is S, K, H, L, A, or W and κ.sub.7 is Y, L, T, or M. In some aspects, when κ.sub.6 is S, κ.sub.5 is S, Q, P, or A and κ.sub.7 is Y, L, or N. In some aspects, when κ.sub.7 is L, κ.sub.5 is S, Q, or A and κ.sub.6 is S, K, L, or W.
[0258] In some aspects, when κ.sub.5 is S, κ.sub.6 is S and κ.sub.7 is Y. In some aspects, when κ.sub.5 is S, κ.sub.6 is S and κ.sub.7 is L. In some aspects, when κ.sub.5 is S, κ.sub.6 is K and κ.sub.7 is L. In some aspects, when κ.sub.5 is S, κ.sub.6 is H and κ.sub.7 is T. In some aspects, when κ.sub.5 is S, κ.sub.6 is L and κ.sub.7 is L. In some aspects, when κ.sub.5 is Q, κ.sub.6 is S and κ.sub.7 is L. In some aspects, when κ.sub.5 is P, κ.sub.6 is S and κ.sub.7 is N. In some aspects, when κ.sub.5 is S, κ.sub.6 is A and κ.sub.7 is M. In some aspects, when κ.sub.5 is A, κ.sub.6 is S and κ.sub.7 is L. In some aspects, when κ.sub.5 is S, κ6 is W and κ.sub.7 is L.
2.8.4. Kabat CDR-H2 Consensus Sequences
[0259] In some embodiments, the antibody comprises a Kabat CDR-H2 sequence defined by the consensus sequence ε.sub.1-I-N-P-ε.sub.5-ε.sub.6-G-S-T-ε.sub.10-Y-A-Q-K-F-Q-G (SEQ ID NOS: 63-66 and 68), where ε.sub.1 is K, S, R, or V; ε.sub.5 is L, R, or S; ε.sub.6 is G or V; and ε.sub.10 is S or W.
[0260] In some aspects, when ε.sub.1 is V; ε.sub.5 is L or S; ε.sub.6 is G; and ε.sub.10 is S. In some aspects, when ε.sub.1 is R; ε.sub.5 is S; ε.sub.6 is V or G; and ε.sub.10 is W. In some aspects, when ε.sub.5 is S; ε.sub.1 is R or V; ε.sub.6 is G or V; and ε.sub.10 is S or W. In some aspects, when ε.sub.6 is G; ε.sub.1 is R or V; ε.sub.5 is S; and ε.sub.10 is S or W. In some aspects, when ε.sub.10 is S; ε.sub.1 is V or S; ε.sub.5 is L, R, or S; and ε.sub.6 is G. In some aspects, when ε.sub.10 is W; ε.sub.1 is K or R; ε.sub.5 is S; and ε.sub.6 is G or V.
[0261] In some aspects, when ε.sub.1 is V; ε.sub.5 is L; ε.sub.6 is G; and ε.sub.10 is S. In some aspects, when ε.sub.1 is V; ε.sub.5 is S; ε.sub.6 is G; and ε.sub.10 is S. In some aspects, when ε.sub.1 is R; ε.sub.5 is S; ε.sub.6 is V; and ε.sub.10 is W. In some aspects, when ε.sub.1 is R; ε.sub.5 is S; ε.sub.6 is G; and ε.sub.10 is W. In some aspects, when ε.sub.1 is K; ε.sub.5 is S; ε.sub.6 is G; and ε.sub.10 is W. In some aspects, when ε.sub.1 is S; ε.sub.5 is R; ε.sub.6 is G; and ε.sub.10 is S.
[0262] In some embodiments, the antibody comprises a Kabat CDR-H2 sequence defined by the consensus sequence G-I-α.sub.3-α.sub.4-as-α.sub.6-G-T-A-N-Y-A-Q-K-F-Q-G (SEQ ID NOS: 69-72), where α.sub.3 is I or L or is absent; α.sub.4 is P or is absent; and as is I, G, or R; and α.sub.6 is A, F, or G.
[0263] In some aspects, when α.sub.3, is I, α.sub.4 is P; as is I or R; and α.sub.6 is F or G. In some aspects, when α.sub.3, is L, α.sub.4 is P; as is I; and α.sub.6 is A or G. In some aspects, when α.sub.4, is P, α.sub.3 is I or L; as is I or R; and α.sub.6 is A, F, or G. In some aspects, when as, is I, α.sub.3 is I or L; α.sub.4 is P; and α.sub.6 is A, F, or G. In some aspects, when α.sub.6, is F, α.sub.3 is I or is absent; α.sub.4 is P or is absent; and as is I or G. In some aspects, when α.sub.6, is G, α.sub.3 is I or L; α.sub.4 is P; and as is I or R.
[0264] In some aspects, when α.sub.3 is L, α.sub.4 is P; as is I; and α.sub.6 is A. In some aspects, when α.sub.3 is I, α.sub.4 is P; as is I; and α.sub.6 is F. In some aspects, when α.sub.3 is absent, α.sub.4 is absent; as is G; and α.sub.6 is F. In some aspects, when α.sub.3 is L, α.sub.4 is P; as is I; and α.sub.6 is G. In some aspects, when α.sub.3 is I, α.sub.4 is P; as is R; and α.sub.6 is G.
[0265] In some embodiments, the antibody comprises a Kabat CDR-H2 sequence defined by the consensus sequence β.sub.1-I-I-P-β.sub.5-β.sub.6-G-β.sub.8-A-N-Y-A-Q-K-F-G-Q (SEQ ID NOS: 74 and 76-79) where β.sub.1 is S or G; β.sub.5 is I, E, S, or T; β.sub.6 is F, I, or S; and β.sub.8 is I or T.
[0266] In some aspects, when β.sub.1 is S, β.sub.5 is E, I, or S; β.sub.6 is I or F; and β.sub.8 is I or T. In some aspects, when β.sub.1 is G, β.sub.5 is I or T; β.sub.6 is F or S; and β.sub.8 is T. In some aspects, when β.sub.5 is I, Pi is G or S; β.sub.6 is F or S; and β.sub.8 is T. In some aspects, when β.sub.6 is F, β.sub.1 is G or S; β.sub.5 is E, I, or T; and β.sub.8 is I or T. In some aspects, when β.sub.8 is T, Pi is G or S; β.sub.5 is I, S, or T; and β.sub.6 is F, I, or S.
[0267] In some aspects, when β.sub.1 is S, β.sub.5 is I; β.sub.5 is F; and β.sub.8 is T. In some aspects, when β.sub.1 is S, β.sub.5 is E; β.sub.5 is F; and β.sub.8 is I. In some aspects, when β.sub.1 is S, β.sub.5 is S; β.sub.5 is I; and β.sub.8 is T. In some aspects, when β.sub.1 is G, β.sub.5 is I; β.sub.5 is F; and β.sub.8 is T. In some aspects, when β.sub.1 is G, β.sub.5 is I; β.sub.5 is S; and β.sub.8 is T. In some aspects, when β.sub.1 is G, β.sub.5 is T; β.sub.5 is F; and β.sub.8 is T.
2.8.5. Kabat CDR-H1 Consensus Sequences
[0268] In some embodiments, the antibody comprises a Kabat CDR-H1 sequence defined by the consensus sequence S-Y-Δ.sub.3-M-Δ.sub.5 (SEQ ID NOS: 25-29 and 44-45), where Δ.sub.3 is E, F, Q, or Y and Δ.sub.5 is H or Y.
[0269] In some aspects, when Δ.sub.3 is Y, Δ.sub.5 is H or Y. In some aspects, when Δ.sub.5 is H, Δ.sub.3 is E, F, Q, or Y.
[0270] In some aspects, Δ.sub.3 is Y when Δ.sub.5 is H. In some aspects, Δ.sub.3 is Y when Δ.sub.5 is Y. In some aspects, Δ.sub.3 is E when Δ.sub.5 is H. In some aspects, Δ.sub.3 is Q when Δ.sub.5 is H. In some aspects, Δ.sub.3 is F when Δ.sub.5 is H.
[0271] In some embodiments, the antibody comprises a Kabat CDR-H1 sequence defined by the consensus sequence θ.sub.1-θ.sub.2-θ.sub.3-I-S(SEQ ID NOS: 30-37), where Oi is A, H, K, L, S, or W; θ.sub.2 is L, M, N, or T; and θ.sub.3 is A or P.
[0272] In some aspects, when θ.sub.1 is S, θ.sub.2 is L or N and θ.sub.3 is A or P. In some aspects, when θ.sub.2 is L, θ.sub.1 is K, L, S, or W and θ.sub.3 is A or P. In some aspects, when θ.sub.3 is A, θ.sub.1 is A, H, K, L, S, or W and θ.sub.2 is L, M, N, or T.
[0273] In some aspects, θ.sub.1 is S, when θ.sub.2 is L and θ.sub.3 is A. In some aspects, θ.sub.1 is K, when θ.sub.2 is L and θ.sub.3 is A. In some aspects, θ.sub.1 is H when θ.sub.2 is T and θ.sub.3 is A. In some aspects, θ.sub.1 is S when θ.sub.2 is L and θ.sub.3 is P. In some aspects, θ.sub.1 is L when θ.sub.2 is L and θ.sub.3 is A. In some aspects, θ.sub.1 is S when θ.sub.2 is N and θ.sub.3 is A. In some aspects, θ.sub.1 is A when θ.sub.2 is M and θ.sub.3 is A. In some aspects, θ.sub.1 is W when θ.sub.2 is L and θ.sub.3 is A.
[0274] In some embodiments, the antibody comprises a Kabat CDR-H1 sequence defined by the consensus sequence η.sub.1-Y-η.sub.3-I-S SEQ ID NOS: 38-41), where η.sub.1 is S, K, N, or R and η.sub.3 is A or G.
[0275] In some aspects, η.sub.1 is S where η.sub.3 is A or G. In some aspects, η.sub.3 is A where η.sub.1 is N or S. In some aspects, η.sub.3 is G where η.sub.1 is K, R, or S.
[0276] In some aspects, when η.sub.1 is S, η.sub.3 is A. In some aspects, when η.sub.1 is S, η.sub.3 is G. In some aspects, when η.sub.1 is K, η.sub.3 is G. In some aspects, when η.sub.1 is R, η.sub.3 is G. In some aspects, when η.sub.1 is N, η.sub.3 is A.
2.8.6. CDR-L3 Consensus Sequences
[0277] In some embodiments, the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-Q-Y-π.sub.4-π.sub.5-π.sub.6-π.sub.7-T (SEQ ID NOS: 141-147), where π.sub.4 is G, H, or Y; π.sub.5 is S, N, F, G, or R; π.sub.6 is S, Y, A, G, or R; and π.sub.7 is P, I, or L.
[0278] In some aspects, π.sub.4 is H when π.sub.5 is S, N, G, or R; π.sub.6 is Y, A, G, or R; and π.sub.7 is I or L. In some aspects, π.sub.5 is S, when π.sub.4 is G or H; π.sub.6 is S, Y, or A; and π.sub.7 is P, I or L. In some aspects, π.sub.6 is Y, when π.sub.4 is H or Y; π.sub.5 is S or F; and π.sub.7 is I. In some aspects, π.sub.6 is A when π.sub.4 is H; π.sub.5 is N or S; and π.sub.7 is I or L. In some aspects, π.sub.7 is I when π.sub.4 is H or Y; π.sub.5 is S, N, F, G, or R; and π.sub.6 is Y, A, G, or R.
[0279] In some aspects, π.sub.4 is G when π.sub.5 is S; π.sub.6 is S; and π.sub.7 is P. In some aspects, π.sub.4 is H when π.sub.5 is S; π.sub.6 is Y; and π.sub.7 is I. In some aspects, π.sub.4 is H when π.sub.5 is N; π.sub.6 is I; and π.sub.7 is A. In some aspects, π.sub.4 is Y when π.sub.5 is F; π.sub.6 is Y; and π.sub.7 is I. In some aspects, π.sub.4 is H when π.sub.5 is S; π.sub.6 is A; and π.sub.7 is L. In some aspects, π.sub.4 is H when π.sub.5 is G; π.sub.6 is G; and π.sub.7 is I. In some aspects, π.sub.4 is H when π.sub.5 is R; π.sub.6 is R; and π.sub.7 is I.
[0280] In some embodiments, the antibody comprises a CDR-L3 sequence defined by consensus sequence Q-Q-λ.sub.3-λ.sub.4-λ.sub.5-λ.sub.6-P-T (SEQ ID NOS: 148-150), where λ.sub.3 is R, F, H, S, L, D, Y, or V; λ.sub.4 is S, V, T, G, L, Y, or N; λ.sub.5 is N, L, F, K, or V; and λ.sub.6 is W, F, Y, or L.
[0281] In some aspects, λ.sub.3 is R, when λ.sub.4 is S or N; λ.sub.5 is N or F; and λ.sub.4 is W or Y. In some aspects, λ.sub.3 is H when λ.sub.4 is V or T; λ.sub.5 is N or V; and λ.sub.6 is F or W. In some aspects, λ.sub.3 is S when λ.sub.4 is V or Y; λ.sub.5 is F; and λ.sub.6 is W or L. In some aspects, λ.sub.4 is V when λ.sub.3 is F, H, S, or D; λ.sub.5 is L, N, or F; and λ.sub.6 is W or F. In some aspects, λ.sub.4 is T when λ.sub.3 is L or H; λ.sub.5 is K or V; and λ.sub.6 is W. In some aspects, λ.sub.5 is N when λ.sub.3 is R, H, or V; λ.sub.4 is S, V, or L; and λ.sub.6 is W, F, or Y. In some aspects, λ.sub.5 is L when λ.sub.3 is F, D, or Y; λ.sub.4 is V or G; and λ.sub.2 is W or F. In some aspects, λ.sub.5 is F when λ.sub.3 is S or R; λ.sub.4 is V, Y, or N; and λ.sub.6 is W, L, or Y. In some aspects, λ.sub.6 is W when λ.sub.3 is R, F, S, L, D, or H; λ.sub.4 is S, V, or T; and λ.sub.5 is N, L, F, K, or V. In some aspects, λ.sub.4 is F when λ.sub.3 is H or Y; λ.sub.4 is V or G; and λ.sub.5 is N or L. In some aspects, λ.sub.6 is Y when λ.sub.3 is V or R; λ.sub.4 is L or N; and λ.sub.5 is N or F.
[0282] In some aspects, λ.sub.3 is R when λ.sub.4 is S; λ.sub.5 is N; and λ.sub.6 is W. In some aspects, λ.sub.3 is F when λ.sub.4 is V; λ.sub.5 is L; and 4 is W. In some aspects, λ.sub.3 is H when λ.sub.4 is V; λ.sub.5 is N; and λ.sub.6 is F. In some aspects, λ.sub.3 is S when λ.sub.4 is V; λ.sub.5 is F; and λ.sub.4 is W. In some aspects, λ.sub.3 is L when λ.sub.1 is T; λ.sub.5 is K; and λ.sub.6 is W. In some aspects, λ.sub.3 is D when λ.sub.4 is V; λ.sub.5 is L; and λ.sub.6 is W. In some aspects, λ.sub.3 is Y when λ.sub.4 is G; λ.sub.5 is L; and λ.sub.6 is F. In some aspects, λ.sub.3 is H when λ.sub.4 is T; λ.sub.5 is V; and λ.sub.6 is W. In some aspects, λ.sub.3 is V when λ.sub.4 is L; λ.sub.5 is N; and λ.sub.6 is Y. In some aspects, λ.sub.3 is S when λ.sub.4 is Y; λ.sub.5 is F; and λ.sub.6 is L. In some aspects, λ.sub.3 is R when λ.sub.4 is N; λ.sub.5 is F; and 4 is Y.
[0283] In some embodiments, the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-Q-Y-ρ.sub.3-ρ.sub.4-W-P-L-T (SEQ ID NOS: 151 and 152), where ρ.sub.3 is N or L and ρ.sub.4 is N or L.
[0284] In some aspects, ρ.sub.3 is N when ρ.sub.4 is L. In some aspects, ρ.sub.3 is L when ρ.sub.4 is L.
[0285] In some embodiments, the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-Q-ω.sub.3-ω.sub.4-ω.sub.5-ω.sub.6-P-ω.sub.5-T (SEQ ID NOS: 153-156), where ω.sub.3 is Y or F; ω.sub.4 is Y or W; ω.sub.5 is S, L, T, or F; ω.sub.6 is T, Y, or F; and ω.sub.5 is L or P.
[0286] In some aspects, ω.sub.3 is Y when ω.sub.4 is Y or W; ω.sub.5 is S, L, or T; ω.sub.6 is T or Y; and ω.sub.5 is L. In some aspects, ω.sub.4 is Y when ω.sub.3 is Y or F; ω.sub.5 is S, L, or F; ω.sub.6 is T or Y; and ω.sub.5 is L or P. In some aspects, ω.sub.6 is Y when ω.sub.3 is Y; ω.sub.4 is Y or W; ω.sub.5 is L or T; and ω.sub.5 is L. In some aspects, ω.sub.5 is L when ω.sub.3 is Y; ω.sub.4 is Y or W; ω.sub.5 is S, L, or T; and ω.sub.6 is T or Y.
[0287] In some aspects, ω.sub.3 is Y when ω.sub.4 is Y; ω.sub.5 is S; ω.sub.6 is T; and ω.sub.5 is L. In some aspects, ω.sub.3 is Y when ω.sub.4 is Y; ω.sub.5 is L; ω.sub.6 is Y; and ω.sub.8 is L. In some aspects, ω.sub.3 is Y when ω.sub.4 is W; ω.sub.5 is T; ω.sub.6 is Y; and ω.sub.5 is L. In some aspects, ω.sub.3 is F when ω.sub.4 is Y; ω.sub.5 is F; ω.sub.6 is F; and ω.sub.5 is P.
2.8.7. CDR-L2 Consensus Sequences
[0288] In some embodiments, the antibody comprises a CDR-L2 sequence defined by the consensus sequence ψ.sub.1-A-S-ψ.sub.4-R-ψ.sub.6-ψ.sub.7 (SEQ ID NOS: 125-136), where ψ.sub.1 is G or Y, is S or N; ψ.sub.6 is A or H; and ψ.sub.7 is T, Y, or N.
[0289] In some aspects, ψ.sub.1 is G when ψ.sub.4 is S or N; ψ.sub.6 is A or H; and ψ.sub.7 is T or N. In some aspects, ψ.sub.1 is Y when is S or N; ψ.sub.6 is A; and ψ.sub.7 is Y or T. In some aspects, ψ.sub.4 is S when ψ.sub.1 is G or Y; ψ.sub.6 is A; and ψ.sub.7 is T, Y, or N. In some aspects, ψ.sub.4 is N when ψ.sub.1 is G or Y; ψ.sub.6 is H or A; and ψ.sub.7 is T. In some aspects, ψ.sub.6 is A when ψ.sub.1 is G or Y; ψ.sub.4 is S or N; and ψ.sub.7 is T, Y, or N. In some aspects, ψ.sub.7 is T when ψ.sub.1 is G or Y; ψ.sub.4 is S or N; and ψ.sub.6 is A or H.
[0290] In some aspects, ψ.sub.1 is G when ψ.sub.4 is S; ψ.sub.6 is A; and ψ.sub.7 is T. In some aspects, ψ.sub.1 is G when ψ.sub.4 is N; ψ.sub.6 is H; and ψ.sub.7 is T. In some aspects, ψ.sub.1 is Y when ψ.sub.4 is S; ψ.sub.6 is A; and ψ.sub.7 is Y. In some aspects, ψ.sub.1 is G when ψ.sub.4 is S; ψ.sub.6 is A; and ψ.sub.7 is N. In some aspects, ψ.sub.1 is Y when ψ.sub.4 is N; ψ.sub.6 is A; and ψ.sub.7 is T.
[0291] In some embodiments, the antibody comprises a CDR-L2 sequence defined by the consensus sequence D-A-S-χ.sub.4-R-A-T (SEQ ID NOS: 138 and 139), where £.sub.4 is N or K.
[0292] In some aspects, χ.sub.4 is N. In some aspects, χ.sub.4 is K.
[0293] In some embodiments, the antibody comprises a CDR-L2 sequence defined by the consensus sequence W-A-S-T-R-σ.sub.6-S(SEQ ID NOS: 131 and 133-134), where σ.sub.6 is A, E, or Q.
[0294] In some aspects, σ.sub.6 is A. In some aspects, σ.sub.6 is E. In some aspects, σ.sub.6 is Q.
2.8.8. CDR-L1 Consensus Sequences
[0295] In some embodiments, the antibody comprises a CDR-L1 sequence defined by the consensus sequence ϕ.sub.1-A-S-ϕ.sub.4-ϕ.sub.5-V-ϕ.sub.7-ϕ.sub.8-ϕ.sub.9-Y-L-A (SEQ ID NOS: 1101-114), where ϕ.sub.1 is E, K, or R; ϕ.sub.4 is Q or E; ϕ.sub.5 is S or Y; ϕ.sub.7 is S or A; ϕ.sub.8 is S or Y; and ϕ.sub.9 is D or S.
[0296] In some aspects, ϕ.sub.1 is R when ϕ.sub.4 is Q or E; ϕ.sub.5 is S or Y; ϕ.sub.7 is S or A; ϕ.sub.8 is S or Y; and ϕ.sub.9 is S or D. In some aspects, ϕ.sub.4 is E when ϕ.sub.1 is K or R; ϕ.sub.5 is S; ϕ.sub.7 is S; ϕ.sub.8 is S; and ϕ.sub.9 is S. In some aspects, ϕ.sub.4 is Q when ϕ.sub.1 is E or R; ϕ.sub.5 is S or Y; ϕ.sub.7 is S or A; ϕ.sub.8 is S or Y; and ϕ.sub.9 is S or D. In some aspects, ϕ.sub.5 is S when ϕ.sub.1 is E, K, or R; ϕ.sub.4 is E or Q; ϕ.sub.7 is S or A; ϕ.sub.8 is S or Y; and ϕ.sub.9 is S or D. In some aspects, ϕ.sub.7 is S when ϕ.sub.1 is E, K, or R; ϕ.sub.4 is E or Q; ϕ.sub.5 is S or Y; ϕ.sub.8 is S or Y; and ϕ.sub.9 is S or D. In some aspects, ϕ.sub.8 is S when ϕ.sub.1 is K or R; ϕ.sub.4 is E or Q; ϕ.sub.5 is S or 5; ϕ.sub.7 is A or S; and ϕ.sub.9 is S or D. In some aspects, ϕ.sub.8 is R when ϕ.sub.1 is E or R; ϕ.sub.4 is Q; ϕ.sub.5 is S; ϕ.sub.7 is S; and ϕ.sub.9 is S. In some aspects, ϕ.sub.9 is S when ϕ.sub.1 is E, K, or R; ϕ.sub.4 is E or Q; ϕ.sub.5 is S or Y; ϕ.sub.7 is A or S; and ϕ.sub.8 is S or Y.
[0297] In some aspects, ϕ.sub.1 is K when ϕ.sub.4 is E; ϕ.sub.5 is S; ϕ.sub.7 is S; ϕ.sub.8 is S; and ϕ.sub.9 is S. In some aspects, ϕ.sub.1 is E, when ϕ.sub.4 is Q; ϕ.sub.5 is S; ϕ.sub.7 is S; ϕ.sub.8 is Y; and ϕ.sub.9 is S. In some aspects, ϕ.sub.1 is R when ϕ.sub.4 is Q; ϕ.sub.5 is S; ϕ.sub.7 is S; ϕ.sub.8 is S; and ϕ.sub.9 is D. In some aspects, ϕ.sub.1 is R when ϕ.sub.4 is Q; ϕ.sub.5 is S; ϕ.sub.7 is S; ϕ.sub.8 is S; and ϕ.sub.9 is S. In some aspects, ϕ.sub.1 is R when ϕ.sub.4 is Q; ϕ.sub.5 is S; ϕ.sub.7 is A; ϕ.sub.8 is S; and ϕ.sub.9 is S. In some aspects, ϕ.sub.1 is R when ϕ.sub.4 is Q; ϕ.sub.5 is S; ϕ.sub.7 is S; ϕ.sub.8 is Y; and ϕ.sub.9 is S. In some aspects, ϕ.sub.1 is R when ϕ.sub.4 is E; ϕ.sub.5 is S; ϕ.sub.7 is S; ϕ.sub.8 is S; and ϕ.sub.9 is S. In some aspects, ϕ.sub.1 is R when ϕ.sub.4 is Q; ϕ.sub.5 is Y; ϕ.sub.7 is S; ϕ.sub.8 is S; and ϕ.sub.9 is S.
[0298] In some embodiments, the antibody comprises a CDR-L1 sequence defined by the consensus sequence ∂.sub.1-A-S-Q-∂.sub.5-∂.sub.6-∂.sub.7-∂.sub.8-∂.sub.9-L-∂.sub.11 (SEQ ID NOS: 118 and 120-123), where ∂.sub.1 is Q or R1; ∂.sub.5 is D or S; ∂.sub.6 is I or V; ∂.sub.7 is G or S; ∂.sub.8 is N, R, or S; ∂.sub.9 is N, Y, or W; and ∂.sub.11 is A or N.
[0299] In some aspects, when ∂.sub.1 is R, ∂.sub.5 is S; ∂.sub.6 is I or V; ∂.sub.7 is G or S; ∂.sub.8 is R or S; ∂.sub.9 is N, Y, or W; and ∂.sub.11 is A. In some aspects, when ∂.sub.5 is S, ∂.sub.1 is R; ∂.sub.6 is I or V; ∂.sub.7 is G or S; ∂.sub.8 is R or S; ∂.sub.9 is N, Y, or W; and ∂.sub.11 is A. In some aspects, when ∂.sub.6 is I, ∂.sub.1 is Q or R; ∂.sub.5 is D or S; ∂.sub.7 is S; ∂.sub.8 is N or S; ∂.sub.9 is Y or W; and ∂.sub.11 is A or N. In some aspects, when ∂.sub.6 is V, ∂.sub.1 is R; ∂.sub.5 is S; ∂.sub.7 is G or S; ∂.sub.8 is R or S; ∂.sub.9 is N or W; and ∂.sub.11 is A. In some aspects, when ∂.sub.7 is S, ∂.sub.1 is Q or R; ∂.sub.5 is D or S; ∂.sub.6 is I or V; ∂.sub.8 is N, S, or R; ∂.sub.9 is Y or W; and ∂.sub.11 is A or N. In some aspects, when ∂.sub.8 is S, ∂.sub.1 is R; ∂.sub.5 is S; ∂.sub.6 is I or V; ∂.sub.7 is S; ∂.sub.9 is N, Y, or W; and ∂.sub.11 is A. In some aspects, when ∂.sub.9 is Y, ∂.sub.1 is Q or R; ∂.sub.5 is D or S; ∂.sub.6 is I or V; ∂.sub.7 is S; ∂.sub.8 is N, S, or R; and ∂.sub.11 is A or N. In some aspects, when ∂.sub.11 is A, ∂.sub.1 is R; ∂.sub.5 is S; ∂.sub.6 is I or V; ∂.sub.7 is S or G; ∂.sub.8 is S, or R; and ∂.sub.9 is N, W, or Y.
[0300] In some aspects, when ∂.sub.1 is R, ∂.sub.5 is S; ∂.sub.6 is V; ∂.sub.7 is S; ∂.sub.8 is S; ∂.sub.9 is Y; and ∂.sub.11 is A. In some aspects, when ∂.sub.1 is Q, ∂.sub.5 is D; ∂.sub.6 is I; ∂.sub.7 is S; ∂.sub.8 is N; ∂.sub.9 is Y; and ∂.sub.11 is N. In some aspects, when ∂.sub.1 is R, ∂.sub.5 is S; ∂.sub.6 is V; ∂.sub.7 is S; ∂.sub.8 is R; ∂.sub.9 is Y; and ∂.sub.11 is A. In some aspects, when ∂.sub.1 is R, ∂.sub.5 is S; ∂.sub.6 is V; ∂.sub.7 is G; ∂.sub.8 is S; ∂.sub.9 is N; and ∂.sub.11 is A. In some aspects, when ∂.sub.1 is R, ∂.sub.5 is S; ∂.sub.6 is I; ∂.sub.7 is S; ∂.sub.8 is S; ∂.sub.9 is W; and ∂.sub.11 is A.
[0301] In some embodiments, the antibody comprises a CDR-L1 sequence defined by the consensus sequence K-S-S-Γ.sub.4-S-V-L-Γ.sub.8-S-Γ.sub.10-N-N-K-N-Y-L-A (SEQ ID NOS: 115-117), where Γ.sub.4 is Q, R or K; Γ.sub.8 is F or Y; and Γ.sub.10 is S or N.
[0302] In some aspects, Γ.sub.4 is Q when Γ.sub.8 is F or Y and Γ.sub.10 is S. In some aspects, Γ.sub.8 is F when Γ.sub.4 is Q or R and Γ.sub.10 is S. In some aspects, Γ.sub.8 is Y when Γ.sub.4 is K or Q and Γ.sub.10 is S or N. In some aspects, Γ.sub.10 is S when Γ.sub.4 is R or Q and Γ.sub.8 is F or Y.
[0303] In some aspects, Γ.sub.4 is Q when Γ.sub.8 is Y and Γ.sub.10 is S. In some aspects, Γ.sub.4 is K when Γ.sub.8 is Y and Γ.sub.10 is N. In some aspects, Γ.sub.4 is Q when Γ.sub.8 is F and Γ.sub.10 is S. In some aspects, Γ.sub.4 is R when Γ.sub.8 is F and Γ.sub.10 is S.
3. Germline
[0304] In some embodiments, the antibody that specifically binds CD39 is an antibody comprising a variable region that is encoded by a particular germline gene, or a variant thereof. The illustrative antibodies provided herein comprise variable regions that are encoded by the heavy chain variable region germline genes VH1-46, VH1-69, 1-69, and VH1-46, or variants thereof and the light chain variable region germline genes VK3-20, VK3-11, VK4-01, VK3, and VK3-15, or variants thereof. One of skill in the art would recognize that the CDR sequences provided herein may also be useful when combined with variable regions encoded by other variable region germline genes, or variants thereof. In particular, the CDR sequences provided herein may be useful when combined with variable regions encoded by variable region germline genes, or variants thereof, that are structurally similar to the variable region germline genes recited above. For example, in some embodiments, a CDR-H sequence provided herein may be combined with a variable region encoded by a variable region germline gene selected from the VH1 or VH3 family, or a variant thereof. In some embodiments, a CDR-L sequence provided herein may be combined with a variable region encoded by a variable region germline gene selected from the Vλ3, Vκ1, Vκ3, and VK4 families, or a variant thereof
4. Affinity
[0305] In some embodiments, the affinity of the antibody for CD39, as indicated by K.sub.D, is less than about 10.sup.−5 M, less than about 10.sup.−6 M, less than about 10.sup.−7 M, less than about 10.sup.−8 M, less than about 10.sup.−9 M, less than about 10.sup.−10 M, less than about 10.sup.−11 M, or less than about 10.sup.−12M. In some embodiments, the affinity of the antibody is between about 10.sup.−7M and 10.sup.−11M. In some embodiments, the affinity of the antibody is between about 10.sup.−7 M and 10.sup.−10 M. In some embodiments, the affinity of the antibody is between about 10.sup.−7M and 10.sup.−9 M. In some embodiments, the affinity of the antibody is between about 10.sup.−7 M and 10.sup.−8 M. In some embodiments, the affinity of the antibody is between about 10.sup.−8 M and 10.sup.−11 M. In some embodiments, the affinity of the antibody is between about 10.sup.−8 M and 10.sup.−10 M. In some embodiments, the affinity of the antibody is between about 10.sup.−9 M and 10.sup.−11 M. In some embodiments, the affinity of the antibody is between about 10.sup.−10 M and 10.sup.−11M.
[0306] In some embodiments, the affinity of the antibody for human CD39 is between about 4.09×10.sup.−7 M and 7.31×10.sup.−11 M. In some embodiment, the affinity of the antibody for human CD39 is about 1.14×10.sup.−7 M, about 1.31×10.sup.−7 M, about 1.67×10.sup.−7 M, about 1.43×10.sup.−7 M, about 1.30×10.sup.−8 M, about 1.27×10.sup.−7 M, about 1.13×10.sup.−7 M, about 1.60×10.sup.−7 M, about 1.34×10.sup.−9 M, about 1.16×10.sup.−9 M, about 7.31×10.sup.−11 M, about 7.60×10.sup.−10 M, about 2.66×10.sup.−10 M, about 9.22×10.sup.−10 M, about 6.72×10.sup.−10 M, about 9.24×10.sup.−10 M, about 5.58×10.sup.−10 M, about 5.48×10.sup.−7 M, about 3.37×10.sup.−7 M, about 3.11×10.sup.−7 M, about 1.88×10.sup.−7 M, about 1.63×10.sup.−7 M about 1.64×10.sup.−7 M, about 1.01×10.sup.−7 M, about 2.44×10.sup.−7 M, about 4.09×10.sup.−7 M, about 3.35×10.sup.−8 M, about 1.91×10.sup.−8M, about 1.73×10.sup.−7 M, or about 2.39×10.sup.−7 M.
[0307] In some embodiments the antibody has a k.sub.on when associating with human CD39 of between about 1.93×10.sup.4 M.sup.−1×sec.sup.−1 and about 1.72×10.sup.6 M.sup.−1×sec.sup.−1. In some embodiments the antibody has a k.sub.a when associating with human CD39 of about 6.59×10.sup.4 m.sup.−1×sec.sup.−1, about 1.93×10.sup.4 M.sup.−1×sec.sup.−1, about 4.44×10.sup.5M.sup.−1×sec.sup.−1, about 2.72×10.sup.5 M.sup.−1×sec.sup.−1, about 6.39×10.sup.5 M.sup.−1×sec.sup.−1, about 8.93×10.sup.5 M.sup.−1×sec.sup.−1, about 9.55×10.sup.5 M.sup.−1×sec.sup.−1, about 2.11×10.sup.5 M.sup.−1×sec.sup.−1, about 1.17×10.sup.5 M.sup.−1×sec.sup.−1, about 2.02×10.sup.5 M.sup.−1×sec.sup.−1, about 1.76×10.sup.5 m.sup.−1×sec.sup.−1, about 1.72×10.sup.5 M.sup.−1×sec.sup.−1, about 2.73×10.sup.5M.sup.−1×sec.sup.−1, about 1.43×10.sup.5 M.sup.−1×sec.sup.−1, about 9.01×10.sup.5 M.sup.−1×sec.sup.−1, about 3.13×10.sup.5 M.sup.−1×sec.sup.−1, about 5.03×10.sup.5 M.sup.−1×sec.sup.−1, about 3.02×10.sup.5 M.sup.−1×sec.sup.−1, about 2.73×10.sup.5 M.sup.−1×sec.sup.−1, about 1.78×10.sup.5 M.sup.−1×sec.sup.−1, about 2.98×10.sup.5 m.sup.−1×sec.sup.−1, about 4.31×10.sup.5 M.sup.−1×sec.sup.−1, about 2.27×10.sup.5M.sup.−1×sec.sup.−1, about 3.14×10.sup.5 M.sup.−1×sec.sup.−1, about 2.81×10.sup.5 M.sup.−1×sec.sup.−1, about 4.73×10.sup.5 M.sup.−1×sec.sup.−1, about 3.26×10.sup.5 M.sup.−1×sec.sup.−1, about 1.73×10.sup.5 M.sup.−1×sec.sup.−1, about 2.68×10.sup.5 M.sup.−1×sec.sup.−1, about 2.63×10.sup.5 M.sup.−1×sec.sup.−1, about 3.82×10.sup.5 m.sup.−1×sec.sup.−1, about 2.46×10.sup.5 M.sup.−1×sec.sup.−1, about 3.11×10.sup.5 M.sup.−1×sec.sup.−1, about 4.53×10.sup.5 M.sup.−1×sec.sup.−1, about 4.63×10.sup.5 M.sup.−1×sec.sup.−1, about 9.01×10.sup.5 M.sup.−1×sec.sup.−1, about 1.03×10.sup.6 M.sup.−1×sec.sup.−1, about 1.52×10.sup.6 M.sup.−1×sec.sup.−1, or about 3.53×10.sup.5 M.sup.−1×sec.sup.−1.
[0308] In some embodiments the antibody has a k.sub.off of about 7.51×10.sup.−3 sec.sup.−1, about 6.33×10.sup.−2 sec.sup.−1, about 4.70×10.sup.−2 sec.sup.−1, about 7.82×10.sup.−4 sec.sup.−1, about 4.70×10.sup.−2 sec.sup.−1, about 1.05×10.sup.−2 sec.sup.−1, about 3.65×10.sup.−1 sec.sup.−1, about 1.60×10.sup.−1 sec.sup.−1, about 7.11×10.sup.−3 sec.sup.−1, about 6.44×10.sup.−3 sec.sup.−1, about 3.85×10.sup.−2 sec.sup.−1, about 2.30×10.sup.−2 sec.sup.−1, about 5.33×10.sup.−2 sec.sup.−1, about 9.14×10.sup.−2 sec.sup.−1, about 1.80×10.sup.−3 sec.sup.−1, about 8.15×10.sup.−3 sec.sup.−1, about 3.85×10.sup.−4 sec.sup.−1, about 1.34×10.sup.−4 sec.sup.−1, about 2.29×10.sup.−4 sec.sup.−1, about 4.37×10.sup.−3 sec.sup.−1, about 3.71×10.sup.−3 sec.sup.−1, about 4.06×10.sup.−3 sec.sup.−1, about 6.66×10.sup.−2 sec.sup.−1, about 2.02×10.sup.−3 sec.sup.−1, about 2.00×10.sup.4 sec.sup.−1, about 5.26×10.sup.−3 sec.sup.−1, about 1.13×10.sup.−2 sec.sup.−1, about 3.28×10.sup.−3 sec.sup.−1, about 2.76×10.sup.−3 sec.sup.−1, about 2.86×10.sup.−4 sec.sup.−1, about 2.43×10.sup.−4 sec.sup.−1, about 2.13×10.sup.−4 sec.sup.−1, about 6.09×10.sup.−4 sec.sup.−1, about 8.39×10.sup.4 sec.sup.−1, about 8.15×10.sup.−3 sec.sup.−1, about 1.32×10.sup.−4 sec.sup.−1, about 1.11×10.sup.4 sec.sup.−1, about 2.43×10.sup.−4 sec.sup.−1, about 2.13×10.sup.−4 sec.sup.−1, about 6.09×10.sup.−4 sec.sup.−1, about 8.15×10.sup.−3 sec.sup.−1, about 1.32×10.sup.4 sec.sup.−1, or about 1.11×10.sup.4 sec.sup.−1.
[0309] In some aspects, the K.sub.D, k.sub.a, and k.sub.d are determined at 25° C. In some embodiments, the K.sub.D, k.sub.a, and k.sub.d are determined by surface plasmon resonance. In some embodiments, the K.sub.D, k.sub.a, and k.sub.d are determined according to the methods described in the examples.
5. Inhibition of CD39
[0310] In some aspects, the antibody decreases affinity of CD39 to its substrate. In some aspects, the antibody inhibits CD39 function on tumor cells. In some aspects, the antibody inhibits or impedes the release of ADP or AMP from CD39. In some aspects, the antibody inhibits or impedes CD39 processivity.
[0311] In some aspects, the antibody binds CD39 but does not inhibit ATPase. In some aspects, the antibody binds CD39 and inhibits extracellular CD39 activity but not cellular ATPase activity. In some aspects, the antibody binds both the extracellular domain of CD39 and cellular CD39 and can inhibit both the extracellular domain of CD39 and cellular CD39. In some aspects, the antibodies do not compete with A1 and/or others in binding to the extracellular domain.
6. CD39 Assays
[0312] In some embodiments, the antibody binds to an epitope of CD39. In some aspects, CD39 has a sequence identical to the amino acid sequence set forth in SEQ ID NO: 249. In some aspects, the epitope has an amino acid sequence that is identical to the amino acid sequence set forth in SEQ ID NO: 249. In some aspects, the epitope is in an extracellular domain of CD39. In some aspects, the extracellular domain corresponds to all or at least a portion of amino acids 38-478 of SEQ ID NO: 249. In some aspects, the epitope has an amino acid sequence that is 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identical to the sequence set forth in SEQ ID NO: 249 or all or a portion of the extracellular domain. In some aspects, the epitope has a sequence that is identical or corresponds to residues 143-158 and/or residues 274-277 of SEQ ID NO: 249. In some aspects, the epitope is in the region of E143 to N158 on the human CD39 polypeptide having the sequence set forth in SEQ ID NO: 249. In some aspects, the epitope has a sequence that has a 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identity to residues 143-158 or 274-277 of the sequence set forth in SEQ ID NO: 249. In some aspects, the epitope has 1, 2, 3, 4, 5, 6, 7, 8, or 9 substitutions from residues 143-158 of the sequence forth in SEQ ID NO: 249. In some aspects, the epitope has 1, 2 or 3 substitutions from residues 274-277 of SEQ ID NO: 249. In some aspects, the antibody makes contact with any of the residues set forth in
[0313] In some aspects, the antibody competes with 1, 2, 3, 4, or 5 of antibodies 27536, 27571, 28347, 27579, or 27597 as set forth in
[0314] In some aspects, the antibody inhibits conversion by CD39 of ATP to ADP and/or ADP to AMP. In some aspects, the antibody inhibits platelet aggregation. In some aspects, the antibody decreases or prevents activation of phospho antigen specific T cells selected from MATT cells and γδ T cells. In some aspects, the antibody inhibits angiogenesis. In some aspects, the antibody decreases levels of phosphate, ADP, AMP, and/or adenosine and/or increasing levels of ATP. In some aspects, the antibody increases T effector cell function. In some aspects, the antibody decreases the number of regulatory T cells in tissues or in circulation. In some aspects, the antibody decreases the regulatory T cells or regulatory T cell activity. In some aspects, the antibody increases B cell function. In some aspects, the antibody increases antigen presenting cell function. In some aspects, the antibody inhibits processing of at least one of phospho-antigen from phosphorylated isoprenoid, phosphorylated vitamin B metabolite, and/or phosphorylated riboflavin.
[0315] In some aspects, the antibody has limited ability to limit ATPase of the soluble or extracellular domain. In some aspects, the antibody has limited ability to inhibit ATPase of the cellular and/or extracellular domain of CD39.
7. Glycosylation Variants
[0316] In certain embodiments, an antibody may be altered to increase, decrease or eliminate the extent to which it is glycosylated. Glycosylation of polypeptides is typically either “N-linked” or “O-linked.”
[0317] “N-linked” glycosylation refers to the attachment of a carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site.
[0318] “O-linked” glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
[0319] Addition or deletion of N-linked glycosylation sites to the antibody may be accomplished by altering the amino acid sequence such that one or more of the above-described tripeptide sequences is created or removed. Addition or deletion of O-linked glycosylation sites may be accomplished by addition, deletion, or substitution of one or more serine or threonine residues in or to (as the case may be) the sequence of an antibody.
[0320] In certain embodiments, the antibody is glycosylated. In certain embodiments, the antibody is deglycosylated. Carbohydrates may be removed by standard techniques. In certain embodiments, the antibody is aglycosylated, for instance by expression in a system that does not glycosylate.
8. Fc Variants
[0321] In certain embodiments, amino acid modifications may be introduced into the Fc region of an antibody provided herein to generate an Fc region variant. In certain embodiments, the Fc region variant possesses some, but not all, effector functions. Such antibodies may be useful, for example, in applications in which the half-life of the antibody in vivo is important, yet certain effector functions are unnecessary or deleterious. Examples of effector functions include complement-dependent cytotoxicity (CDC) and antibody-directed complement-mediated cytotoxicity (ADCC). Numerous substitutions or substitutions or deletions with altered effector function are known in the art.
[0322] An alteration in in CDC and/or ADCC activity can be confirmed using in vitro and/or in vivo assays. For example, Fc receptor (FcR) binding assays can be conducted to measure FcγR binding. The primary cells for mediating ADCC, NK cells, express FcγRIII only, whereas monocytes express FcγR1, FcγRII and FcγRIII. FcR expression on hematopoietic cells is summarized in Ravetch and Kinet, Ann. Rev. Immunol., 1991, 9:457-492.
[0323] Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest are provided in U.S. Pat. Nos. 5,500,362 and 5,821,337; Hellstrom et al., Proc. Natl. Acad. Sci. USA., 1986, 83:7059-7063; Hellstrom et al., Proc. Natl. Acad. Sci. USA., 1985, 82:1499-1502; and Bruggemann et al., J. Exp. Med., 1987, 166:1351-1361. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, using an animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. USA., 1998, 95:652-656.
[0324] C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. Examples of C1q binding assays include those described in WO 2006/029879 and WO 2005/100402.
[0325] Complement activation assays include those described, for example, in Gazzano-Santoro et al., J. Immunol. Methods, 1996, 202:163-171; Cragg et al., Blood, 2003, 101:1045-1052; and Cragg and Glennie, Blood, 2004, 103:2738-2743.
[0326] FcRn binding and in vivo clearance (half-life determination) can also be measured, for example, using the methods described in Petkova et al., Intl. Immunol., 2006, 18:1759-1769.
9. Preparation of Antibodies
9.1. Antigen Preparation
[0327] The CD39 antigen to be used for production of antibodies may be intact CD39 or a fragment of CD39. The intact CD39, or fragment of CD39, may be in the form of an isolated protein or expressed by a cell. Other forms of CD39 useful for generating antibodies will be apparent to those skilled in the art.
9.2. Monoclonal Antibodies
[0328] Monoclonal antibodies may be obtained, for example, using the hybridoma method first described by Kohler et al., Nature, 1975, 256:495-497, and/or by recombinant DNA methods (see e.g., U.S. Pat. No. 4,816,567). Monoclonal antibodies may also be obtained, for example, using phage or yeast-based libraries. See e.g., U.S. Pat. Nos. 8,258,082 and 8,691,730.
[0329] In the hybridoma method, a mouse or other appropriate host animal is immunized to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization. Alternatively, lymphocytes may be immunized in vitro. Lymphocytes are then fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell. See Goding J. W., Monoclonal Antibodies: Principles and Practice 3.sup.rd ed. (1986) Academic Press, San Diego, Calif.
[0330] The hybridoma cells are seeded and grown in a suitable culture medium that contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
[0331] Useful myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive media conditions, such as the presence or absence of HAT medium. Among these, preferred myeloma cell lines are murine myeloma lines, such as those derived from MOP-21 and MC-11 mouse tumors (available from the Salk Institute Cell Distribution Center, San Diego, Calif.), and SP-2 or X63-Ag8-653 cells (available from the American Type Culture Collection, Rockville, Md.). Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies. See e.g., Kozbor, J. Immunol., 1984, 133:3001.
[0332] After the identification of hybridoma cells that produce antibodies of the desired specificity, affinity, and/or biological activity, selected clones may be subcloned by limiting dilution procedures and grown by standard methods. See Goding, supra. Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as ascites tumors in an animal.
[0333] DNA encoding the monoclonal antibodies may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies). Thus, the hybridoma cells can serve as a useful source of DNA encoding antibodies with the desired properties. Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as bacteria (e.g., E. coli), yeast (e.g., Saccharomyces or Pichia sp.), COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody, to produce the monoclonal antibodies.
9.3. Humanized Antibodies
[0334] Humanized antibodies may be generated by replacing most, or all, of the structural portions of a monoclonal antibody with corresponding human antibody sequences. Consequently, a hybrid molecule is generated in which only the antigen-specific variable, or CDR, is composed of non-human sequence. Methods to obtain humanized antibodies include those described in, for example, Winter and Milstein, Nature, 1991, 349:293-299; Rader et al., Proc. Nat. Acad. Sci. USA., 1998, 95:8910-8915; Steinberger et al., J. Biol. Chem., 2000, 275:36073-36078; Queen et al., Proc. Natl. Acad. Sci. USA., 1989, 86:10029-10033; and U.S. Pat. Nos. 5,585,089, 5,693,761, 5,693,762, and 6,180,370.
9.4. Human Antibodies
[0335] Human antibodies can be generated by a variety of techniques known in the art, for example by using transgenic animals (e.g., humanized mice). See, e.g., Jakobovits et al., Proc. Natl. Acad. Sci. USA., 1993, 90:2551; Jakobovits et al., Nature, 1993, 362:255-258; Bruggermann et al., Year in Immuno., 1993, 7:33; and U.S. Pat. Nos. 5,591,669, 5,589,369 and 5,545,807. Human antibodies can also be derived from phage-display libraries (see e.g., Hoogenboom et al., J. Mol. Biol., 1991, 227:381-388; Marks et al., J. Mol. Biol., 1991, 222:581-597; and U.S. Pat. Nos. 5,565,332 and 5,573,905). Human antibodies may also be generated by in vitro activated B cells (see e.g., U.S. Pat. Nos. 5,567,610 and 5,229,275). Human antibodies may also be derived from yeast-based libraries (see e.g., U.S. Pat. No. 8,691,730).
10. Vectors, Host Cells, and Recombinant Methods
[0336] The invention also provides isolated nucleic acids encoding anti-CD39 antibodies, vectors and host cells comprising the nucleic acids, and recombinant techniques for the production of the antibodies.
[0337] For recombinant production of the antibody, the nucleic acid encoding it may be isolated and inserted into a replicable vector for further cloning (i.e., amplification of the DNA) or expression. In some aspects, the nucleic acid may be produced by homologous recombination, for example as described in U.S. Pat. No. 5,204,244.
[0338] Many different vectors are known in the art. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence, for example as described in U.S. Pat. No. 5,534,615.
[0339] Illustrative examples of suitable host cells are provided below. these host cells are not meant to be limiting.
[0340] Suitable host cells include any prokaryotic (e.g., bacterial), lower eukaryotic (e.g., yeast), or higher eukaryotic (e.g., mammalian) cells. Suitable prokaryotes include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia (E. coli), Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella (S. typhimurium), Serratia (S. marcescans), Shigella, Bacilli (B. subtilis and B. licheniformis), Pseudomonas (P. aeruginosa), and Streptomyces. One useful E. coli cloning host is E. coli 294, although other strains such as E. coli B, E. coli X1776, and E. coli W3110 are suitable.
[0341] In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are also suitable cloning or expression hosts for anti-CD39 antibody-encoding vectors. Saccharomyces cerevisiae, or common baker's yeast, is a commonly used lower eukaryotic host microorganism. However, a number of other genera, species, and strains are available and useful, such as Schizosaccharomyces pombe, Kluyveromyces (K. lactis, K. fragilis, K. bulgaricus K. wickeramii, K. waltii, K. drosophilarum, K. thermotolerans, and K. marxianus), Yarrowia, Pichia pastoris, Candida (C. albicans), Trichoderma reesia, Neurospora crassa, Schwanniomyces (S. occidentalis), and filamentous fungi such as, for example Penicillium, Tolypocladium, and Aspergillus (A. nidulans and A. niger).
[0342] Useful mammalian host cells include COS-7 cells, HEK293 cells; baby hamster kidney (BHK) cells; Chinese hamster ovary (CHO); mouse sertoli cells; African green monkey kidney cells (VERO-76), and the like.
[0343] The host cells used to produce the anti-CD39 antibody of this invention may be cultured in a variety of media. Commercially available media such as, for example, Ham's F10, Minimal Essential Medium (MEM), RPMI-1640, and Dulbecco's Modified Eagle's Medium (DMEM) are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz., 1979, 58:44; Barnes et al., Anal. Biochem., 1980, 102:255; and U.S. Pat. Nos. 4,767,704, 4,657,866, 4,927,762, 4,560,655, and 5,122,469, or WO 90/03430 and WO 87/00195 may be used.
[0344] Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics, trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
[0345] The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
[0346] When using recombinant techniques, the antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. For example, Carter et al. (Bio/Technology, 1992, 10:163-167) describes a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5), EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 minutes. Cell debris can be removed by centrifugation.
[0347] In some embodiments, the antibody is produced in a cell-free system. In some aspects, the cell-free system is an in vitro transcription and translation system as described in Yin et al., mAbs, 2012, 4:217-225, incorporated by reference in its entirety. In some aspects, the cell-free system utilizes a cell-free extract from a eukaryotic cell or from a prokaryotic cell. In some aspects, the prokaryotic cell is E coli. Cell-free expression of the antibody may be useful, for example, where the antibody accumulates in a cell as an insoluble aggregate, or where yields from periplasmic expression are low.
[0348] Where the antibody is secreted into the medium, supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon® or Millipore® Pellcon® ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
[0349] The antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being a particularly useful purification technique. The suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody. Protein A can be used to purify antibodies that are based on human γ1, γ2, or γ4 heavy chains (Lindmark et al., J. Immunol. Meth., 1983, 62:1-13). Protein G is useful for all mouse isotypes and for human γ3 (Guss et al., EMBO J., 1986, 5:1567-1575).
[0350] The matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. Where the antibody comprises a C.sub.H3 domain, the BakerBond ABX® resin is useful for purification.
[0351] Other techniques for protein purification, such as fractionation on an ion-exchange column, ethanol precipitation, Reverse Phase HPLC, chromatography on silica, chromatography on heparin Sepharose®, chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also available, and can be applied by one of skill in the art.
[0352] Following any preliminary purification step(s), the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5 to about 4.5, generally performed at low salt concentrations (e.g., from about 0 to about 0.25 M salt).
11. Pharmaceutical Compositions and Methods of Administration
[0353] Any of the antibodies provided herein can be provided in any appropriate pharmaceutical composition and be administered by any suitable route of administration. Suitable routes of administration include, but are not limited to, the inhalation, intraarterial, intradermal, intramuscular, intraperitoneal, intravenous, nasal, parenteral, pulmonary, and subcutaneous routes.
[0354] The pharmaceutical composition may comprise one or more pharmaceutical excipients. Any suitable pharmaceutical excipient may be used, and one of ordinary skill in the art is capable of selecting suitable pharmaceutical excipients. Accordingly, the pharmaceutical excipients provided below are intended to be illustrative, and not limiting. Additional pharmaceutical excipients include, for example, those described in the Handbook of Pharmaceutical Excipients, Rowe et al. (Eds.) 6th Ed. (2009), incorporated by reference in its entirety.
[0355] In some embodiments, the pharmaceutical composition comprises an anti-foaming agent. Any suitable anti-foaming agent may be used. In some aspects, the anti-foaming agent is selected from an alcohol, an ether, an oil, a wax, a silicone, a surfactant, and combinations thereof. In some aspects, the anti-foaming agent is selected from a mineral oil, a vegetable oil, ethylene bis stearamide, a paraffin wax, an ester wax, a fatty alcohol wax, a long chain fatty alcohol, a fatty acid soap, a fatty acid ester, a silicon glycol, a fluorosilicone, a polyethylene glycol-polypropylene glycol copolymer, polydimethylsiloxane-silicon dioxide, ether, octyl alcohol, capryl alcohol, sorbitan trioleate, ethyl alcohol, 2-ethyl-hexanol, dimethicone, oleyl alcohol, simethicone, and combinations thereof.
[0356] In some embodiments, the pharmaceutical composition comprises a cosolvent. Illustrative examples of cosolvents include ethanol, poly(ethylene) glycol, butylene glycol, dimethylacetamide, glycerin, and propylene glycol.
[0357] In some embodiments, the pharmaceutical composition comprises a buffer. Illustrative examples of buffers include acetate, borate, carbonate, lactate, malate, phosphate, citrate, hydroxide, diethanolamine, monoethanolamine, glycine, methionine, guar gum, and monosodium glutamate.
[0358] In some embodiments, the pharmaceutical composition comprises a carrier or filler. Illustrative examples of carriers or fillers include lactose, maltodextrin, mannitol, sorbitol, chitosan, stearic acid, xanthan gum, and guar gum.
[0359] In some embodiments, the pharmaceutical composition comprises a surfactant. Illustrative examples of surfactants include d-alpha tocopherol, benzalkonium chloride, benzethonium chloride, cetrimide, cetylpyridinium chloride, docusate sodium, glyceryl behenate, glyceryl monooleate, lauric acid, macrogol 15 hydroxystearate, myristyl alcohol, phospholipids, polyoxyethylene alkyl ethers, polyoxyethylene sorbitan fatty acid esters, polyoxyethylene stearates, polyoxylglycerides, sodium lauryl sulfate, sorbitan esters, and vitamin E polyethylene(glycol) succinate.
[0360] In some embodiments, the pharmaceutical composition comprises an anti-caking agent. Illustrative examples of anti-caking agents include calcium phosphate (tribasic), hydroxymethyl cellulose, hydroxypropyl cellulose, and magnesium oxide.
[0361] Other excipients that may be used with the pharmaceutical compositions include, for example, albumin, antioxidants, antibacterial agents, antifungal agents, bioabsorbable polymers, chelating agents, controlled release agents, diluents, dispersing agents, dissolution enhancers, emulsifying agents, gelling agents, ointment bases, penetration enhancers, preservatives, solubilizing agents, solvents, stabilizing agents, and sugars. Specific examples of each of these agents are described, for example, in the Handbook of Pharmaceutical Excipients, Rowe et al. (Eds.) 6th Ed. (2009), The Pharmaceutical Press, incorporated by reference in its entirety.
[0362] In some embodiments, the pharmaceutical composition comprises a solvent. In some aspects, the solvent is saline solution, such as a sterile isotonic saline solution or dextrose solution. In some aspects, the solvent is water for injection.
[0363] In some embodiments, the pharmaceutical compositions are in a particulate form, such as a microparticle or a nanoparticle. Microparticles and nanoparticles may be formed from any suitable material, such as a polymer or a lipid. In some aspects, the microparticles or nanoparticles are micelles, liposomes, or polymersomes. In certain embodiments, a composition provided herein is a pharmaceutical composition or a single unit dosage form. Pharmaceutical compositions and single unit dosage forms provided herein comprise a prophylactically or therapeutically effective amount of one or more prophylactic or therapeutic antibodies.
[0364] Further encompassed herein are anhydrous pharmaceutical compositions and dosage forms comprising an antibody, since water can facilitate the degradation of some antibodies.
[0365] Anhydrous pharmaceutical compositions and dosage forms provided herein can be prepared using anhydrous or low moisture containing ingredients and low moisture or low humidity conditions. Pharmaceutical compositions and dosage forms that comprise lactose and at least one active ingredient that comprises a primary or secondary amine can be anhydrous if substantial contact with moisture and/or humidity during manufacturing, packaging, and/or storage is expected.
[0366] An anhydrous pharmaceutical composition should be prepared and stored such that its anhydrous nature is maintained. Accordingly, anhydrous compositions can be packaged using materials known to prevent exposure to water such that they can be included in suitable formulary kits. Examples of suitable packaging include, but are not limited to, hermetically sealed foils, plastics, unit dose containers (e.g., vials), blister packs, and strip packs.
11.1. Parenteral Dosage Forms
[0367] In certain embodiments, provided are parenteral dosage forms. Parenteral dosage forms can be administered to subjects by various routes including, but not limited to, subcutaneous, intravenous (including bolus injection), intramuscular, and intraarterial. Because their administration typically bypasses subjects' natural defenses against contaminants, parenteral dosage forms are typically, sterile or capable of being sterilized prior to administration to a subject. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions.
[0368] Suitable vehicles that can be used to provide parenteral dosage forms are well known to those skilled in the art. Examples include, but are not limited to: Water for Injection USP; aqueous vehicles such as, but not limited to, Sodium Chloride Injection, Ringer's Injection, Dextrose Injection, Dextrose and Sodium Chloride Injection, and Lactated Ringer's Injection; water miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and polypropylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
[0369] Excipients that increase the solubility of one or more of the antibodies disclosed herein can also be incorporated into the parenteral dosage forms.
11.2. Dosage and Unit Dosage Forms
[0370] In human therapeutics, the doctor will determine the posology which he considers most appropriate according to a preventive or curative treatment and according to the age, weight, condition and other factors specific to the subject to be treated.
[0371] The amount of the antibody or composition which will be effective in the prevention or treatment of a disorder or one or more symptoms thereof will vary with the nature and severity of the disease or condition, and the route by which the antibody is administered. The frequency and dosage will also vary according to factors specific for each subject depending on the specific therapy (e.g., therapeutic or prophylactic agents) administered, the severity of the disorder, disease, or condition, the route of administration, as well as age, body, weight, response, and the past medical history of the subject. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
[0372] In certain embodiments, exemplary doses of a composition include milligram or microgram amounts of the antibody per kilogram of subject or sample weight (e.g., about 10 micrograms per kilogram to about 50 milligrams per kilogram, about 100 micrograms per kilogram to about 25 milligrams per kilogram, or about 100 microgram per kilogram to about 10 milligrams per kilogram). In certain embodiment, the dosage of the antibody provided herein, based on weight of the antibody, administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 6 mg/kg, 10 mg/kg, or 15 mg/kg or more of a subject's body weight. In another embodiment, the dosage of the composition or a composition provided herein administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg to 200 mg, 0.1 mg to 100 mg, 0.1 mg to 50 mg, 0.1 mg to 25 mg, 0.1 mg to 20 mg, 0.1 mg to 15 mg, 0.1 mg to 10 mg, 0.1 mg to 7.5 mg, 0.1 mg to 5 mg, 0.1 to 2.5 mg, 0.25 mg to 20 mg, 0.25 to 15 mg, 0.25 to 12 mg, 0.25 to 10 mg, 0.25 mg to 7.5 mg, 0.25 mg to 5 mg, 0.25 mg to 2.5 mg, 0.5 mg to 20 mg, 0.5 to 15 mg, 0.5 to 12 mg, 0.5 to 10 mg, 0.5 mg to 7.5 mg, 0.5 mg to 5 mg, 0.5 mg to 2.5 mg, 1 mg to 20 mg, 1 mg to 15 mg, 1 mg to 12 mg, 1 mg to 10 mg, 1 mg to 7.5 mg, 1 mg to 5 mg, or 1 mg to 2.5 mg.
[0373] The dose can be administered according to a suitable schedule, for example, once, two times, three times, or for times weekly. It may be necessary to use dosages of the antibody outside the ranges disclosed herein in some cases, as will be apparent to those of ordinary skill in the art. Furthermore, it is noted that the clinician or treating physician will know how and when to interrupt, adjust, or terminate therapy in conjunction with subject response.
[0374] Different therapeutically effective amounts may be applicable for different diseases and conditions, as will be readily known by those of ordinary skill in the art. Similarly, amounts sufficient to prevent, manage, treat or ameliorate such disorders, but insufficient to cause, or sufficient to reduce, adverse effects associated with the antibodies provided herein are also encompassed by the herein described dosage amounts and dose frequency schedules. Further, when a subject is administered multiple dosages of a composition provided herein, not all of the dosages need be the same. For example, the dosage administered to the subject may be increased to improve the prophylactic or therapeutic effect of the composition or it may be decreased to reduce one or more side effects that a particular subject is experiencing.
[0375] In certain embodiments, treatment or prevention can be initiated with one or more loading doses of an antibody or composition provided herein followed by one or more maintenance doses.
[0376] In certain embodiments, a dose of an antibody or composition provided herein can be administered to achieve a steady-state concentration of the antibody in blood or serum of the subject. The steady-state concentration can be determined by measurement according to techniques available to those of skill or can be based on the physical characteristics of the subject such as height, weight and age.
[0377] In certain embodiments, administration of the same composition may be repeated and the administrations may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months. In other embodiments, administration of the same prophylactic or therapeutic agent may be repeated and the administration may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months.
12. Therapeutic Applications
[0378] For therapeutic applications, the antibodies of the invention are administered to a mammal, generally a human, in a pharmaceutically acceptable dosage form such as those known in the art and those discussed above. For example, the antibodies of the invention may be administered to a human intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intra-cerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, or intratumoral routes. The antibodies also are suitably administered by peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects. The intraperitoneal route may be particularly useful, for example, in the treatment of ovarian tumors.
[0379] The antibodies provided herein may be useful for the treatment of any disease or condition involving CD39, such as cancer, autoimmune disease, and infection.
[0380] Any suitable cancer may be treated with the antibodies provided herein. Illustrative suitable cancers include, for example, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, anal cancer, appendix cancer, astrocytoma, basal cell carcinoma, brain tumor, bile duct cancer, bladder cancer, bone cancer, breast cancer, bronchial tumor, Burkitt Lymphoma, carcinoma of unknown primary origin, cardiac tumor, cervical cancer, chordoma, chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), chronic myeloproliferative neoplasm, colon cancer, colorectal cancer, craniopharyngioma, cutaneous T-cell lymphoma, ductal carcinoma, embryonal tumor, endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma, fibrous histiocytoma, Ewing sarcoma, eye cancer, germ cell tumor, gallbladder cancer, gastric cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumor, gestational trophoblastic disease, glioma, head and neck cancer, hairy cell leukemia, hepatocellular cancer, histiocytosis, Hodgkin lymphoma, hypopharyngeal cancer, intraocular melanoma, islet cell tumor, Kaposi sarcoma, kidney cancer, Langerhans cell histiocytosis, laryngeal cancer, leukemia, lip and oral cavity cancer, liver cancer, lobular carcinoma in situ, lung cancer, lymphoma, macroglobulinemia, malignant fibrous histiocytoma, melanoma, Merkel cell carcinoma, mesothelioma, metastatic squamous neck cancer with occult primary, midline tract carcinoma involving NUT gene, mouth cancer, multiple endocrine neoplasia syndrome, multiple myeloma, mycosis fungoides, myelodysplastic syndrome, myelodysplastic/myeloproliferative neoplasm, nasal cavity and par nasal sinus cancer, nasopharyngeal cancer, neuroblastoma, non-Hodgkin lymphoma, non-small cell lung cancer, oropharyngeal cancer, osteosarcoma, ovarian cancer, pancreatic cancer, papillomatosis, paraganglioma, parathyroid cancer, penile cancer, pharyngeal cancer, pheochromocytomas, pituitary tumor, pleuropulmonary blastoma, primary central nervous system lymphoma, prostate cancer, rectal cancer, renal cell cancer, renal pelvis and ureter cancer, retinoblastoma, rhabdoid tumor, salivary gland cancer, Sezary syndrome, skin cancer, small cell lung cancer, small intestine cancer, soft tissue sarcoma, spinal cord tumor, stomach cancer, T-cell lymphoma, teratoid tumor, testicular cancer, throat cancer, thymoma and thymic carcinoma, thyroid cancer, urethral cancer, uterine cancer, vaginal cancer, vulvar cancer, and Wilms tumor.
[0381] Any suitable autoimmune disease may be treated with the antibodies provided herein. Illustrative suitable autoimmune diseases, or diseases with an autoimmune component, include, for example, acute disseminated encephalomyelitis (ADEM), acute necrotizing hemorrhagic leukoencephalitis, Addison's disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-GBM/anti-TBM nephritis, antiphospholipid syndrome (APS), autoimmune angioedema, autoimmune aplastic anemia, autoimmune dysautonomia, autoimmune hepatitis, autoimmune hyperlipidemia, autoimmune immunodeficiency, autoimmune inner ear disease (AIED), autoimmune myocarditis, autoimmune oophoritis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune thrombocytopenic purpura (ATP), autoimmune thyroid disease, autoimmune urticarial, axonal & neuronal neuropathies, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Castleman disease, Celiac disease, Chagas disease, chronic fatigue syndrome, chronic inflammatory demyelinating polyneuropathy (CIDP), chronic recurrent multifocal ostomyelitis (CRMO), Churg-Strauss syndrome, cicatricial pemphigoid/benign mucosal pemphigoid, Crohn's disease, Cogans syndrome, cold agglutinin disease, colitis, congenital heart block, coxsackie myocarditis, CREST disease, essential mixed cryoglobulinemia, demyelinating neuropathies, dermatitis herpetiformis, dermatomyositis, Devic's disease (neuromyelitis optica), discoid lupus, Dressler's syndrome, endometriosis, eosinophilic esophagitis, eosinophilic fasciitis, erythema nodosum, experimental allergic encephalomyelitis, Evans syndrome, fibromyalgia, fibrosing alveolitis, giant cell arteritis (temporal arteritis), giant cell myocarditis, glomerulonephritis, Goodpasture's syndrome, granulomatosis with polyangiitis (GPA) (formerly called Wegener's Granulomatosis), Graves' disease, Guillain-Barre syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, hemolytic anemia, Henoch-Schonlein purpura, herpes gestationis, hypogammaglobulinemia, idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, IgG4-related sclerosing disease, immunoregulatory lipoproteins, inclusion body myositis, inflammatory bowel disease. interstitial cystitis, juvenile arthritis, juvenile diabetes (Type 1 diabetes), juvenile myositis, Kawasaki syndrome, Lambert-Eaton syndrome, leukocytoclastic vasculitis, lichen planus, lichen sclerosus, ligneous conjunctivitis, linear IgA disease (LAD), lupus (SLE), Lyme disease (chronic), Meniere's disease, microscopic polyangiitis, mixed connective tissue disease (MCTD), Mooren's ulcer, Mucha-Habermann disease, multiple sclerosis, myasthenia gravis, myositis, narcolepsy, neuromyelitis optica (Devic's), neutropenia, ocular cicatricial pemphigoid, optic neuritis, palindromic rheumatism, PANDAS (Pediatric Autoimmune Neuropsychiatric Disorders Associated with Streptococcus), paraneoplastic cerebellar degeneration, paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Parsonnage-Turner syndrome, pars planitis (peripheral uveitis), pemphigus, peripheral neuropathy, perivenous encephalomyelitis, pernicious anemia, POEMS syndrome, polyarteritis nodosa, type I, II, & III autoimmune polyglandular syndromes, polymyalgia rheumatic, polymyositis, postmyocardial infarction syndrome, postpericardiotomy syndrome, progesterone dermatitis, primary biliary cirrhosis, rimary sclerosing cholangitis, psoriasis, psoriatic arthritis, idiopathic pulmonary fibrosis, pyoderma gangrenosum, pure red cell aplasia, Raynauds phenomenon, reactive arthritis, reflex sympathetic dystrophy, Reiter's syndrome, relapsing polychondritis, restless legs syndrome, retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis, sarcoidosis, Schmidt syndrome, scleritis, scleroderma, Sjogren's syndrome, sperm & testicular autoimmunity, stiff person syndrome, subacute bacterial endocarditis (SBE), Susac's syndrome, sympathetic ophthalmia, Takayasu's arteritis, temporal arteritis/giant cell arteritis, thrombotic disease, thrombocytopenic purpura (TTP), Tolosa-Hunt syndrome, transverse myelitis, type 1 diabetes, ulcerative colitis, undifferentiated connective tissue disease (UCTD), uveitis, vasculitis, vesiculobullous dermatosis, vitiligo, and Wegener's granulomatosis (now termed Granulomatosis with Polyangiitis (GPA).
[0382] Any suitable infection may be treated with the antibodies provided herein. Illustrative suitable infections include, for example, hepatitis A virus, hepatitis B virus, hepatitis C virus (HCV), human immunodeficiency virus (HIV), and other viral infections.
13. Diagnostic Applications
[0383] In some embodiments, the antibodies provided herein are used in diagnostic applications. For example, an ant-CD39 antibody may be useful in assays for CD39 protein. In some aspects, the antibody can be used to detect the expression of CD39 in various cells and tissues. These assays may be useful, for example, evaluating cancer and autoimmune disease.
[0384] In some diagnostic applications, the antibody may be labeled with a detectable moiety. Suitable detectable moieties include, but are not limited to radioisotopes, fluorescent labels, and enzyme-substrate labels. In another embodiment of the invention, the anti-CD39 antibody need not be labeled, and the presence thereof can be detected using a labeled antibody which specifically binds to the anti-CD39 antibody.
14. Affinity Purification Reagents
[0385] The antibodies of the invention may be used as affinity purification agents. In this process, the antibodies may be immobilized on a solid phase such a resin or filter paper, using methods well known in the art. The immobilized antibody is contacted with a sample containing the CD39 protein (or fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the CD39 protein, which is bound to the immobilized antibody. Finally, the support is washed with another suitable solvent, such as glycine buffer, pH 5.0, that will release the CD39 protein from the antibody.
15. Kits
[0386] In some embodiments, an anti-CD39 antibody provided herein is provided in the form of a kit, i.e., a packaged combination of reagents in predetermined amounts with instructions for performing a procedure. In some embodiments, the procedure is a diagnostic assay. In other embodiments, the procedure is a therapeutic procedure.
[0387] In some embodiments, the kit further comprises a solvent for the reconstitution of the anti-CD39 antibody. In some embodiments, the anti-CD39 antibody is provided in the form of a pharmaceutical composition.
Examples
Example 1: Selection of CD39 Antigen-Binding Proteins
[0388] CD39 ABPs were selected from a synthetic library of human antibodies presented on the surface of yeast cells in IgG format, as generally described, e.g., in WO2009036379; WO2010105256; WO2012009568; and Xu et al., Protein Eng. Des. Sel., 2013, 26:663-670 (each incorporated by reference in its entirety), and more specifically as provided below. The sequences and characteristics of the ABPs isolated from the recombinant library are provided in Table S.
[0389] Eight naïve human synthetic yeast libraries each of .sup.˜10 E+09 diversity were propagated as described in WO2009036379; WO2010105256; WO2012009568; and Xu et al., Protein Eng. Des. Sel., 2013, 26:663-670; each incorporated by reference in its entirety. For the first two rounds of selection, a magnetic bead sorting technique utilizing the Miltenyi MACS® system was performed, as described in Siegel et al., J. Immunol. Meth., 2004, 286:141-153. The following rounds of selection were performed using flow cytometry based sorting. For all round of selection, the antigen was biotinylated human CD39 extracellular domain (heretofore “ECD”), and decreasing concentrations of antigen were used in each subsequent round of selection. In addition to selection on antigen, some rounds of selection were employed in order to reduce the number of non-specific binders utilizing soluble membrane proteins from CHO cells (see WO2014179363 and Xu et al., Protein Eng. Des. Sel., 2013, 26:663-670, each incorporated by reference in its entirety). After the final round of sorting, yeast were plated and individual colonies were picked for characterization and for nomination of clones for affinity maturation.
[0390] Antibody variable domains of interest were synthesized, with codon optimization to maximize transient expression in host cells. The variable regions were cloned in to expression vectors containing human immunoglobulin constant domains and their sequence confirmed. Antibody heavy and light chain vector pairings were transfected into Expi293 cells using the Expifectamine system (Invitrogen). Transient cultures were harvested on day 4 and clarified cell culture supernatant IgG titer was estimated using Bio-Layer Interferometry (BLI) using Octet (ForteBio) alongside standards. Antibodies were subsequently purified on a Protein A column and eluted using low pH glycine. Purified antibody samples were then buffer-exchanged or dialyzed into downstream assay-compatible buffers.
[0391] Antibody purity was assessed by running samples on SDS-PAGE and on an analytical size exclusion chromatography column.
[0392] Light Chain Shuffling: Heavy chain plasmids were extracted from naïve outputs (described herein) and transformed into a pre-made naïve light chain library with a diversity of 10E+06. Selections were performed as described above with one round of MACS sorting and three rounds of FACS sorting using decreasing amounts of biotinylated ECD antigen for respective rounds. Selected individual heavy chains from the primary discovery process were also independently transformed into separate pre-made light chain libraries with a diversity of 10E+06 and selections performed as described above with one round of MACS sorting and three rounds of FACS sorting using decreasing amount of biotinylated ECD antigen for respective rounds.
Example 2: Affinity Maturation
[0393] Optimization of naïve clones was carried out utilizing three maturation strategies; diversification of CDR-H1 and CDR-H2; diversification of CDR-H3; diversification of CDR-L1, L2 and L3; shuffling of diversified heavy and light chains.
[0394] CDR-H1 and CDR-H2 Selection: The CDR-H3s from clones selected from each of the light chain batch diversification, light chain diversification, and naïve discovery efforts were independently recombined into premade libraries with CDR-H1 and CDR-H2 variants of a diversity of >10E+8 and selections were performed using ECD antigen. Affinity pressures were applied by using decreasing concentrations of antigen.
[0395] CDR-H3 Selection: Clones obtained from the CDR-H1 and CDR-H2 selection procedure were subject to additional rounds of affinity maturation via walking dimer mutagenesis of the heavy chain. Selections were performed using ECD as antigen generally as described above but with the addition of employing FACS sorting for all selection rounds.
[0396] CDR-L1, L2, L3 Selection: Clones obtained from the CDR-H1 and CDR-H2 selection procedure were subject to additional rounds of affinity maturation via mutagenesis of the light chain. The CDR-L1 and CDR-L2 diversity derived from a pre-made library while CDR-L3 diversity derived from walking dimer mutagenesis. Selections were performed using ECD as antigen generally as described above but with the addition of employing FACS sorting for all selection rounds, with one round of MACS followed by three rounds of FACS in the CDR-L1, L2, L3 process described here.
[0397] Diversified Heavy Chain and Light Chain Shuffling: Outputs from heavy chain diversification and light diversification described above were recombined and selections were performed using ECD as antigen generally as described above but with the addition of employing FACS sorting for all selection rounds.
Example 3: Monovalent Affinity of Anti-hCD39 Antibodies to Recombinant CD39 Extracellular Domain
[0398] Binding kinetics were measured using the Octet Red96 system (ForteBio) at 25° C. in running buffer (lx Pall ForteBio Kinetics Buffer diluted into PBS or Tris pH 7.4). In brief, 1.25 mg/ml of unlabeled anti-hCD39 antibodies were immobilized onto anti-human Fc sensors. After a short baseline step in running buffer, the sensors were exposed to varying concentrations (10-300 nM) of rhCD39-ECD-His (R&D Systems) for the association step. Dissociation of the complex was monitored upon exposure of the sensors to running buffer once again. Data was processed using ForteBio Octet software with baseline subtraction, global fit and 1:1 binding model to obtain association and dissociation rates. K.sub.D was calculated from the ratio of k.sub.d to k.sub.a.
[0399] Data shown in
[0400] The paralog specificity of the anti-CD39 antibodies was assessed by biolayer interferometry using soluble recombinant human ENTDP2 and soluble recombinant human ENTDP3 (both from R&D Systems). ENTDP2 and ENTDP3 are enzymes with functions similar to CD39. None of the antibodies exhibited detectable binding to ENTDP2 or ENTDP3 (data not shown). Thus all of the antibodies exhibit specific binding to human CD39.
Example 4: Inhibition of Recombinant Human CD39 Extracellular Domain
[0401] The inhibition of recombinant human CD39 ECD by anti-CD39 antibodies was measured as follows. Recombinant human CD39/ENTPD1 (4397-EN from R&D systems), (either 5 or 10 nM final concentration) was combined with anti-CD39 IgGs (0.25 or 1 micromolar final concentration) in 25 mM Tris, 5 mM CaCl.sub.2, pH 7.5 in a 96-well plate and incubated at room temperature for 2 hrs. ATP (Sigma A1852-1VL) was then added to a final concentration of 500 micromolar and incubated at 37° C. for 60 minutes. The plate was then placed at room temperature and CellTiter-Glo Luminescent Cell Viability Assay solution was added to each well of the assay plate, mixed and read on a microplate reader using “CellTiter-Glo luminescent” preset. Control reactions consisting of negative control IgG, IgG only (no ATP), ATP only (no CD39) were run using the same method. Data values are the average of 2 replicates.
[0402] Inhibition of human CD39 ECD enzymatic activity by anti-CD39 antibodies was determined by measuring ATP levels using the CellTiter-Glo assay (
Example 5: Antibodies Bind to CHO Cells Expressing Human and Cyno CD39
[0403] Binding of anti-CD39 IgGs to Chinese Hamster Ovary K1 (CHO) CD39 cells. 100 nanomolar IgGs (each antibody is indicated as a unique clone number in the FIG.) were incubated at 25° C. for 30 minutes on ice in phosphate buffered saline (PBS) with parental CHO cells or CHO cells engineered to express either human or cynomolgus macaque (Macaca fascicularis) CD39 (CHO CD39 cells). Cells were then washed with ice cold PBS and incubated with a fluorescently labeled goat-anti-human IgG for 20 minutes on ice. Cells were washed and resuspended in ice cold PBS prior to analysis by flow cytometry. Fold over background binding levels represent the ratio of median fluorescence intensity (MFI) values for anti-CD39 antibodies binding to CHO CD39 to MFI values for anti-CD39 antibodies binding to the parental CHO cells.
[0404] The anti-CD39 antibodies bound to CHO cells expressing cellular human CD39 (CHO CD39 cells) and did not exhibit significant binding to parental CHO cells (
[0405] The ortholog specificity of the anti-CD39 antibodies was assessed with flow cytometry using CHO cells engineered to express either cynomolgus macaque or mouse CD39. The anti-CD39 antibodies bound to cynomolgus macaque CD39 to a similar extent as human CD39 (
Example 6: Binding of Antibodies to Cell Surface CD39 in MEL-28 or 721 Cells and Antibodies that Inhibit CD39 on MEL-28 Cells a Short Term ATPAse Assay
[0406] Cells were incubated with serially diluted anti-CD39 antibodies for 30 minutes at 4 degrees C. Cells were washed 3 times in FACS buffer (PS, 2% FBS, and 2 mM EDTA) and next incubated with secondary antibody (goat anti-human IgG Southern Biotech) at 1:100 for 30 minutes at 4 degrees C. Cells were washed, resuspended in FACS buffer, and analyzed for binding by flow cytometry analysis on BD Celesta.
[0407] 3.5×10.sup.4 MEL-28 cells/well were washed with Tris buffer and incubated with serially diluted (100-0.00013 nM) antibody for 30 minutes at 37 degrees C. 50 μM ATP was added to each well and incubated with cells for 15 minutes. The supernatants were collected and analyzed in Malachite Green Assay (R&D) according to manufacturer's protocol. Phosphate released from CD39 processing of ATP was used as a readout of enzyme activity. Palivizumab was used as an isotype control and ARL (Tocris) and POM-1 (Alpha Aesar), non-specific small molecule inhibitors of CD39, were used as positive controls at 100 μm.
[0408] All antibodies bound to endogenously expressed CD39 on both cell lines with similar affinity with EC50 ranges from 0.05-0.28 μg/ml on MEL-28 (see
[0409] After confirmation of cellular binding, anti-CD39 antibodies were evaluated for inhibition of ATPase activity on MEL-28 cell in short term 30 minute Malachite Green phosphate readout assay. Isotype control was used to establish maximum possible signal from ATP processing in MEL-28 cells-50 μm ATP addition to cells typically resulted in 55-60 μM phosphate signal in this assay (see
Example 7: ATP Preservation Quantified when MEL-28 Cells are Treated with CD39 Enzymatic Inhibitors
[0410] 3.5×10.sup.4 MEL-28 cells were plated overnight at 37 degrees C. Cells were washed with Tris assay buffer to remove phosphate. 100 nM titrated down to 0.005 pM of monoclonal antibodies were incubated with cells for 30 minutes at 37 degrees C. 50 μM ATP was added and incubated for 15 minutes. Supernates were harvested and frozen. Supernates were thawed and evaluated for ATP using the EnzyLight (EnzyLight ATP Assay Kit, BioAssay Systems). Palivizumab was used as an isotype control and ARL (Tocris) and POM-1 (Alpha Aesar) used at a concentration of 100 μM are non-specific small molecule inhibitors of CD39 as positive controls.
[0411] ATP was almost undetectable after 30 minutes post ATP addition to the cells in untreated and/or isotype treated samples (see
Example 8: Antibodies Inhibit CD39 Activity on MEL-28 in an Overnight Assay
[0412] 3.5×10.sup.4 MEL-28 cells/well were plated and incubated with antibodies overnight at 37 degrees C. Cells were washed to remove FBS. Cells next were pre-treated with antibodies in X-VIVO 15 FBS free media overnight at 37 degrees C. ATP was then spiked in at 50 μM for 15 minutes. Supernatants were collected and analyzed using AMP-Glo kit according to manufacturer's instructions (Promega). Palivizumab was used as an isotype control and POM-1 (Alpha Aesar), a non-specific small molecule inhibitor of CD39, was used as positive control at 100 μM.
[0413] Anti-CD39 antibodies tested in overnight AMPGlo assay in MEL-28 cells demonstrated sustained inhibition of ATPase activity as indicated by decreased AMP levels present in the supernatants (see
Example 9: Anti-CD 39 Antibodies Bind to Primary Human and Cyno B Cells
[0414] B cells were isolated from human donor leukopak using EasySep B cell isolation kit (STEMCELL Technologies). Cyno monocytes were purified from fresh cyno blood using NHP CD14 positive selection kit (Miltenyi) and flow through was collected and stained with CD4, CD8, CD20, CD16, and CD3 antibodies (BD). Human B cells or cyno cells were incubated with serially diluted anti-CD39 antibodies (15 μg/ml 7.5 fold serial dilution, 8-point) for 30 minutes at 4 degrees C. Cell were washed 3 times in FACS buffer (PS, 2% FBS, and 2 mM EDTA) and incubated with secondary antibody (mouse anti-human IgG southern biotech) at 1:100 for 30 minutes at 4 degrees C. Cells were washed 2 times in FACS buffer and resuspended in FACS buffer and analyzed on BD Celesta.
[0415] Detection of antibody binding is as described in
Example 10: Antibodies Inhibit CD39 Activity on Human B Cells
[0416] B cells were isolated from human leukopak using EasySep B cell isolation kit (STEMCELL Technologies). 5×10.sup.4 B cells/well were washed with Tris buffer and incubated with serially diluted (100-0.00013 nM) antibodies for 30 minutes at 37 degrees C. 50 μM ATP was added to each well and incubated with cells for 2 hrs. The supernatants were collected and analyzed in Malachite Green Assay (R&D) according to manufacturer's protocol. Phosphate released from CD39 processing of ATP was used as a readout of enzyme activity. Palivizumab was used as an isotype control and ARL (Tocris) and POM-1 (Alpha Aesar), non-specific small molecule inhibitors of CD39, were used as positive controls at 100 μM.
[0417] The antibodies were demonstrated to bind to primary human and cyno B cells (see
Example 11: Anti-CD39 Antibodies Inhibit ATPAse Activity on Human and Cyano Monocytes
[0418] Human monocytes were purified from leukopak using EasySep Human monocytes isolation kit (STEMCELL). Cyno monocytes were isolated from whole cyno blood using NHP CD14 positive selection kit (Miltenyi). Monocytes at 5×10.sup.4 cells/well were washed with Tris buffer and incubated with serially diluted (100-0.00013 nM) anti-CD39 antibodies for 30 minutes at 37 C. 50 μM ATP was added to the cells for 15 minutes at 37 C and supernatants were harvested and analyzed in Malachite Green Assay (R&D) for phosphate levels. Palivizμmab was used as an isotype control and ARL (Tocris) and POM-1 (Alpha Aesar), non-specific small molecule inhibitors of CD39, were used as positive controls at 100 μM.
[0419] CD39 expression has been detected on human leukocytes with the highest expression detected on monocytes (Thromb Res. 2007; 121(3):309-17). Because of this information, it was important to evaluate the ability of the anti-CD39 antibodies to inhibit ATPase activity on the cell surface. As demonstrated in
Example 12: Anti-CD39 Antibodies Bind to Primary Human TRegs and Inhibit CD39 Enzymatic Activity
[0420] Treg cells were isolated from human donor leukopak using CD4.sup.+CD25.sup.+CD127.sup.dim regulatory T cell isolation kit II (Miltenyi). Human Treg cells were incubated with serially diluted anti-CD39 antibodies (100 nM-0.00064 nM) for 30 minutes at 4 degrees C. Cell were washed 3 times in FACS buffer (PS, 2% FBS, and 2 mM EDTA) and incubated with secondary antibody (mouse anti-human IgG southern biotech) at 1:100 for 30 minutes at 4 degrees C. Cells were washed 2 times in FACS buffer, resuspended in FACS buffer and analyzed on BD Fortessa.
[0421] CD4.sup.+CD25.sup.+CD127.sup.dim human Treg cells were washed 3× with Tris buffer. Cells were incubated with anti-CD39 antibodies (100 nM-0.00064 nM) for 30 minutes at 37 C. The cells were spiked with 50 μM ATP and supernatants were collected after 15 minutes incubation at 37 C. Supernatants were analyzed for phosphate levels in Malachite Green Assay kit (R&D). Palivizumab was used as an isotype control and ARL (Tocris) and POM-1 (Alpha Aesar), non-specific small molecule inhibitors of CD39, were used as positive controls at 100 μM.
[0422] CD39 had been shown to be expressed on human regulatory T cells (Treg) and important for their suppressive function by hydrolysis of ATP to immune suppressive adenosine. (Blood. 2007 Aug. 15; 110(4):1225-32, Cellular & Molecular Immunology (2017) 14, 521-528; doi:10.1038/cmi.2016.30). In order to determine whether the anti-CD39 antibodies were capable of inhibiting CD39 enzymatic activity, it was important to evaluate the binding to human Tregs. Tregs were isolated from human PBMCs and the Tregs were purified and the anti-bodies were evaluated for binding by flow cytometry. The result indicate that the anti-CD39 antibodies bind to human Tregs (
Example 13: Anti-CD39 Antibodies Increase CD8.SUP.+ T Cell Response in a CMV Recall Response Assay
[0423] Frozen PBMCs are thawed and resuspended at 3×10.sup.6/ml and cultured in presence of CMV peptides (Miltenyi, PeptTivator CMV pp65) for 3 days in complete (10% FBS) media at 37 degrees C. T cells were then purified (STEMCELL, EasyStep) and rested for 24 hours at 37 degrees C. APCs were generated by depleting CD2 positive cells (STEMCELL, Easystep) from PBMCs from the same donor and plated at 5×10.sup.4/well overnight at 37 degrees C. The following day 5×10.sup.4 rested T cells were added to the APCs. Antibodies were added at 25 μg/ml plus 100μ M ATP+1 μM EHNA and Golgi plug/stop with CMV peptides and incubated at 37 degrees C. for 5 hours. T cells were stained and analyzed for intracellular IFN gamma on a Fortessa (Becton Dickinson) flow cytometer.
[0424] Adenosine has been shown to inhibit T cell activation. (Int J Oncol. 2008 March; 32(3):527-35). As the rate-limiting enzyme in ATP/ADP-AMP-adenosine pathway, inhibiting CD39 would diminish the levels of immune suppressive adenosine and increase immune activating ATP resulting in enhanced T cell activity. In order to evaluate the role of anti-CD39 antibodies inhibiting ATP/ADP-AMP hydrolysis, preventing the generation of adenosine which could result in an increased T cell response, a CMV recall assay was used. PBMCs were cultured in the presence of a pool of CMV peptides for 3 days and then the T cells were purified cultured with autologous PBMC plus CMV peptides and ATP+EHNA. After 5 hours the T cells were evaluated for the production of IFN gamma. The results indicate that some of the anti-CD39 antibodies were able to increase CD8.sup.+ T cells activity in a CMV recall responses assay. This demonstrates that inhibiting the enzymatic activity of CD39 prevents the generation of adenosine and preserves ATP levels and allowing for a robust T cell response to a peptide:MHC complex. In addition, not all antibodies that bind to CD39 and inhibit cell surface enzymatic activity are capable of increasing T cell response and the specific interaction of the antibody to CD39 is important.
Example 14: Evaluation of Antibodies for Inhibition of CD39 Activity on Mel-28 and Human Monocytes
[0425] 3.5×10.sup.4 MEL-28 cells/well were incubated with 100 nM down to 0.32 pM of monoclonal antibodies for 30 minutes. 50 μM ATP was added and incubated for 15 minutes. Supernate was evaluated for free phosphate (Pi) using the Malachite Green Phosphate Detection Kit (R&D Systems cat#DY996). Palivizumab was used as an isotype control and ARL (Tocris) and POM-1 (Alpha Aesar) used at a concentration of 100 μM as non-specific small molecule inhibitors of CD39 as positive controls. Cyno monocytes were isolated from whole cyno blood using NHP CD14 positive selection kit (Miltenyi). Monocytes at 5×10.sup.4 cells/well were washed with Tris buffer and incubated as described above.
[0426] When comparing anti-CD39 antibodies for enzymatic inhibition in short term assays, differences were observed. Some were able to block the release of free phosphate (Pi) measured in a malachite green assay and others demonstrated very little activity. For example, BY40v9 and 9-8B have little to no enzymatic inhibition at concentrations of 100 nM using both the MEL-28 cell or primary human monocyte compared to other anti-CD39 antibodies (e.g., 29579 and 28347) that are able to inhibit ATPase activity at low nM concentrations.
[0427] 9-8B was produced as described in US 2017/0335007 A1, using SEQ ID Nos. 22 and 23, as hIgG4. BY40v9 is an engineered variant of the antibody BY40 described in WO 2009/095478 A1 SEQ ID Nos. 1 and 5. We tried to express BY40 as described as a human IgG4 but repeated attempts failed. The VH described in SEQ No.1 appears to be missing several N-terminal residues compared to germline VH's, so we engineered in the missing residues with closest germline sequence from IMGT (http://imgt.org/), resulting in BY40-v9, which expressed and was determined to specifically bind rhCD39-ECD and cellular ECD.
Example 15: Design of Chimera and Region of Distinct Binding
[0428] (a) Examples of Antibodies that Bind Soluble Recombinant CD39 ECD and Cellular CD39 but do not Inhibit ATPase Activity and do not Compete with Cellular Inhibitors for Binding to ECD Inhibitors
[0429] 0.04-3.3 nM rhCD39-ECD (R&D Systems) was incubated with buffer, 50 μg/ml antibody or 100 μM POM-1 (Alpha Aesar) for 1 hr at 37° C. in assay buffer (25 mM Tris pH 7.5, 5 mM CaCl.sub.2) at which point ATP (Sigma) was spiked in to a final concentration of 10 μM, and the reaction further incubated for 30 min 37° C. Production of free phosphate (Pi) was subsequently measured using Malachite Green Phosphate Detection kit (R&D Systems).
[0430] Indicated cells were incubated in assay buffer with 10-25 μg/ml antibody, 100 μM POM-1 or 100 μM ARL for 30 min at 37° C. 5% CO.sub.2. ATP was added to a final concentration of 50 μM and the incubation continued for 15 min. Supernatant was evaluated for free phosphate (Pi) using the Malachite Green Phosphate Detection kit. Palivizumab is used as an isotype control and POM-1 and ARL are non-specific small molecule inhibitors of CD39.
[0431] A1 antibody was immobilized onto an Anti-Mouse IgG Fc Capture (AMC) biosensor (ForteBio). Association of hCD39-ECD was then monitored for 180 seconds via Bio-Layer Interferometry (BLI) using the Octet system (ForteBio), at which point the biosensor was dipped into competitor antibody and monitored for another 180 seconds. Association of the second antibody was recorded as an upward shift in the interference pattern and indicates that the antibodies bind to different epitopes on CD39. No change in the interference pattern indicated that A1 blocks the second antibody from binding to CD39.
[0432] Although A1 does bind hCD39 ECD (
[0433] The commercially available A1 antibody represents a group of anti-human CD39 monoclonal antibodies that do not directly inhibit the ATPase activity of CD39 and do not bin with any of the other anti-CD39 antibodies described here. More than 30 antibodies were discovered that do not inhibit ECD ATPase activity, do not inhibit cellular CD39 ATPase activity, but do compete with A1 for binding to ECD. These antibodies may be considered to bin with anti-hCD39 antibody A1.
(b) Example of Antibodies that have Limited Ability to Inhibit the ATPase Activity of Both Soluble Recombinant and Cellular CD39 and Bin Separately from Other Cellular CD39 Inhibitors
[0434] The methods are the same as set forth above except that instead of A1, the representative antibody was immobilized using anti-human IgG Fc Capture (AHC) biosensor.
[0435] Anti-hCD39 antibodies exemplified by 27536 and 28337 represent a group of antibodies that bind both soluble ECD and cellular CD39 and have the ability to inhibit their ATPase activity yet do not compete with other inhibitors for CD39 binding. Both 27536 and 28337 are able to inhibit the hydrolysis of ATP by hCD39 ECD compared to isotype or buffer controls as shown by μM Pi, as described herein (top left panel). 27536 and 28337 inhibit the hydrolysis of CD39 expressed on MEL-28 and OAW42 cells, as shown, compared to isotype control. Antibodies 27536 and 28337 represent a distinct bin group of anti-hCD39 inhibitory antibodies since they are blocked from binding CD39 ECD by another bin member that does not block other inhibitory antibodies such as 27571, 27579, 27597, or 38347 (see insert (c) at the bottom of
(c) Example of Antibodies that Inhibit the ATPase Activity of Soluble Recombinant CD39ECD but do not Inhibit Cellular CD39 and Bin Separately from Other CD39 ECD Inhibitors
[0436] The methods are as provided above, with the addition of experimental design where inhibition of 0.37 nM CD39 by 50 μg/ml antibody was challenged by ATP concentrations of 3-100 μM. Also, an 18 hour incubation was used with the antibody or isotype control. Finally, an additional 30 second baseline dip in buffer between antigen capture and dipping into a second competitor antibody for 300 seconds was used.
[0437] Anti-hCD39 antibodies exemplified by 27549 represent a group of antibodies that can bind ECD and cellular CD39 but can only inhibit ECD ATPase activity and not cellular CD39 ATPase activity. As can be seen in
[0438] Antibody 27549 represents a group of anti-human CD39 monoclonal antibodies that directly inhibit the ATPase activity of sol CD39 ECD yet does inhibit cellular CD39 despite being able to bind to CD39 expressed on cells (
(d) Example of Antibodies that Inhibit the ATPase Activity of ECD and Cellular CD39 and Bin Separately from Other CD39 ECD and/or Cellular Inhibitors
[0439] The methods are as provided above.
[0440] Antibodies 27571, 27579 and 28347 represent a group of anti-human CD39 antibodies that directly inhibit the ATPase activity of soluble CD39 ECD and inhibit cellular CD39 and yet do not compete with A1, cellular inhibitors 27536 or 28337, or ECD inhibitor 27549 (
(e) Examples of Inhibitory Antibodies that Make Distinct Contacts with CD39
[0441] Chimeras were generated by replacing human CD39 with mouse CD39 sequence in mammalian expression vectors. The chimeras were expressed in CHO cells and the ability of anti-human CD39 antibodies to bind the chimeras tested via FACS. In brief, cells were washed and blocked in FACS buffer (PBS/2% FBS) for 30 min on ice. They were then incubated with 15 μg/ml anti-human CD39 antibodies diluted in FACS buffer×1 h on ice. After 2 washes, cells were incubated with fluorescently labeled anti-human Fc antibodies, anti-mouse Fc antibodies, or anti-mCD39 antibody (R&D Systems 495826) diluted in FACS buffer per manufacturers' instructions×30 min on ice. After 2 washes, cells were resuspended in FACS buffer and analyzed on BD Fortessa. Data was processed with FlowJo. Positive binding was scored as “yes” and lack of binding was scored as “NO” and examples of FACS plots used to generate this table are in
[0442] Chimeras formed between human and mouse CD39 distinguish regions critical for antibody contact that are unique to inhibitory antibodies such as 31414, 31895, 31873, 31901, 31905, reference antibodies such as BY40v9 and 9-8B, and commercial antibodies such as A1 and 498403. Columns 1 and 3 describe the human CD39 sequences flanking the mouse CD39 sequence described in column 2. Column 4 lists the exact mouse amino sequence in the chimera.
[0443] The antibodies described thus far have no/minimal cross-reactivity to mouse CD39, which shares 78% percent identity with human CD39 in the extracellular domain. Chimeras were therefore made between human and mouse CD39 in order to identify those region(s) critical to antibody recognition and binding. To that end, 8 chimeras were generated with the sequence swaps chosen based on sequence diversity between human and mouse CD39 and potential for surface exposure based on rat ENTPD1 and rat ENTPD2 crystal structures. Thus, these 8 chimeras do not comprehensively interrogate all potential contact residues. All tested antibodies were able to bind Chimeras #1,3,5,6,7, and 8, suggesting that these chimeras maintained overall global structural integrity. A1 and 498403 lost the ability to bind Chimera #4, indicating that residues critical to their contact with human CD39 had been lost. A1, 498403, BY40v9 and 9-8B were able to bind Chimera #2, suggesting that this chimera maintained overall global structural integrity. In contrast, inhibitory antibodies 31414, 31895, 31901, 31905, and 31873 were able to bind all chimeras but Chimera #2. Thus, Chimera #2 has lost residues critical to making contacts with these antibodies and therefore E143-N158 constitute part or all of the human CD39 epitope for these antibodies. Notably, these antibodies belong to the bin group exemplified by 27571, 27579 and 28347 in
[0444] Chimeras were generated by mutagenesis of Chimera #2 or WT hCD39 expression vectors. Residues for mutagenesis were chosen based on divergence between human and mouse CD39. The chimeras were expressed in CHO cells and the ability of anti-human CD39 antibodies to bind the chimeras tested via FACS, as described in
[0445] Specific residues critical for antibody contact can distinguish inhibitory antibodies 31414, 31418, and 31895 from 31901, 31905, and 31873. Individual amino acids in the mouse sequence of human-mouse Chimera #2, when reverted back to the respective human residue (resulting in Chimera #9,10), restore the ability of antibodies 31895, 31414, 31418 to bind to CD39 but not the ability of 31901, 31905, or 31873 to bind CD39. Mutation of individual residues in the context of otherwise fully human CD39 (Chimeras #11,12) did not impair the binding ability of any of the tested antibodies. Co-mutation of two human residues to the cognate mouse residues (Chimeras #13,14) did not impair binding by antibodies 31414, 31418 or 31895. In stark contrast, antibodies 31901, 31905, and 31873 completely lost their ability to bind Chimeras #13 and 14. The ability of indicated antibodies to bind a given chimera was determined by FACS. In particular,
[0446] As demonstrated in
(f) FACS Plots Highlighting the Importance of Human CD39 Residue D150 and/or E153 in Recognition of Antibodies Represented by 31414, 31418, and 31895 and FACS Plots Highlighting the Importance of Human CD39 Residues N99, R154, and/or E153 in Recognition by Antibodies Represented by 31901, 31905, and 31873
[0447] The methods are as provided above for the examples of inhibitory antibodies that make distinct contacts with CD39.
[0448] The ability of indicated antibodies to bind to a given chimera was determined by FACS.
[0449] While antibodies 31414, 31418, 31895, 31873, 31901, and 31905 all share a common requirement for human CD39 residues E143-N158, these antibodies make different critical contacts with residues within and outside of this region. Thus, antibodies, which belong to the bin group represented, by antibodies 27571, 27579, and 28347 (
Example 16: Anti-CD39 Antibodies are Reversible Allosteric, not Competitive, Inhibitors Due to V.SUB.max .Suppression of V.SUB.Max
[0450] Anti-CD39 antibodies or isotype control antibody (100 nanomolar final concentration) were incubated with MEL-28 cells (35,000 MEL-28 cells/well) endogenously expressing human CD39 at 37° C. for 20 minutes in the presence of EnzChek reagents (PNP & MESG). Immediately following the addition of ATP (final concentrations ranging from 0-450 micromolar), the rate of ATP hydrolysis to free phosphate (Pi) by CD39 was monitored over time at Abs360 nm using SpectraMax i3× plate reader. The initial enzyme velocity, ν0, was determined from the linear region of Pi vs. time curve for each ATP concentration. The plot of ν0 vs. [ATP] was curve fit using non-linear regression of the Michaelis-Menten kinetic model.
[0451] The ATP hydrolysis rate by CD39 expressed on MEL-28 cells can be markedly reduced by the anti-CD39 antibodies (see
[0452] The plot of initial velocity versus ATP concentration for multiple concentrations of the anti-CD39 antibody 29872 indicates that the mechanism of inhibition of this IgG antibody is not competitive (see
[0453] Many of the other anti-CD39 antibodies tested in this assay showed a similar profile for CD39 enzymatic inhibition (data not shown), indicating that they also may be non-competitive inhibitors, un-competitive inhibitors, or mixed inhibitors of CD39. The mechanism of enzymatic inhibition of these antibodies suggests that they retain their full inhibition of CD39 enzymatic inhibition at high ATP concentrations. The anti-CD39 antibodies appear to be reversible inhibitors.
Example 17: Anti-CD39 can Induce Internalization of CD39 on Cyno Monocytes
[0454] Anti-CD39 antibodies were injected into cynomolgus monkeys to test for ability to downregulate CD39 on cell surface of cyno monocytes. CD39 internalization was assessed by FACS of whole blood samples collected pre-dose, Day 1, Day 7, and Day 14 after antibody treatment. Non-competing anti-CD39-PE antibody (clone A1) was used to measure CD39 levels on CD14+ gated monocytes. Data is shown as MFI of Al-PE on gated cyno monocytes in
[0455] Cynomolgus monkeys were injected with anti-CD39 antibodies at 10 mg/kg. Blood samples were collected prior to injection and on Day 1, Day 7, and Day 14 after treatment. For each time-point, 50 uL of cynomolgus whole blood was incubated with 30 uL of staining buffer (PBS, 2% FBS, 2 mM EDTA, 3% mouse serum, 5% goat serum) containing CD14 and CD20 antibodies (eBioscience) and an Fc blocking reagent (BD) for 30 minutes at 4 C. CD39 antibody (clone eBioA1, eBioscience) was added to the sample and incubated for an additional 40 minutes at 4 degrees C. Following incubation, the samples were treated with ACK lysis buffer (ThermoFisher) for 10 minutes at room temperature to lyse red blood cells. Samples were washed several times with staining buffer and fixed with 1% PFA (Sigma) before acquisition on a BD Fortessa X-20 flow cytometer. Total CD39 receptor expression on CD14 positive monocytes was determined by mean fluorescence intensity.
[0456] CD39 was highly expressed on cyno monocytes prior to antibody treatment in all blood samples tested (pre-dose). Anti-CD39 antibodies tested in vivo had distinct internalization profiles where antibody 1 treatment led to downregulation of CD39 on cell surface of monocytes and antibody 2 had no effect on overall CD39 levels. Apparent decrease of CD39 levels after antibody 1 treatment was not due to A1 antibody competing with antibody 1 for binding to CD39 as the epitopes for A1 and antibody 1 are distinct from each other.
Example 18: Anti-CD39 Antibody Increases Stimulated Human CD4.SUP.+ and CD8.SUP.+ T Cell in the Presence of Exogenous ATP
[0457] Anti-CD3+anti-CD28 stimulated PBMCs were treated with anti-CD39 antibody 31895 or isotype control in the presence of 50 μM ATP for 96 hours. Proliferation of CD4.sup.+ and CD8.sup.+ T cells was measured by Cell Trace Violet by flow cytometry.
[0458]
Example 19: Anti-CD39 Antibody Increase Stimulated PBMC Secretion of INF-γ, TNF-α and IL-2
[0459] Human PBMCs were treated with anti-CD3+anti-CD28 and incubated with anti-CD39 antibody 31895 or isotype control in presence (B) or absence (A) of exogenous ATP (50 μM). Supernatants were harvested after 96 hours and cytokines were measured using a Meso Scale Discovery human cytokine kit.
[0460]
Example 20: Anti-CD39 Antibody Increases Stimulated PBMC Secretion of INF-γ, TNF-α, IL-2 and IL-1β
[0461] Human PBMCs were stimulated with anti-CD3+anti-CD28 and incubated with anti-CD39 antibodies 31895, HAO-391 (See, SEQ ID 10/SEQ ID 11 from WO 2017/089334), HAO mAb4 (See SEQ ID 12/SEQ ID 13 from WO2017157948) or isotype control at a fixed concentration of 50 μg/ml in presence of ATP. Supernatants were harvested after 96 hours and analyzed by Meso Scale Discovery human cytokine kit.
[0462]
Example 21: Anti-39 Antibody 31895 Increase Extracellular ATP Accumulation and Reduces Adenosine Generation by CD39.SUP.+.CD73.SUP.+ SK-MEL-28 Cells
[0463] SK-MEL-28 cells were treated with 31895, isotype control, or small molecule inhibitors (EHNA, ARL, or POM-1) for 1 hour and 50 μM ATP was added for 15 min prior to harvesting of the supernatants. The supernatants were analyzed for ATP levels using AmpGlo Kit (A) and for adenosine levels using LC/MS analysis (B). % Adenosine levels were normalized to isotype control (100%) and SK-MEL-28 CD39 KO cells (0%).
[0464] The results are shown in
Example S: Sequences
[0465] Table S provides sequences referred to herein.
TABLE-US-00003 TABLE S Sequences. SEQ ID NO: Region Scheme/Clone Sequence 1 CDR-H1 Chothia GYTFTSY 2 CDR-H1 Chothia GYTFKSY 3 CDR-H1 Chothia GYIFKSY 4 CDR-H1 Chothia GYTFQSY 5 CDR-H1 Chothia GYTFFSY 6 CDR-H1 Chothia GYTFVSY 7 CDR-H1 Chothia GGTFSSLAIS 8 CDR-H1 Chothia GGTFSKLAIS 9 CDR-H1 Chothia GGTFSHT 10 CDR-H1 Chothia GGTFSSL 11 CDR-H1 Chothia GGTFSLL 12 CDR-H1 Chothia GGTFQSL 13 CDR-H1 Chothia GGTFPSN 14 CDR-H1 Chothia GGTFSAM 15 CDR-H1 Chothia GGTFASL 16 CDR-H1 Chothia GGTFSWL 17 CDR-H1 Chothia GGTFSSY 18 CDR-H1 Chothia GGTFGSY 19 CDR-H1 Chothia GGTFSKY 20 CDR-H1 Chothia GGTFGRY 21 CDR-H1 Chothia GGTFESY 22 CDR-H1 Chothia GGTFSNY 23 CDR-H1 Chothia GGAFSSY 24 CDR-H1 Chothia GFTFSSY 25 CDR-H1 Kabat SYYMH 26 CDR-H1 Kabat SYEMH 27 CDR-H1 Kabat SYQMH 28 CDR-H1 Kabat SYYMY 29 CDR-H1 Kabat SYFMH 30 CDR-H1 Kabat SLAIS 31 CDR-H1 Kabat KLAIS 32 CDR-H1 Kabat HTAIS 33 CDR-H1 Kabat SLPIS 34 CDR-H1 Kabat LLAIS 35 CDR-H1 Kabat SNAIS 36 CDR-H1 Kabat AMAIS 37 CDR-H1 Kabat WLAIS 38 CDR-H1 Kabat SYAIS 39 CDR-H1 Kabat SYGIS 40 CDR-H1 Kabat KYGIS 41 CDR-H1 Kabat NYAIS 42 CDR-H1 Kabat SYATS 43 CDR-H1 Kabat SYAIG 44 CDR-H1 Kabat SYSMN 45 CDR-H1 Kabat SYGMN 46 CDR-H2 Chothia NPSGGST 47 CDR-H2 Chothia NPSVGS 48 CDR-H2 Chothia NPSGGS 49 CDR-H2 Chothia NPLGGG 50 CDR-H2 Chothia NPRGGS 51 CDR-H2 Chothia IPIFGT 52 CDR-H2 Chothia GFGT 53 CDR-H2 Chothia LPIGGT 54 CDR-H2 Chothia LPIAGT 55 CDR-H2 Chothia LPIFGE 56 CDR-H2 Chothia IPRGGT 57 CDR-H2 Chothia IPEFGI 58 CDR-H2 Chothia IPSIGT 59 CDR-H2 Chothia IPISGT 60 CDR-H2 Chothia IPTFGT 61 CDR-H2 Chothia SSSSSY 62 CDR-H2 Chothia WYDGSN 63 CDR-H2 Kabat VINPSGGSTSYAQKFQG 64 CDR-H2 Kabat RINPSVGSTWYAQKFQG 65 CDR-H2 Kabat RINPSGGSTWYAQKFQG 66 CDR-H2 Kabat KINPSGGSTWYAQKFQG 67 CDR-H2 Kabat VINPLGGGTSYAQKFQG 68 CDR-H2 Kabat SINPRGGSTSYAQKFQG 69 CDR-H2 Kabat GIIPIFGTANYAQKFQG 70 CDR-H2 Kabat GI--GFGTANYAQKFQG 71 CDR-H2 Kabat GILPIGGTANYAQKFQG 72 CDR-H2 Kabat GILPIAGTANYAQKFQG 73 CDR-H2 Kabat GILPIFGEANYAQKFQG 74 CDR-H2 Kabat GIIPRGGTANYAQKFQG 75 CDR-H2 Kabat SIIPIFGTANYAQKFRG 76 CDR-H2 Kabat SIIPEFGIANYAQKFQG 77 CDR-H2 Kabat SIIPIFGTANYAQKFQG 78 CDR-H2 Kabat GIIPISGTANYAQEFQG 79 CDR-H2 Kabat GIIPTFGTANYAQKFQG 80 CDR-H2 Kabat SISSSSSYIYYADSVKG 81 CDR-H2 Kabat VIWYDGSNKYYADSVKG 82 CDR-H3 GKREGGTEYLRH 83 CDR-H3 GKREGGTEYLRK 84 CDR-H3 GKREGGTEYLRS 85 CDR-H3 GKREGGTEYLRN 86 CDR-H3 GKREGGTEYLRV 87 CDR-H3 GGAKYASTYGMDV 88 CDR-H3 GGAKYASTHGMDV 89 CDR-H3 GGAKYASQLGMDV 90 CDR-H3 GGAKYASKWGMDV 91 CDR-H3 GGAKYAVGYGMDV 92 CDR-H3 GGAKYAGRYGMDV 93 CDR-H3 GGAKYARTYGMDV 94 CDR-H3 ESGGYRDHRLDV 95 CDR-H3 ESGTYRDHRLDV 96 CDR-H3 ESGGYRDHRLGV 97 CDR-H3 DFTDYSSGYSSGWTY 98 CDR-H3 DTLYSSGAYYGYNV 99 CDR-H3 AKRGYDSYGGVYFDY 100 CDR-H3 GPTVTATTSIGTHNWFDP 101 CDR-H3 EGRGYDSSRYYKFWFDPWGQGTLVTVSS 102 CDR-H3 DGGGYRHHYFDL 103 CDR-H3 ESGGYRDHKLDV 104 CDR-H3 DGGGYQHHYFDL 105 CDR-H3 DSGYHRHYSDY 106 CDR-H3 DPLGIRKHWFDP 107 CDR-H3 DTPRWRYHYFDY 108 CDR-H3 ERRGSLALGMDV 109 CDR-H3 DLGGYSYGEPYYYYYGMDV 110 CDR-L1 RASQSVSSSYLA 111 CDR-L1 RASQSVASSYLA 112 CDR-L1 EASQSVSYSYLA 113 CDR-L1 KASESVSSSYLA 114 CDR-L1 RASQYVSSSYLA 115 CDR-L1 KSSQSVLFSSNNKNYLA 116 CDR-L1 KSSRSVLFSSNNKNYLA 117 CDR-L1 KSSKSVLYSNNNKNYLA 118 CDR-L1 RASQSVGSNLA 119 CDR-L1 KSSQSVLYSSNNKNYLA 120 CDR-L1 QASQDISNYLN 121 CDR-L1 RASQSVSSYLA 122 CDR-L1 RASQSVSRYLA 123 CDR-L1 RASQSISSWLA 124 CDR-L1 RASQSVSSDYLA 125 CDR-L2 GASSRAT 126 CDR-L2 GASNRHT 127 CDR-L2 YASSRAY 128 CDR-L2 GASSRAN 129 CDR-L2 YASSRAT 130 CDR-L2 YASNRAT 131 CDR-L2 WASTRES 132 CDR-L2 WASSRES 133 CDR-L2 WASTRQS 134 CDR-L2 WASTRAS 135 CDR-L2 GASTRAT 136 CDR-L2 GASTRAS 137 CDR-L2 DASNLET 138 CDR-L2 DASNRAT 139 CDR-L2 DASKRAT 140 CDR-L2 KASSLES 141 CDR-L3 QQYHSYIT 142 CDR-L3 QQYHNAIT 143 CDR-L3 QQYYFYIT 144 CDR-L3 QQYHSALT 145 CDR-L3 QQYHGGIT 146 CDR-L3 QQYHRRIT 147 CDR-L3 QQYHSGIT 148 CDR-L3 QQYYLYPLT 149 CDR-L3 QQYWTYPLT 150 CDR-L3 QQYLLYPLT 151 CDR-L3 QQYLIWPLT 152 CDR-L3 QQYLLWPLT 153 CDR-L3 QQFYFFPPT 154 CDR-L3 QQAYTFPPT 155 CDR-L3 QQYYIFPPT 156 CDR-L3 QQRNFYPPT 157 CDR-L3 QQFVLWPRT 158 CDR-L3 QQHVNFPLT 159 CDR-L3 QQSVFWPIT 160 CDR-L3 QQLTKWPLT 161 CDR-L3 QQDVLWPLT 162 CDR-L3 QQYGLFPIT 163 CDR-L3 QQHTVWPIT 164 CDR-L3 QQVLNYPLT 165 CDR-L3 QQSYFLPPT 166 CDR-L3 QQAHSSPYT 167 Leader for Leader MKYLLPTAAAGLLLLAAQPAMA scFV, scFv-Fc 168 Linker for Linker GGGGSGGGGSGGGGS scFV, scFV-FC 169 C-Term Tag for C-Term Tag GPGGQHHHHHH scFV, scFV-FC 170 C-Term Tag for C-Term Tag PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD scFv, scFV-FC TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 171 scFv 29872 MKYLLPTAAAGLLLLAAQPAMAQVQLVQSGAEV KEPGASVKVSCKAPGYTFTSYYMHWVRQAPGQG LEWMGVINPSGGSTSYAQKFQGRVTMTRDTSTS TVYMELSSLRSEDTAVYYCARGKREGGTEYLRH WGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQS PGTLSLSPGERATLSCRASQSVSSSYLAWYQQK PGQAPRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQYHSYITFGGGTKVEI KGPGGQHHHHHH 172 scFv 31895 MKYLLPTAAAGLLLLAAQPAMAQVQLVQSGAEV KKPGASVKVSCKASGYTFKSYEMHWVRQAPGQG LEWMGRINPSVGSTWYAQKFQGRVTMTRDTSTS TVYMELSSLRSEDTAVYYCARGKREGGTEYLRK WGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQS PGTLSLSPGERATLSCRASQSVASSYLAWYQQK PGQAPRLLIYGASNRHTGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQYHNAITFGGGTKVEI KGPGGQHHHHHH 173 scFv 31414 MKYLLPTAAAGLLLLAAQPAMAQVQLVQSGAEV KKPGASVKVSCKASGYTFKSYEMHWVRQAPGQG LEWMGRINPSVGSTWYAQKFQGRVTMTRDTSTS TVYMELSSLRSEDTAVYYCARGKREGGTEYLRN WGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQS PGTLSLSPGERATLSCRASQSVSSSYLAWYQQK PGQAPRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQYHSYITFGGGTKVEI KGPGGQHHHHHH 174 scFv 31905 MKYLLPTAAAGLLLLAAQPAMAQVQLVQSGAEV KKPGSSVKVSCKASGGTFPSNAISWVRQAPGQG LEWMGGIGFGTANYAQKFQGRVTITADESTSTA YMELSSLRSEDTAVYYCARGGAKYARTYGMDVW GQGTTVTVSSGGGGSGGGGSGGGGSDIVMTQSP DSLAVSLGERATINCKSSKSVLYSNNNKNYLAW YQQKPGQPPKLLIYWASTRQSGVPDRFSGSGSG TDFTLTISSLQAEDVAVYYCQQYLLYPLTFGGG TKVEIKGPGGQHHHHHH 175 scFv-Fc 29872 MKYLLPTAAAGLLLLAAQPAMAQVQLVQSGAEV KEPGASVKVSCKAPGYTFTSYYMHWVRQAPGQG LEWMGVINPSGGSTSYAQKFQGRVTMTRDTSTS TVYMELSSLRSEDTAVYYCARGKREGGTEYLRH WGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQS PGTLSLSPGERATLSCRASQSVSSSYLAWYQQK PGQAPRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQYHSYITFGGGTKVEI KPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K 176 scFv-Fc 31895 MKYLLPTAAAGLLLLAAQPAMAQVQLVQSGAEV KKPGASVKVSCKASGYTFKSYEMHWVRQAPGQG LEWMGRINPSVGSTWYAQKFQGRVTMTRDTSTS TVYMELSSLRSEDTAVYYCARGKREGGTEYLRK WGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQS PGTLSLSPGERATLSCRASQSVASSYLAWYQQK PGQAPRLLIYGASNRHTGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQYHNAITFGGGTKVEI KPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K 177 scFv-Fc 31414 MKYLLPTAAAGLLLLAAQPAMAQVQLVQSGAEV KKPGASVKVSCKASGYTFKSYEMHWVRQAPGQG LEWMGRINPSVGSTWYAQKFQGRVTMTRDTSTS TVYMELSSLRSEDTAVYYCARGKREGGTEYLRN WGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQS PGTLSLSPGERATLSCRASQSVSSSYLAWYQQK PGQAPRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQYHSYITFGGGTKVEI KPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K 178 scFv-Fc 31905 MKYLLPTAAAGLLLLAAQPAMAQVQLVQSGAEV KKPGSSVKVSCKASGGTFPSNAISWVRQAPGQG LEWMGGIGFGTANYAQKFQGRVTITADESTSTA YMELSSLRSEDTAVYYCARGGAKYARTYGMDVW GQGTTVTVSSGGGGSGGGGSGGGGSDIVMTQSP DSLAVSLGERATINCKSSKSVLYSNNNKNYLAW YQQKPGQPPKLLIYWASTRQSGVPDRFSGSGSG TDFTLTISSLQAEDVAVYYCQQYLLYPLTFGGG TKVEIKPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK 179 VH 27579 QVQLVQSGAEVKEPGASVKVSCKAPGYTFTSYY MHWVRQAPGQGLEWMGVINPSGGSTSYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRHWGQGTLVTVSS 180 VH 31895 QVQLVQSGAEVKKPGASVKVSCKASGYTFKSYE MHWVRQAPGQGLEWMGRINPSVGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRKWGQGTLVTVSS 181 VH 31415 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYQ MHWVRQAPGQGLEWMGRINPSGGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRSWGQGTLVTVSS 182 VH 31414 QVQLVQSGAEVKKPGASVKVSCKASGYTFKSYE MHWVRQAPGQGLEWMGRINPSVGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRNWGQGTLVTVSS 183 VH 31891 QVQLVQSGAEVKKPGASVKVSCKASGYIFKSYE MHWVRQAPGQGLEWMGRINPSVGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRVWGQGTLVTVSS 184 VH 29871 QVQLVQSGAEVKKPGASVKVSCKASGYTFQSYY MHWVRQAPGQGLEWMGKINPSGGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRHWGQGTLVTVSS 185 VH 31418 QVQLVQSGAEVKKPGASVKVSCKASGYTFKSYE MHWVRQAPGQGLEWMGRINPSGGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRHWGQGTLVTVSS 186 VH 31431 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYQ MHWVRQAPGQGLEWMGRINPSGGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRHWGQGTLVTVSS 187 VH 31421 QVQLVQSGAEVKKPGASVKVSCKASGYTFFSYY MYWVRQAPGQGLEWMGVINPLGGGTSYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRHWGQGTLVTVSS 188 VH 31429 QVQLVQSGAEVKKPGASVKVSCKASGYTFVSYF MHWVRQAPGQGLEWMGSINPRGGSTSYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRHWGQGTLVTVSS 189 VH 29872 QVQLVQSGAEVKKPGASVKVSCKASGYTFKSYE MHWVRQAPGQGLEWMGRINPSVGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRHWGQGTLVTVSS 190 VH 28347 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSLA ISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTNTAYMELSSLRSEDTAVYYCARG GAKYASTYGMDVWGQGTTVTVSS 191 VH 31896 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSKLA ISWVRQAPGQGLEWMGGIGFGTANYAQKFQGRV TITADESASTAYMELSSLRSEDTAVYYCARGGA KYASTHGMDVWGQGTTVTVSS 192 VH 31432 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSHTA ISWVRQAPGQGLEWMGGILPIGGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARG GAKYASQLGMDVWGQGTTVTVSS 193 VH 31915 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSLP ISWVRQAPGQGLEWMGGIGFGTANYAQKFQGRV TITADESTSTAYMELSSLRSEDTAVYYCARGGA KYASKWGMDVWGQGTTVTVSS 194 VH 31436 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSLLA ISWVRQAPGQGLEWMGGILPIAGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARG GAKYAVGYGMDVWGQGTTVTVSS 195 VH 31437 QVQLVQSGAEVKKPGASVKVSCKASGGTFQSLA ISWVRQAPGQGLEWMGGILPIGGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARG GAKYAGRYGMDVWGQGTTVTVSS 196 VH 31905 QVQLVQSGAEVKKPGSSVKVSCKASGGTFPSNA ISWVRQAPGQGLEWMGGIGFGTANYAQKFQGRV TITADESTSTAYMELSSLRSEDTAVYYCARGGA KYARTYGMDVWGQGTTVTVSS 197 VH 31901 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSLP ISWVRQAPGQGLEWMGGIGFGTANYAQKFQGRV TITADESTSTAYMELSSLRSEDTAVYYCARGGA KYAGRYGMDVWGQGTTVTVSS 198 VH 29852 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSAMA ISWVRQAPGQGLEWMGGILPIAGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARG GAKYASTYGMDVWGQGTTVTVSS 199 VH 29851 QVQLVQSGAEVKKPGSSVKVSCKASGGTFASLA ISWVRQAPGQGLEWMGGILPIFGEANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARG GAKYASTYGMDVWGQGTTVTVSS 200 VH 29857 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSWLA ISWVRQAPGQGLEWMGGIIPRGGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARG GAKYASTYGMDVWGQGTTVTVSS 201 VH 27571 QVQLVQSGAEVKKPGSSVKASCKASGGTFSSYA ISWVRQAPGQGLEWMGSIIPIFGTANYAQKFRG RVTITADESTSTTYMELSSLRSEDTAVYYCARE SGGYRDHRLDVWGQGTMVTVSS 202 VH 31861 QVQLVQSGAEVKKPGSSVKVSCKASGGTFGSYG ISWVRQAPGQGLEWMGSIIPEFGIANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARE SGTYRDHRLDVWGQGTMVTVSS 203 VH 31873 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSKYG ISWVRQAPGQGLEWMGSIIPEFGIANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARE SGGYRDHRLGVWGQGTMVTVSS 204 VH 31393 QVQLVQSGAEVKKPGSSVKVSCKASGGTFESYG ISWVRQAPGQGLEWMGSIIPEFGIANYAQKFQG RVTITADESTSTTYMELSSLRSEDTAVYYCARE SGGYRDHRLDVWGQGTMVTVSS 205 VH 27534 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYA ISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD FTDYSSGYSSGWTYWGQGTLVTVSS 206 VH 27536 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYA ISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD TLYSSGAYYGYNVWGQGTMVTVSS 207 VH 27588 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYA ISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARA KRGYDSYGGVYFDYWGQGTLVTVSS 208 VH 27590 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYA ISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARG PTVTATTSIGTHNWFDPWGQGTLVTVSS 209 VH 27597 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYA ISWVRQAPGQGLEWMGSIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARE GRGYDSSRYYKFWFDPWGQGTLVTVSS 210 VH 27575 QVQLVQSGAEVKEPGSSVKVSCKASGGTFSSYA TSWVRQAPGQGLEWMGGIIPISGTANYAQEFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD GGGYRHHYFDLWGRGTLVTVSS 211 VH 27568 QVQLVQSGAEVKKPGSSVKVPCKASGGTFSSYA ISWVRQAPEQGLEWMGSIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCAGE SGGYRDHKLDVWGQGTVVTVSS 212 VH 27577 QVQLVQSGAEVKKPGSSVKVSCKASGGAFSSYA IGWVRQAPGQGLEWMGGIIPTFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD GGGYQHHYFDLWGRGTLVTVSS 213 VH 27587 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYA ISWVRQAPGQGLEWMGSIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARE SGGYRDHKLDVWGQGTMVTVSS 214 VH 27589 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYA ISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD SGYHRHYSDYWGQGTLVTVSS 215 VH 27596 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYA ISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD PLGIRKHWFDPWGQGTLVTVSS 216 VH 27535 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYA ISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD TPRWRYHYFDYWGQGTLVTVSS 217 VH 27550 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYS MNWVRQAPGKGLEWVSSISSSSSYIYYADSVKG RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARE RRGSLALGMDVWGQGTLVTVSS 218 VH 27549 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYG MNWVRQAPGKGLEWVAVIWYDGSNKYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARD LGGYSYGEPYYYYYGMDVWGQGTTVTVSS 219 VL 27579 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHSYITFG GGTKVEIK 220 VL 31895 EIVLTQSPGTLSLSPGERATLSCRASQSVASSY LAWYQQKPGQAPRLLIYGASNRHTGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHNAITFG GGTKVEIK 221 VL 31891 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY LAWYQQKPGQAPRLLIYYASSRAYGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHNAITFG GGTKVEIK 222 VL 31418 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYYFYITFG GGTKVEIK 223 VL 31430 EIVLTQSPGTLSLSPGERATLSCEASQSVSYSY LAWYQQKPGQAPRLLIYGASSRANGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHSALTFG GGTKVEIK 224 VL 31431 EIVLTQSPGTLSLSPGERATLSCRASQSVASSY LAWYQQKPGQAPRLLIYGASNRHTGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHGGITFG GGTKVEIK 225 VL 31421 EIVLTQSPGTLSLSPGERATLSCKASESVSSSY LAWYQQKPGQAPRLLIYYASSRATGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHRRITFG GGTKVEIK 226 VL 31429 EIVLTQSPGTLSLSPGERATLSCRASQYVSSSY LAWYQQKPGQAPRLLIYYASNRATGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHSGITFG GGTKVEIK 227 VL 28347 DIVMTQSPDSLAVSLGERATINCKSSQSVLFSS NNKNYLAWYQQKPGQPPKLLIYWASTRESGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYL YPLTFGGGTKVEIK 228 VL 31896 DIVMTQSPDSLAVSLGERATINCKSSRSVLFSS NNKNYLAWYQQKPGQPPKLLIYWASTRESGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCQQYWT YPLTFGGGTKVEIK 229 VL 31915 DIVMTQSPDSLAVSLGERATINCKSSQSVLFSS NNKNYLAWYQQKPGQPPKLLIYWASSRESGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCQQYWT YPLTFGGGTKVEIK 230 VL 31905 DIVMTQSPDSLAVSLGERATINCKSSKSVLYSN NNKNYLAWYQQKPGQPPKLLIYWASTRQSGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCQQYLL YPLTFGGGTKVEIK 231 VL 31901 GIVMTQSPDSLAVSLGERATINCKSSQSVLFSS NNKNYLAWYQQKPGQPPKLLIYWASTRASGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYL YPLTFGGGTKVEIK 232 VL 27571 EIVMTQSPATLSVSPGERATLSCRASQSVGSNL AWYQQKPGQAPRLLIYGASTRATGIPARFSGSG SGTEFTLTISSLQSEDFAVYYCQQYLIWPLTFG GGTKVEIK 233 VL 31861 EIVMTQSPATLSVSPGERATLSCRASQSVGSNL AWYQQKPGQAPRLLIYGASTRATGIPARFSGSG SGTEFTLTISSLQSEDFAVYYCQQYLLWPLTFG GGTKVEIK 234 VL 31873 EIVMTQSPATLSVSPGERATLSCRASQSVGSNL AWYQQKPGQAPRLLIYGASTRASGIPARFSGSG SGTEFTLTISSLQSEDFAVYYCQQYLLWPLTFG GGTKVEIK 235 VL 28337 DIVMTQSPDSLAVSLGERATINCKSSQSVLFSS NNKNYLAWYQQKPGQPPKLLIYWASTRESGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCQQFYF YPPTFGGGTKVEIK 236 VL 27536 DIVMTQSPDSLAVSLGERATINCKSSQSVLYSS NNKNYLAWYQQKPGQPPKLLIYWASTRESGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCQQAYT FPPTFGGGTKVEIK 237 VL 27588 DIQMTQSPSSLSASVGDRVTITCQASQDISNYL NWYQQKPGKAPKLLIYDASNLETGVPSRFSGSG SGTDFTFTISSLQPEDIATYYCQQYYIFPPTFG GGTKVEIK 238 VL 27590 EIVLTQSPATLSLSPGERATLSCRASQSVSSYL AWYQQKPGQAPRLLIYDASNRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQRNFYPPTFG GGTKVEIK 239 VL 27597 EIVLTQSPATLSLSPGERATLSCRASQSVSSYL AWYQQKPGQAPRLLIYDASNRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQFVLWPRTFG GGTKVEIK 240 VL 27575 EIVLTQSPATLSLSPGERATLSCRASQSVSRYL AWYQQKPGQAPRLLIYDASNRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQHVNFPLTFG GGTKVEIK 241 VL 27568 EIVLTQSPATLSLSPGERATLSCRASQSVSSYL AWYQQKPGQAPRLLIYDASNRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQSVFWPITFG GGTKVEIK 242 VL 27577 EIVMTQSPATLSVSPGERATLSCRASQSVGSNL AWYQQKPGQAPRLLIYGASTRATGIPARFSGSG SGTEFTLTISSLQSEDFAVYYCQQLTKWPLTFG GGTKVEIK 243 VL 27587 EIVLTQSPATLSLSPGERATLSCRASQSVSSYL AWYQQKPGQAPRLLIYDASKRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQDVLWPLTFG GGTKVEIK 244 VL 27589 DIQMTQSPSTLSASVGDRVTITCRASQSISSWL AWYQQKPGKAPKLLIYKASSLESGVPSRFSGSG SGTEFTLTISSLQPDDFATYYCQQYGLFPITFG GGTKVEIK 245 VL 27596 EIVMTQSPATLSLSPGERATLSCRASQSVSSYL AWYQQKPGQAPRLLIYDASNRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQHTVWPITFG GGTKVEIK 246 VL 27535 EIVLTQSPATLSLSPGERATLSCRASQSVSSYL AWYQQKPGQAPRLLIYDASKRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQVLNYPLTFG GGTKVEIK 247 VL 27550 DIQMTQSPSSLSASVGDRVTITCQASQDISNYL NWYQQKPGKAPKLLIYDASNLETGVPSRFSGSG SGTDFTFTISSLQPEDIATYYCQQSYFLPPTFG GGTKVEIK 248 VL 27549 EIVLTQSPGTLSLSPGERATLSCRASQSVSSDY LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQAHSSPYTF GGGTKVEIK 249 hCD39 MEDTKESNVKTFCSKNILAILGFSSIIAVIALL AVGLTQNKALPENVKYGIVLDAGSSHTSLYIYK WPAEKENDTGVVHQVEECRVKGPGISKFVQKVN EIGIYLTDCMERAREVIPRSQHQETPVYLGATA GMRLLRMESEELADRVLDVVERSLSNYPFDFQG ARIITGQEEGAYGWITINYLLGKFSQKTRWFSI VPYETNNQETFGALDLGGASTQVTFVPQNQTIE SPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQ KLAKDIQVASNEILRDPCFHPGYKKVVNVSDLY KTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSIL ELFNTSYCPYSQCAFNGIFLPPLQGDFGAFSAF YFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEE IKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHF TADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMI PAEQPLSTPLSHSTYVFLMVLFSLVLFTVAIIG LLIFHKPSYFWKDMV 250 mCD39 MEDIKDSKVKRFCSKNILIILGFTSILAVIALI AVGLTQNKPLPENVKYGIVLDAGSSHTNLYIYK WPAEKENDTGVVQQLEECQVKGPGISKYAQKTD EIGAYLAECMELSTELIPTSKHHQTPVYLGATA GMRLLRMESEQSADEVLAAVSTSLKSYPFDFQG AKIITGQEEGAYGWITINYLLGRFTQEQSWLSL ISDSQKQETFGALDLGGASTQITFVPQNSTIES PENSLQFRLYGEDYTVYTHSFLCYGKDQALWQK LAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYG TPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILE LFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFY FVMDFFKKVAKNSVISQEKMTEITKNFCSKSWE ETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNF TDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMI PAEQPLSPPLPHSTYIGLMVLFSLLLVAVAITG LFIYSKPSYFWKEAV 251 Macaca MLFDSILSTVGLSKLVSVVSSPAAALSKSNVKT fascicularis FCSKNILAILGESSIIAVIALLAVGLTQNKALP cCD39 ENIKYGIVLDAGSSHTSLYIYKWPAEKENDTGV VHQVEECRVKGPGISKYVQKVNEIGIYLTDCME RAREVIPRSQHQETPVYLGATAGMRLLRMESEE LADRVLDVVERSLSNYPFDFQGARIITGQEEGA YGWITINYLLGKFSQKTRWFSIVPYETNNQETF GALDLGGASTQITFVPQNQTTESPDNALQFRLY GKDYNVYTHSFLCYGKDQALWQKLAKDIQVASN EILRDPCFHPGYKKVVNVSDLYKTPCTKRFEMT LPFQQFEIQGIGNYQQCHQSVLELFNTSYCPYS QCAFNGIFLPPLQGDFGAFSAFYFVMNFLNLTS EKVSQEKVTEMMKKFCSQPWEEIKTSYAGVKEK YLSEYCFSGTYILSLLLQGYHFTADSWEHIHFI GKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLS HSTYVFLMVLFSLVLVIVAIIGLLIFHKPSYFW KDMV 252 hCD39ECD TQNKALPENVKYGIVLDAGSSHTSLYIYKWPAE KENDTGVVHQVEECRVKGPGISKFVQKVNEIGI YLTDCMERAREVIPRSQHQETPVYLGATAGMRL LRMESEELADRVLDVVERSLSNYPFDFQGARII TGQEEGAYGWITINYLLGKFSQKTRWFSIVPYE TNNQETFGALDLGGASTQVTFVPQNQTIESPDN ALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAK DIQVASNEILRDPCFHPGYKKVVNVSDLYKTPC TKRFEMTLPFQQFEIQGIGNYQQCHQSILELFN TSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVM KFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTS YAGVKEKYLSEYCFSGTYILSLLLQGYHFTADS WEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQ PLSTPLSHSTYVFLMVLFSLVLFTVAIIGLLIF HKPSYFWKDMV 253 mCD39ECD TQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAE KENDTGVVQQLEECQVKGPGISKYAQKTDEIGA YLAECMELSTELIPTSKHHQTPVYLGATAGMRL LRMESEQSADEVLAAVSTSLKSYPFDFQGAKII TGQEEGAYGWITINYLLGRFTQEQSWLSLISDS QKQETFGALDLGGASTQITFVPQNSTIESPENS LQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKD IQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCT KRFEKKLPFDQFRIQGTGDYEQCHQSILELFNN SHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMD FFKKVAKNSVISQEKMTEITKNFCSKSWEETKT SYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSS WEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQ PLSPPLPHSTYIGLMVLFSLLLVAVAITGLFIY SKPSYFWKEAV 254 cCD39ECD TQNKALPENIKYGIVLDAGSSHTSLYIYKWPAE KENDTGVVHQVEECRVKGPGISKYVQKVNEIGI YLTDCMERAREVIPRSQHQETPVYLGATAGMRL LRMESEELADRVLDVVERSLSNYPFDFQGARII TGQEEGAYGWITINYLLGKFSQKTRWFSIVPYE TNNQETFGALDLGGASTQITFVPQNQTTESPDN ALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAK DIQVASNEILRDPCFHPGYKKVVNVSDLYKTPC TKRFEMTLPFQQFEIQGIGNYQQCHQSVLELFN TSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVM NFLNLTSEKVSQEKVTEMMKKFCSQPWEEIKTS YAGVKEKYLSEYCFSGTYILSLLLQGYHFTADS WEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQ PLSTPLSHSTYVFLMVLFSLVLVIVAIIGLLIF HKPSYFWKDMV 255 HC 31895 QVQLVQSGAEVKKPGASVKVSCKASGYTFKSYE MHWVRQAPGQGLEWMGRINPSVGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRKWGQGTLVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVM HEALHNHYTQKSLSLSLGK 256 LC 31895 EIVLTQSPGTLSLSPGERATLSCRASQSVASSY LAWYQQKPGQAPRLLIYGASNRHTGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHNAITFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 257 HC 31415 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYQ MHWVRQAPGQGLEWMGRINPSGGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRSWGQGTLVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVM HEALHNHYTQKSLSLSLGK 258 LC 31415 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHSYITFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 259 HC 31891 QVQLVQSGAEVKKPGASVKVSCKASGYIFKSYE MHWVRQAPGQGLEWMGRINPSVGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRVWGQGTLVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVM HEALHNHYTQKSLSLSLGK 260 LC 31891 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY LAWYQQKPGQAPRLLIYYASSRAYGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHNAITFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 261 HC 31418 QVQLVQSGAEVKKPGASVKVSCKASGYTFKSYE MHWVRQAPGQGLEWMGRINPSGGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRHWGQGTLVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVM HEALHNHYTQKSLSLSLGK 262 LC 31418 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYYFYITFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 263 HC 31430 QVQLVQSGAEVKKPGASVKVSCKASGYTFKSYE MHWVRQAPGQGLEWMGRINPSGGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRHWGQGTLVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVM HEALHNHYTQKSLSLSLGK 264 LC 31430 EIVLTQSPGTLSLSPGERATLSCEASQSVSYSY LAWYQQKPGQAPRLLIYGASSRANGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHSALTFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 265 HC 31915 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSLP ISWVRQAPGQGLEWMGGIGFGTANYAQKFQGRV TITADESTSTAYMELSSLRSEDTAVYYCARGGA KYASKWGMDVWGQGTTVTVSSASTKGPSVFPLA PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH EALHNHYTQKSLSLSLGK 266 LC 31915 DIVMTQSPDSLAVSLGERATINCKSSQSVLFSS NNKNYLAWYQQKPGQPPKLLIYWASSRESGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCQQYWT YPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNS QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVY ACEVTHQGLSSPVTKSFNRGEC 267 HC 31905 QVQLVQSGAEVKKPGSSVKVSCKASGGTFPSNA ISWVRQAPGQGLEWMGGIGFGTANYAQKFQGRV TITADESTSTAYMELSSLRSEDTAVYYCARGGA KYARTYGMDVWGQGTTVTVSSASTKGPSVFPLA PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH EALHNHYTQKSLSLSLGK 268 LC 31905 DIVMTQSPDSLAVSLGERATINCKSSKSVLYSN NNKNYLAWYQQKPGQPPKLLIYWASTRQSGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCQQYLL YPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNS QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVY ACEVTHQGLSSPVTKSFNRGEC 269 HC 31901 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSLP ISWVRQAPGQGLEWMGGIGFGTANYAQKFQGRV TITADESTSTAYMELSSLRSEDTAVYYCARGGA KYAGRYGMDVWGQGTTVTVSSASTKGPSVFPLA PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH EALHNHYTQKSLSLSLGK 270 LC 31901 GIVMTQSPDSLAVSLGERATINCKSSQSVLFSS NNKNYLAWYQQKPGQPPKLLIYWASTRASGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYL YPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNS QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVY ACEVTHQGLSSPVTKSFNRGEC 271 HC 31861 QVQLVQSGAEVKKPGSSVKVSCKASGGTFGSYG ISWVRQAPGQGLEWMGSIIPEFGIANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARE SGTYRDHRLDVWGQGTMVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVM HEALHNHYTQKSLSLSLGK 272 LC 31861 EIVMTQSPATLSVSPGERATLSCRASQSVGSNL AWYQQKPGQAPRLLIYGASTRATGIPARFSGSG SGTEFTLTISSLQSEDFAVYYCQQYLLWPLTFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 273 HC 31873 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSKYG ISWVRQAPGQGLEWMGSIIPEFGIANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARE SGGYRDHRLGVWGQGTMVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVM HEALHNHYTQKSLSLSLGK 274 LC 31873 EIVMTQSPATLSVSPGERATLSCRASQSVGSNL AWYQQKPGQAPRLLIYGASTRASGIPARFSGSG SGTEFTLTISSLQSEDFAVYYCQQYLLWPLTFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 275 HC 31393 QVQLVQSGAEVKKPGSSVKVSCKASGGTFESYG ISWVRQAPGQGLEWMGSIIPEFGIANYAQKFQG RVTITADESTSTTYMELSSLRSEDTAVYYCARE SGGYRDHRLDVWGQGTMVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVM HEALHNHYTQKSLSLSLGK 276 LC 31393 EIVMTQSPATLSVSPGERATLSCRASQSVGSNL AWYQQKPGQAPRLLIYGASTRATGIPARFSGSG SGTEFTLTISSLQSEDFAVYYCQQYLLWPLTFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 277 HC 27597 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYA ISWVRQAPGQGLEWMGSIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARE GRGYDSSRYYKFWFDPWGQGTLVTVSSASTKGP SVFPLAPCSRSTSESTAALGCLVKDYFPEPVTV SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP SSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPP CPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKP REEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKGLPSSIEKTISKAKGQPREPQVYTLPPSQEE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVF SCSVMHEALHNHYTQKSLSLSLGK 278 LC 27597 EIVLTQSPATLSLSPGERATLSCRASQSVSSYL AWYQQKPGQAPRLLIYDASNRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQFVLWPRTFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 279 HC 27575 QVQLVQSGAEVKEPGSSVKVSCKASGGTFSSYA TSWVRQAPGQGLEWMGGIIPISGTANYAQEFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD GGGYRHHYFDLWGRGTLVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVM HEALHNHYTQKSLSLSLGK 280 LC 27575 EIVLTQSPATLSLSPGERATLSCRASQSVSRYL AWYQQKPGQAPRLLIYDASNRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQHVNFPLTFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 281 HC 27568 QVQLVQSGAEVKKPGSSVKVPCKASGGTFSSYA ISWVRQAPEQGLEWMGSIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCAGE SGGYRDHKLDVWGQGTVVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVM HEALHNHYTQKSLSLSLGK 282 LC 27568 EIVLTQSPATLSLSPGERATLSCRASQSVSSYL AWYQQKPGQAPRLLIYDASNRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQSVFWPITFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 283 HC 27577 QVQLVQSGAEVKKPGSSVKVSCKASGGAFSSYA IGWVRQAPGQGLEWMGGIIPTFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD GGGYQHHYFDLWGRGTLVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVM HEALHNHYTQKSLSLSLGK 284 LC 27577 EIVMTQSPATLSVSPGERATLSCRASQSVGSNL AWYQQKPGQAPRLLIYGASTRATGIPARFSGSG SGTEFTLTISSLQSEDFAVYYCQQLTKWPLTFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 285 HC 27587 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYA ISWVRQAPGQGLEWMGSIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARE SGGYRDHKLDVWGQGTMVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVM HEALHNHYTQKSLSLSLGK 286 LC 27587 EIVLTQSPATLSLSPGERATLSCRASQSVSSYL AWYQQKPGQAPRLLIYDASKRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQDVLWPLTFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 287 HC 27589 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYA ISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD SGYHRHYSDYWGQGTLVTVSSASTKGPSVFPLA PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH EALHNHYTQKSLSLSLGK 288 LC 27589 DIQMTQSPSTLSASVGDRVTITCRASQSISSWL AWYQQKPGKAPKLLIYKASSLESGVPSRFSGSG SGTEFTLTISSLQPDDFATYYCQQYGLFPITFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 289 HC 27596 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYA ISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD PLGIRKHWFDPWGQGTLVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVM HEALHNHYTQKSLSLSLGK 290 LC 27596 EIVMTQSPATLSLSPGERATLSCRASQSVSSYL AWYQQKPGQAPRLLIYDASNRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQHTVWPITFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 291 HC 27535 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYA ISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARD TPRWRYHYFDYWGQGTLVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVM HEALHNHYTQKSLSLSLGK 292 LC 27535 EIVLTQSPATLSLSPGERATLSCRASQSVSSYL AWYQQKPGQAPRLLIYDASKRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCQQVLNYPLTFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 293 HC 27550 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYS MNWVRQAPGKGLEWVSSISSSSSYIYYADSVKG RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARE RRGSLALGMDVWGQGTLVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVM HEALHNHYTQKSLSLSLGK 294 LC 27550 DIQMTQSPSSLSASVGDRVTITCQASQDISNYL NWYQQKPGKAPKLLIYDASNLETGVPSRFSGSG SGTDFTFTISSLQPEDIATYYCQQSYFLPPTFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC 295 HC 27549 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYG MNWVRQAPGKGLEWVAVIWYDGSNKYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARD LGGYSYGEPYYYYYGMDVWGQGTTVTVSSASTK GPSVFPLAPCSRSTSESTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYG PPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKT KPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCK VSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQ EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGN VFSCSVMHEALHNHYTQKSLSLSLGK 296 LC 27549 EIVLTQSPGTLSLSPGERATLSCRASQSVSSDY LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQAHSSPYTF GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT HQGLSSPVTKSFNRGEC 297 HC 31414 QVQLVQSGAEVKKPGASVKVSCKASGYTFKSYE MHWVRQAPGQGLEWMGRINPSVGSTWYAQKFQG RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG KREGGTEYLRNWGQGTLVTVSSASTKGPSVFPL APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVM HEALHNHYTQKSLSLSLGK 298 LC 31414 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS GSGTDFTLTISRLEPEDFAVYYCQQYHSYITFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH QGLSSPVTKSFNRGEC
EQUIVALENTS
[0466] The disclosure set forth above may encompass multiple distinct inventions with independent utility. Although each of these inventions has been disclosed in its preferred form(s), the specific embodiments thereof as disclosed and illustrated herein are not to be considered in a limiting sense, because numerous variations are possible. The subject matter of the inventions includes all novel and nonobvious combinations and subcombinations of the various elements, features, functions, and/or properties disclosed herein. The following claims particularly point out certain combinations and subcombinations regarded as novel and nonobvious. Inventions embodied in other combinations and subcombinations of features, functions, elements, and/or properties may be claimed in this application, in applications claiming priority from this application, or in related applications. Such claims, whether directed to a different invention or to the same invention, and whether broader, narrower, equal, or different in scope in comparison to the original claims, also are regarded as included within the subject matter of the inventions of the present disclosure.