HUMAN ANTIBODY HAVING HIGH AFFINITY TO HUMAN IL-4 RECEPTOR ALPHA, AND USE THEREOF
20210403580 · 2021-12-30
Assignee
Inventors
- Yong Sung KIM (Suwon-si, KR)
- Hae-Sim PARK (Seoul, KR)
- Jung Eun KIM (Seoul, KR)
- Keunok JUNG (Suwon-si, KR)
Cpc classification
A61P29/00
HUMAN NECESSITIES
C07K16/2866
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
A61K47/6845
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
A61K47/6803
HUMAN NECESSITIES
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K47/68
HUMAN NECESSITIES
A61P29/00
HUMAN NECESSITIES
Abstract
An antibody or antigen-binding fragment thereof, which binds with a high pM-level affinity to a human IL-4 receptor alpha chain that is a human IL-4 receptor, is provided. The antibody or antigen-binding fragment has a different epitope and a different antigen dissociation rate than existing antibodies. A nucleic acid encoding the antibody or antigen-binding fragment thereof, a vector including the nucleic acid, a cell transformed with the vector, a method for producing the antibody or antigen-binding fragment thereof, a conjugate comprising the antibody or antigen-binding fragment thereof, a composition for preventing or treating inflammatory diseases, and a composition for diagnosing inflammatory diseases are disclosed.
Claims
1. An isolated antibody or antigen-binding fragment thereof binding to human interleukin-4 receptor alpha (hIL-4Rα) with an equilibrium dissociation constant (K.sub.D) of less than 150 pM, as measured by surface plasmon resonance (SPR).
2. The antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody recognizes an epitope including an amino acid residue selected from the group consisting of Leu67, Leu68, Asp92, Val93 and Asp97 in hIL-4Rα represented by SEQ ID NO: 98.
3. The antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody binds to an epitope including amino acid residues of Leu67, Leu68, Asp92, Val93 and Asp97 in hIL-4Rα represented by SEQ ID NO: 98, and binds to hIL-4Rα competitively with human interleukin-4 (hIL-4) and human interleukin-13 (hIL-13).
4. The antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody has a higher antigen dissociation rate (off-rate) than other antibodies such that it has lower antigen-mediated antibody clearance in vivo to increase the serum half-life in vivo.
5. The antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody comprises: a heavy-chain CDR1 of SEQ ID NOs: 11 to 13 or 84; a heavy-chain CDR2 selected from the group consisting of SEQ ID NOs: 14 to 22, 73 to 76, and 85; a heavy-chain CDR3 selected from the group consisting of SEQ ID NOs: 23 to 32; a light-chain CDR1 selected from the group consisting of SEQ ID NOs: 43 to 52 and 92 to 97; a light-chain CDR2 selected from the group consisting of SEQ ID NOs: 53 to 60; and a light-chain CDR3 selected from the group consisting of SEQ ID NOs: 61 to 68, 81, and 82.
6. The antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody or antigen-binding fragment thereof comprises a heavy-chain variable region comprising a sequence selected from the group consisting of SEQ ID NOs: 1 to 10, 69 to 72, and 83.
7. The antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody or antigen-binding fragment thereof comprises a light-chain variable region comprising a sequence selected from the group consisting of SEQ ID NOs: 33 to 42, 77 to 80, and 86 to 91.
8-10. (canceled)
11. A method of producing an isolated antibody or antigen-binding fragment thereof binding to human interleukin-4 receptor alpha (hIL-4Rα) with an equilibrium dissociation constant (K.sub.D) of less than 150 pM, as measured by surface plasmon resonance (SPR), the method comprising: (a) culturing a cell transformed with a vector comprising a nucleic acid, said nucleic acid coding for the antibody or antigen-binding fragment thereof, under conditions for expressing the antibody or antigen-binding fragment; and (b) recovering an antibody or antigen-binding fragment thereof from the cultured cell.
12. A conjugate of the antibody or antigen-binding fragment thereof according to claim 1, and a bioactive molecule selected from the group consisting of a peptide, a protein, a small-molecule drug, a nucleic acid, a nanoparticle, a liposome, and a combination thereof, wherein the antibody or antigen-binding fragment is genetically fused or chemically conjugated with the bioactive molecule.
13. A method for preventing or treating an inflammatory disease in a subject in need thereof, comprising administering an effective amount of the following (a) and/or (b): (a) the antibody or antigen-binding fragment thereof according to claim 1, and/or (b) a conjugate of the antibody or antigen-binding fragment thereof according to claim 1 and a bioactive molecule selected from the group consisting of a peptide, a protein, a small-molecule drug, a nucleic acid, a nanoparticle, a liposome, and a combination thereof, wherein the antibody or antigen-binding fragment is genetically fused or chemically conjugated with the bioactive molecule to the subject.
14. The method according to claim 13, wherein the inflammatory disease is selected from allergic diseases including atopic dermatitis, asthma, allergic rhinitis and food allergies.
15. (canceled)
Description
DESCRIPTION OF DRAWINGS
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
BEST MODE
[0056] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as appreciated by those skilled in the field to which the present invention pertains. In general, the nomenclature used herein is well-known in the art and is ordinarily used.
[0057] In one aspect, the present invention is directed to an isolated antibody or antigen-binding fragment thereof binding to human interleukin-4 receptor alpha (hIL-4Rα), the isolated antibody or antigen-binding fragment thereof having an equilibrium dissociation constant (K.sub.D) of less than 150 pM, as measured by surface plasmon resonance (SPR), but having a higher off-rate than a previously developed antibody, so that a phenomenon in which the antibody is removed by the antigen in vivo (called “antigen-mediated clearance”) is expected to decrease, thereby improving in-vivo pharmacokinetics.
[0058] The antibody according to the present invention is an antibody that binds with high affinity to the antigen hIL-4Rα, and has the ability to neutralize IL-4 activity. The term “affinity” refers to the ability to specifically recognize a specific site of an antigen and to bind thereto, and specificity and high-affinity of an antibody for an antigen are important factors in the immune response.
[0059] The equilibrium dissociation constant (K.sub.D) can be determined using surface plasmon resonance (SPR), for example, BIAcore instrument. An equilibrium dissociation constant (K.sub.D) calculated from a 1:1 Langmuir binding model (simultaneously ka and kd) and the ratio of the rate constant kd1/ka1 was obtained based on surface plasmon resonance data, and may be less than 150 pM, less than 100 pM, less than 75 pM, or less than 50 pM.
[0060] In one embodiment, the antibody according to the present invention binds to an epitope including amino acid residues of Leu67, Leu68, Asp92, Val93 and Asp97 in hIL-4Rα of SEQ ID NO: 98, and can bind to hIL-4Rα competitively with human interleukin-13 (hIL-13) and human interleukin-4 (hIL-4).
[0061] As used herein, the term “antibody” refers to an anti-hIL-4Rα antibody that specifically binds to hIL-4Rα. The scope of the present invention includes not only a complete antibody specifically binding to hIL-4Rα but also an antigen-binding fragment of the antibody molecule.
[0062] The complete antibody has a structure having two full-length light chains and two full-length heavy chains, wherein each light chain is linked to a corresponding heavy chain by a disulfide bond. The heavy-chain constant region has gamma (γ), mu (μ), alpha (α), delta (δ) and epsilon (ε) types, and is subclassified into gamma 1 (γ1), gamma 2 (γ2), gamma 3 (γ3), gamma 4 (γ4), alpha 1 (α1), and alpha 2 (α2). The light-chain constant region has kappa (κ) and lambda (λ) types.
[0063] The antigen-binding fragment of an antibody or antibody fragment refers to a fragment that has antigen-binding function and includes Fab, F(ab′), F(ab′)2, Fv and the like. Among the antibody fragments, Fab refers to a structure including a variable region of each of the heavy chain and the light chain, the constant region of the light chain, and the first constant domain (CH1) of the heavy chain, each having one antigen-binding site. “scFab” is a polypeptide consisting of the light-chain and heavy-chain variable regions, the light-chain constant region, the first heavy-chain constant region (CH1), and a linker. In some cases, it may be stabilized by insertion of cysteine residues. Fab′ is different from Fab in that it further includes a hinge region including at least one cysteine residue at the C-terminus of the CH1 domain of the heavy chain. F(ab′)2 is created by a disulfide bond between cysteine residues in the hinge region of Fab′.
[0064] Fv is the minimal antibody fragment having only a heavy-chain variable region and a light-chain variable region. Two-chain Fv is a fragment in which the variable region of the heavy chain and the variable region of the light chain are linked by a non-covalent bond, and single-chain Fv (scFv) is a fragment in which the variable region of the heavy chain and the variable region of the light chain are generally linked by a covalent bond via a peptide linker therebetween, or are directly linked at the C-terminal, forming a dimer-shaped structure, like the two-chain Fv. Such antibody fragments may be obtained using proteases (e.g., Fab can be obtained by restriction-cleaving the complete antibody with papain, and the F(ab′)2 fragment can be obtained by restriction-cleaving the complete antibody with pepsin), and may be produced using genetic recombination techniques.
[0065] In one embodiment, the antibody of the present invention is in an Fv form (for example, scFv) or a complete antibody form. In addition, the heavy-chain constant region may be selected from gamma (γ), mu (μ), alpha (α), delta (δ) and epsilon (c) isotypes. For example, the constant region may be gamma 1 (IgG1), gamma 3 (IgG3) or gamma 4 (IgG4). The light-chain constant region may be kappa or lambda.
[0066] As used herein, the term “heavy chain” encompasses both a full-length heavy chain, which includes a variable domain (VH) containing an amino acid sequence having a variable region sequence sufficient for imparting specificity to an antigen and three constant domains (CH1, CH2 and CH3), and a fragment thereof. As used herein, the term “light chain” encompasses both a full-length light chain, which includes a variable domain (VL) containing an amino acid sequence having a variable region sequence sufficient for imparting specificity to an antigen and a constant domain (CL), and a fragment thereof.
[0067] The antibody of the present invention includes, but is not limited to, monoclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, chimeric antibodies, scFvs, single-chain antibodies, Fab fragments, F(ab′) fragments, disulfide-bond Fvs (sdFvs), anti-idiotypic (anti-Id) antibodies, epitope-binding fragments of such antibodies, and the like.
[0068] The term “monoclonal antibody” refers to a uniform antibody, which is obtained from a population of substantially homogeneous antibodies, that is, each antibody constituting the population, excluding possible naturally occurring mutations that may be present in trivial amounts. Monoclonal antibodies are highly specific and are thus induced against a single antigenic site. Unlike conventional (polyclonal) antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
[0069] For example, monoclonal antibodies useful in the present invention may be produced by hybridoma methods, or may be produced in bacterial, eukaryotic or plant cells using recombinant DNA methods. In addition, monoclonal antibodies may be isolated from phage antibody libraries.
[0070] In one embodiment of the present invention, a library may be constructed to improve the affinity of the CDR region of an antibody that specifically binds to hIL-4Rα, and may be realized by a method including (1) selecting an amino acid site having a high possibility of binding to hIL-4Rα, among six complementary binding sites (CDRs) involved in antigen-binding of 4R34 and 4R34.1 light-chain variable regions (VL) and heavy-chain variable regions (VH) as library templates, (2) designing a degenerated codon primer and a spiked oligonucleotide capable of encoding an amino acid to be included in the library at the selected amino acid site, and (3) expressing the designed heavy-chain variable region library in the form of scFab or Fab using a yeast surface expression system.
[0071] In one embodiment of the present invention, the antibody scFab that specifically binds to hIL-4Rα may be isolated and/or screened using a library to improve affinity.
[0072] The method for screening the antibody that specifically binds to hIL-4Rα according to the present invention may be carried out by a method including:
[0073] (1) expressing an antibody scFab library capable of binding to hIL-4Rα using a yeast surface expression system;
[0074] (2) constructing and expressing a IL-4Rα vector fused with a His Tag;
[0075] (3) binding hIL-4Rα to the library and selecting the yeast maintaining to bind to hIL-4Rα even after the conditions for dissociating the bound hIL-4Rα are satisfied (Kinetic screening); and
[0076] (4) measuring the affinity of the binding between the hIL-4Rα and the library.
[0077] As described above, the anti-hIL-4Rα antibody according to the present invention is an antibody binding with high affinity to hIL-4Rα, which is obtained by selecting antibodies to hIL-4Rα from the human antibody Fab library expressed on the yeast cell surface, additionally constructing an antibody Fab library on the yeast surface to improve affinity, and selecting an antibody binding with high affinity to hIL-4Rα through kinetic screening.
[0078] Techniques for identifying and separating high-affinity antibodies from libraries are important for the separation of new therapeutic antibodies. The separation of high-affinity antibodies from libraries may depend on the size of the libraries, the production efficiency in bacterial cells, and the variety of libraries. The size of the libraries is reduced by improper folding of the antibody- or antigen-binding protein and inefficient production due to the presence of the stop codon. Expression in bacterial cells can be inhibited when the antibody- or antigen-binding domain is not properly folded. Expression can be improved by alternately mutating residues on the surface of the variable/constant interfaces or the selected CDR residues.
[0079] It is important to generate various libraries of antibody- or antigen-binding proteins in the separation of high-affinity antibodies. CDR3 regions have often been found to participate in antigen binding. Since the CDR3 region on the heavy chain varies considerably in terms of size, sequence and structurally dimensional morphology, various libraries can be prepared using the same.
[0080] Also, diversity can be created by randomizing the CDR regions of variable heavy and light chains using all 20 amino acids at each position. The use of all 20 amino acids results in antibody sequences having increased diversity and an increased chance of identifying new antibodies.
[0081] The term “epitope” refers to a protein determinant to which an antibody is capable of specifically binding. Epitopes usually consist of a group of chemically active surface molecules, such as amino acids or sugar side chains, and generally have not only specific three-dimensional structural characteristics but also specific charge characteristics. Three-dimensional epitopes are distinguished from non-three-dimensional epitopes in that a bond to the former is broken in the presence of a denaturing solvent, while a bond to the latter is not broken.
[0082] In an embodiment according to the present invention, the antibody may bind to an epitope including an amino acid residue selected from the group consisting of Leu67, Leu68, Asp92, Val93 and Asp97 in hIL-4Rα of SEQ ID NO: 98.
[0083] 4R34, 4R34.1 and 4R34.1.9 antibodies derived according to affinity maturation according to an embodiment of the present invention recognize Leu67, Leu68, Asp92, Val93 and Asp97 of hIL-4Rα as important epitopes, but the contribution of each epitope is varied. In particular, the binding ability to Asp92 and Val93 tends to be higher than that of 4R34 or 4R34.1, which indicates that the binding ability is still maintained by other adjacent residues. This suggests that the epitope of antibodies changes during the affinity maturation process. Dupilumab analogues have no significant difference in binding ability to the hIL-4Rα amino acid residue mutant from the wild-type, but Val93 and Asp97 are considered to be involved in weakly binding to antibodies. Consequently, it was confirmed that the antibodies according to the present invention have an epitope different from those of other antibodies including dupilumab analogues.
[0084] The non-human (e.g., murine) antibody of the “humanized” form is a chimeric antibody containing a minimal sequence derived from non-human immunoglobulin. In most cases, the humanized antibody is a human immunoglobulin (receptor antibody) in which a residue from the hypervariable region of a receptor is replaced with a residue from the hypervariable region of a non-human species (donor antibody) such as a mouse, rat, rabbit or non-human primate having the desired specificity, affinity and ability.
[0085] The term “human antibody” means a molecule derived from human immunoglobulin, wherein all of the amino acid sequences constituting the antibody including a complementarity-determining region and a structural region are composed of human immunoglobulin.
[0086] A part of the heavy chain and/or light chain is identical to or homologous with the corresponding sequence in an antibody derived from a particular species or belonging to a particular antibody class or subclass, while the other chain(s) include “chimeric” antibodies (immunoglobulins) which are identical to or homologous with corresponding sequences in an antibody derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibody exhibiting the desired biological activity.
[0087] As used herein, the term “antibody variable domain” refers to the light- and heavy-chain regions of an antibody molecule including the amino acid sequences of a complementarity-determining region (CDR; i.e., CDR1, CDR2, and CDR3) and a framework region (FR). VH refers to a variable domain of the heavy chain. VL refers to a variable domain of the light chain.
[0088] The term “complementarity-determining region” (CDR; i.e., CDR1, CDR2, and CDR3) refers to an amino acid residue of the antibody variable domain that is necessary for antigen binding. Each variable domain typically has three CDR regions, identified as CDR1, CDR2, and CDR3.
[0089] In the present invention, the antibody or antigen-binding fragment thereof binding to hIL-4Rα may include a heavy-chain CDR1 of SEQ ID NOs: 11 to 13 or 84, a heavy-chain CDR2 selected from the group consisting of SEQ ID NOs: 14 to 22, 73 to 76, and 85, and a heavy-chain CDR3 selected from the group consisting of SEQ ID NOs: 23 to 32, and
[0090] a light-chain CDR1 selected from the group consisting of SEQ ID NOs: 43 to 52 and 92 to 97, a light-chain CDR2 selected from the group consisting of SEQ ID NOs: 53 to 60, and a light-chain CDR3 selected from the group consisting of SEQ ID NOs: 61 to 68, 81, and 82.
[0091] Specifically, the antibody or antigen-binding fragment thereof may include the heavy-chain and light-chain CDR sequences shown in Tables 1 and 2 below.
TABLE-US-00001 TABLE 1 Heavy-chain variable region CDR1 name sequence CDR2 sequence CDR3 sequence Kabat No. 31 32 33 34 35 50 51 52 52a 53 54 55 56 57 58 59 60 61 62 63 64 65 95 96 97 98 99 100 100a 100b 100c 100d 100e 100f 100g 100h 100i 100j 101 102 4R14 N Y A M S A I S S G G G N I Y Y A D S V K G L R R Y F . . . . . . . . . . . D Y SEQ ID NO: 11 SEQ ID NO: 14 SEQ ID NO: 23 4R23 D Y A M S A I S S G G S S I Y Y A D S V K G G P Q R S A T A V F . . . . . . D Y SEQ ID NO: 12 SEQ ID NO: 15 SEQ ID NO: 24 4R25 N Y A M S W I S P N S G N I Y Y A D S V K G R P L S A A W S H S S Y Y N A M D V SEQ ID NO: 11 SEQ ID NO: 16 SEQ ID NO: 25 4R66 G Y A M S L I S H S G S N T Y Y A D S V K G P H R A F . . . . . . . . . . . D Y SEQ ID NO: 13 SEQ ID NO: 17 SEQ ID NO: 26 4R67 N Y A M S G I S H G S G S I Y Y A D S V K G T G R D F . . . . . . . . . . . D Y SEQ ID NO: 11 SEQ ID NO: 18 SEQ ID NO: 27 4R73 N Y A M S G I S H G N G S I Y Y A D S V K G T G R H F . . . . . . . . . . . D Y SEQ ID NO: 11 SEQ ID NO: 19 SEQ ID NO: 28 4R83 N Y A M S S I S P S G S S I Y Y A D S V K G S Y R A F . . . . . . . . . . . D Y SEQ ID NO: 11 SEQ ID NO: 20 SEQ ID NO: 29 4R91 N Y A M S A I S P S G G S I Y Y A D S V K G A K R A F . . . . . . . . . . . D Y SEQ ID NO: 11 SEQ ID NO: 21 SEQ ID NO: 30 4R33 N Y A M S A I S P G S G S T Y Y A D S V K G F R R H F . . . . . . . . . . . D Y SEQ ID NO: 11 SEQ ID NO: 22 SEQ ID NO: 31 4R34 N Y A M S A I S S G G G N I Y Y A D S V K G V H R A F . . . . . . . . . . . D Y SEQ ID NO: 11 SEQ ID NO: 14 SEQ ID NO: 32 Kabat No. 31 32 33 34 35 50 51 52 52a 53 54 55 56 57 58 59 60 61 62 63 64 65 95 96 97 98 99 100 102 4R34.1 N Y A M S A I T S S G R S I Y Y A D S V K G V H R A F D Y SEQ ID NO: 11 SEQ ID NO: 73 SEQ ID NO: 32 4R34.2 N Y A M S A I T S S G A N I Y Y A D S V K G V H R A F D Y SEQ ID NO: 11 SEQ ID NO: 74 SEQ ID NO: 32 4R34.19 N Y A M S A I T S S G G N I Y Y A D S V K G V H R A F D Y SEQ ID NO: 11 SEQ ID NO: 75 SEQ ID NO: 32 4R34.29 N Y A M S A I T A G G G S I Y Y A D S V K G V H R A F D Y SEQ ID NO: 11 SEQ ID NO: 76 SEQ ID NO: 32 4R34.1.19 R H A M A A I T S S G R S I Y Y A D S V K G V H R A F D Y SEQ ID NO: 84 SEQ ID NO: 85 SEQ ID NO: 32
TABLE-US-00002 TABLE 2 Light-chain variable region name CDR1 sequence CDR2 sequence CDR3 sequence Kabat No. 24 25 26 27 27a 27b 28 29 30 31 32 33 34 50 51 52 53 54 55 56 89 90 91 92 93 94 95 95a 95b 96 97 4R14 S G S S S N I G N N Y V N D N S H R P S G T W D A S L S A Y V SEQ ID NO: 43 SEQ ID NO: 53 SEQ ID NO: 61 4R23 S G S S S N I G N N N V S A N S K R P S G S W D D S L S A Y V SEQ ID NO: 44 SEQ ID NO: 54 SEQ ID NO: 62 4R25 T G S S S N I G S N S V N D D S H R P S D A W D S S L S A Y V SEQ ID NO: 45 SEQ ID NO: 55 SEQ ID NO: 63 4R66 T G S S S N I G S N Y V S A D S Q R P S G T W D D S L S G Y V SEQ ID NO: 46 SEQ ID NO: 56 SEQ ID NO: 64 4R67 S S S S S N I G S N Y V S S D S H R P S G S W D Y S L S A Y V SEQ ID NO: 47 SEQ ID NO: 57 SEQ ID NO: 65 4R73 T G S S S N I G N N I V S D N S H R P S G S W D Y S L S A Y V SEQ ID NO: 48 SEQ ID NO: 53 SEQ ID NO: 65 4R83 T G S S S N I G N N D V N Y D S Q R P S A T W D A S L S A Y V SEQ ID NO: 49 SEQ ID NO: 58 SEQ ID NO: 66 4R91 S G S S S N I G S N A V N Y D N Q R P S G T W D D S L N G Y V SEQ ID NO: 50 SEQ ID NO: 59 SEQ ID NO: 67 4R33 S G S S S N I G N N A V T D D S H R P S G S W D Y S L S A Y V SEQ ID NO: 51 SEQ ID NO: 55 SEQ ID NO: 65 4R34 S G S S S N I G S N T F N A D S H R P S G T W D Y S L S G Y V SEQ ID NO: 52 SEQ ID NO: 60 SEQ ID NO: 68 4R34.1 S G S S S N I G S N T F N A D S H R P S G T W D Y S L S G Y V SEQ ID NO: 52 SEQ ID NO: 60 SEQ ID NO: 68 4R34.2 S G S S S N I G S N T F N A D S H R P S G T W D Y S L R G Y V SEQ ID NO: 52 SEQ ID NO: 60 SEQ ID NO: 81 4R34.19 S G S S S N I G S N T F N A D S H R P S G Y W D Y S L S G Y V SEQ ID NO: 52 SEQ ID NO: 60 SEQ ID NO: 82 4R34.29 S G S S S N I G S N T F N A D S H R P S G T W D Y S L S G Y V SEQ ID NO: 52 SEQ ID NO: 60 SEQ ID NO: 68 4R34.1.11 S G S S A N S R T D G F N A D S H R P S G T W D Y S L S G Y V SEQ ID NO: 92 SEQ ID NO: 60 SEQ ID NO: 68 4R34.1.13 S G S A Q F G S R D N F N A D S H R P S G T W D Y S L S G Y V SEQ ID NO: 93 SEQ ID NO: 60 SEQ ID NO: 68 4R34.1.17 S G S T K Q M H N Y Q F N A D S H R P S G T W D Y S L S G Y V SEQ ID NO: 94 SEQ ID NO: 60 SEQ ID NO: 68 4R34.1.18 S G S L L R G E N L Q F N A D S H R P S G T W D Y S L S G Y V SEQ ID NO: 95 SEQ ID NO: 60 SEQ ID NO: 68 4R34.1.19 S G S P L F P D S G S F N A D S H R P S G T W D Y S L S G Y V SEQ ID NO: 96 SEQ ID NO: 60 SEQ ID NO: 68 4R34.1.21 S G S A A L D L S P S F N A D S H R P S G T W D Y S L S G Y V SEQ ID NO: 97 SEQ ID NO: 60 SEQ ID NO: 68
[0092] The term “framework region” (FR) refers to a variable domain residue other than a CDR residue. Each variable domain typically has four FRs, identified as FR1, FR2, FR3, and FR4.
[0093] The antibody or antigen-binding fragment thereof binding to hIL-4Rα may include a heavy-chain variable region including a sequence selected from the group consisting of SEQ ID NOs: 1 to 10, 69 to 72, and 83.
[0094] In addition, the antibody or antigen-binding fragment thereof binding to the extracellular domain of hIL-4Rα may include a light-chain variable region including a sequence selected from the group consisting of SEQ ID NOs: 33 to 42, 77 to 80, and 86 to 91.
[0095] Specifically, the antibody or antigen-binding fragment thereof may include the heavy-chain and light-chain variable region sequences shown in Tables 3 and 4 below.
TABLE-US-00003 TABLE 3 Heavy-chain variable region name sequence SEQ ID NO: 4R14 EVQLLESGGGLVQPGGSLRLSCAVSGFTFSNYAMSWVRQAPGKGLEWVSAISSGGGNIYYA SEQ ID NO: 1 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKLRRYFDYWGQGTLVTVSS 4R23 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSAISSGGSSIYYA SEQ ID NO: 2 DSVKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCARGPQRSATAVFDYWGQGTLVTVSS 4R25 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSWISPNSGNIYYA SEQ ID NO: 3 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARRPLSAAWSHSSYYNAMDVWGQGTL VTVSS 4R66 EVQLLESGGGLVQPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSLISHSGSNTYYA SEQ ID NO: 4 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARPHRAFDYWGQGTLVTVSS 4R67 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSGISHGSGSIYYA SEQ ID NO: 5 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARPHRAFDYWGQGTLVTVSS 4R73 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSGISHGNGSIYYA SEQ ID NO: 6 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKTGRHFDYWGQGTLVTVSS 4R83 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSSISPSGSSIYYA SEQ ID NO: 7 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSYRAFDYWGQGTLVTVSS 4R91 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISPSGGSIYYA SEQ ID NO: 8 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARAKRAFDYWGQGTLVTVSS 4R33 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISPGSGSTYYA SEQ ID NO: 9 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKFRRHFDYWGQGTLVTVSS 4R34 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISSGGGNIYYA SEQ ID NO: 10 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVHRAFDYWGQGTLVTVSS 4R34.1 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAITSSGRSIYYA SEQ ID NO: 69 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVHRAFDYWGQGTLVTVSS 4R34.2 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAITSSGANIYYA SEQ ID NO: 70 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVHRAFDYWGQGTLVTVSS 4R34.19 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAITSSGGNIYYA SEQ ID NO: 71 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVHRAFDYWGQGTLVTVSS 4R34.29 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAITAGGGSIYYA SEQ ID NO: 72 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVHRAFDYWGQGTLVTVSS 4R34.1.19 EVQLLESGGGLVQPGGSLRLSCAASGFTFSRHAMAWVRQAPGKGLEWVSAITSSGRSIYYA SEQ ID NO: 83 DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVHRAFDYWGQGTLVTVSS
TABLE-US-00004 TABLE 4 Light-chain variable region name sequence SEQ ID NO: 4R14 QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNYVNWYQQLPGTAPKLLIYDNSHRPSGVPDRFSGSK SEQ ID NO: 33 SGTSASLAISGLRSEDEADYYCGTWDASLSAYVFGGGTKLTVL 4R23 QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNNVSWYQQLPGTAPKLLIYANSKRPSGVPDRFSGSK SEQ ID NO: 34 SGTSASLAISGLRSEDEADYYCGSWDDSLSAYVFGGGTKLTVL 4R25 QSVLTQPPSAPGTPGQRVTISCTGSSSNIGSNSVNWYQQLPGTAPKLLIYDDSHRPSGVPDRFSGSK SEQ ID NO: 35 SGTSASLAISGLRSEDEADYYCDAWDSSLSAYVFGGGTKLTVL 4R66 QSVLTQPPSASGTPGQRVTLSCTGSSSNIGSNYVSWYQQLPGTAPKLLIYADSQRPSGVPDRFSGSK SEQ ID NO: 36 SGTSASLAISGLRSEDEADYYCGTWDDSLSGYVFGGGTKLTVL 4R67 QSVLTQPPSASGTPGQRVTISCSSSSSNIGSNYVSWYQQLPGTAPKLLIYSDSHRPSGVPDRFSGSK SEQ ID NO: 37 SGTSASLAISGLRSEDEADYYCGSWDYSLSAYVFGGGTKLTVL 4R73 QSVLTQPPSASGTPGQRVTISCTGSSSNIGNNTVSWYQQLPGTAPKLLIYDNSHRPSGVPDRFSGSK SEQ ID NO: 38 SGTSASLAISGLQSEDEADYYCGSWDYSLSAYVFGGGTKLTVL 4R83 QSVLTQPPSASGTPGQRVTISCTGSSSNIGNNDVNWYQQLPGTAPKLLIYYDSQRPSGVPDRFSGSK SEQ ID NO: 39 SGTSASLAISGLRSEDEADYYCATWDASLSAYVFGGGTKLTVL 4R91 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNAVNWYQQLPGTAPKLLIYYDNQRPSGVPDRFSGSK SEQ ID NO: 40 SGTSASLAISGLRSEDEADYYCGTWDDSLNGYVFGGGTKLTVL 4R33 QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNAVTWYQQLPGTAPKLLIYDDSHRPSGVPDRFSGSK SEQ ID NO: 41 SGTSASLAISGLRSEDEADYYCGSWDYSLSAYVFGGGTKLTVL 4R34 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSK SEQ ID NO: 42 SGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVL 4R34.1 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSK SEQ ID NO: 77 SGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVL 4R34.2 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSK SEQ ID NO: 78 SGTSASLAISGLRSEDEADYYCGTWDYSLRGYVLGGGTKLTVL 4R34.19 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSK SEQ ID NO: 79 SGTSASLAISGLRSEDEADYYCGYWDYSLSGYVLGGGTKLTVL 4R34.29 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSK SEQ ID NO: 80 SGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVL 4R34.1.11 QSVLTQPPSASGTPGQRVTISCSGSSANSRTDGFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSK SEQ ID NO: 86 SGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG 4R34.1.13 QSVLTQPPSASGTPGQRVTISCSGSAQFGSRDNFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSK SEQ ID NO: 87 SGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG 4R34.1.17 QSVLTQPPSASGTPGQRVTISCSGSTKQMHNYQFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSK SEQ ID NO: 88 SGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG 4R34.1.18 QSVLTQPPSASGTPGQRVTISCSGSLLRGENLQFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSK SEQ ID NO: 89 SGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG 4R34.1.19 QSVLTQPPSASGTPGQRVTISCSGSPLFPDSGSFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSK SEQ ID NO: 90 SGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG 4R34.1.21 QSVLTQPPSASGTPGQRVTISCSGSAALDLSPSFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSK SEQ ID NO: 91 SGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG
[0096] The antibody or antibody fragment of the present invention may include the sequence of the anti-hIL-4Rα antibody mentioned herein as well as biological equivalents thereof, as long as it can specifically recognize hIL-4Rα. For example, additional changes can be made to the amino acid sequence of the antibody in order to further improve the binding affinity and/or other biological properties of the antibody. Such modifications include, for example, deletion, insertion and/or substitution of the amino acid sequence residues of the antibody.
[0097] When taking into consideration variations having biologically equivalent activity, the antibody or a nucleotide molecule encoding the same according to the present invention is interpreted to include a sequence having substantial identity with the sequence set forth in the sequence number. The term “substantial identity” means that a sequence has homology of at least 90%, more preferably homology of at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, when aligning the sequence of the present invention with another sequence so as to correspond thereto as closely as possible and analyzing the aligned sequence using algorithms commonly used in the art. The alignment method for sequence comparison is well-known in the art. The NCBI Basic Local Alignment Search Tool (BLAST) is accessible through NCBI or the like, and can be used in conjunction with sequence analysis programs such as BLASTP, BLASM, BLASTX, TBLASTN and TBLASTX over the Internet. BLAST is available at www.ncbi.nlm.nih.gov/BLAST/. A method of comparing sequence homology using this program can be found at www.ncbi.nlm.nih.gov/BLAST/blast_help.html.
[0098] Based on this, the antibody or antigen-binding fragment thereof according to the present invention can have homology of 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more. Such homology can be determined through sequence comparison and/or alignment by methods known in the art. For example, the percentage sequence identity of the nucleic acid or protein according to the present invention can be determined using a sequence comparison algorithm (i.e., BLAST or BLAST 2.0), manual alignment, or visual inspection.
[0099] In another aspect of the present invention, provided is a nucleic acid encoding the antibody or an antigen-binding fragment thereof.
[0100] By isolating the nucleic acid encoding the antibody or an antigen-binding fragment thereof according to the present invention, an antibody or antigen-binding fragment thereof can be produced via recombination. The nucleic acid is isolated and inserted into a replicable vector, followed by further cloning (amplification of DNA) or further expression. Based on this, in another aspect, the present invention is directed to a vector including the nucleic acid.
[0101] The term “nucleic acid” is intended to encompass both DNA (gDNA and cDNA) and RNA molecules, and a nucleotide, which is a basic constituent unit of a nucleic acid, includes naturally derived nucleotides as well as analogues, wherein sugar or base moieties are modified. The sequence of the nucleic acid encoding heavy- and light-chain variable regions of the present invention can vary. Such variation includes addition, deletion, or non-conservative or conservative substitution of nucleotides.
[0102] The DNA encoding the antibody can be easily separated or synthesized using conventional procedures (for example, using an oligonucleotide probe capable of specifically binding to DNA encoding heavy and light chains of the antibody). A variety of vectors are obtainable. Vector components generally include, but are not limited to, one or more of the following components: signal sequences, replication origins, one or more marker genes, enhancer elements, promoters, and transcription termination sequences.
[0103] As used herein, the term “vector” refers to a means for expressing target genes in host cells, and includes plasmid vectors, cosmid vectors, and viral vectors such as bacteriophage vectors, adenovirus vectors, retroviral vectors and adeno-associated viral vectors. The polynucleotide encoding the antibody in the vector is operably linked to a promoter.
[0104] The term “operably linked” means a functional linkage between a nucleic acid expression regulation sequence (e.g., an array of promoter, signal sequence or transcription regulator binding sites) and another nucleic acid sequence, and enables the regulation sequence to regulate the transcription and/or translation of the other nucleic acid sequence.
[0105] When a prokaryotic cell is used as a host, it generally includes a potent promoter capable of conducting transcription (such as a tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pLλ promoter, pRλ promoter, racy promoter, amp promoter, recA promoter, SP6 promoter, trp promoter, or T7 promoter), a ribosome-binding site for initiation of translation, and a transcription/translation termination sequence. In addition, for example, when a eukaryotic cell is used as a host, it includes a promoter (e.g., a metallothionein promoter, a β-actin promoter, a human hemoglobin promoter and a human muscle creatine promoter) derived from the genome of mammalian cells, or a promoter derived from a mammalian virus such as an adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus (CMV) promoter, HSV tk promoter, mouse mammary tumor virus (MMTV) promoter, HIV LTR promoter, Moloney virus promoter, Epstein-Barr virus (EBV) promoter, or Rous sarcoma virus (RSV) promoter, and generally has a polyadenylation sequence as a transcription termination sequence.
[0106] Optionally, the vector may be fused with another sequence in order to facilitate purification of the antibody expressed therefrom. The sequence to be fused therewith includes, for example, glutathione S-transferase (Pharmacia, USA), maltose-binding protein (NEB, USA), FLAG (IBI, USA), 6x His (hexahistidine; Qiagen, USA) and the like.
[0107] The vector includes antibiotic-resistant genes commonly used in the art as selectable markers, and examples thereof include genes conferring resistance to ampicillin, gentamycin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin and tetracycline.
[0108] In another aspect, the present invention is directed to a cell transformed with the above-mentioned vector. The cell used to produce the antibody of the present invention may be a prokaryote, yeast or higher eukaryotic cell, but is not limited thereto.
[0109] Prokaryotic host cells such as Escherichia coli, the genus Bacillus, such as Bacillus subtilis and Bacillus thuringiensis, Streptomyces spp., Pseudomonas spp. (for example, Pseudomonas putida), Proteus mirabilis and Staphylococcus spp. (for example, Staphylococcus carnosus) can be used.
[0110] Interest in animal cells is the greatest, and examples of useful host cell lines include, but are not limited to, COS-7, BHK, CHO, CHOK1, DXB-11, DG-44, CHO/-DHFR, CV1, COS-7, HEK293, BHK, TM4, VERO, HELA, MDCK, BRL 3A, W138, Hep G2, SK-Hep, MMT, TRI, MRC 5, FS4, 3T3, RIN, A549, PC12, K562, PER.C6, SP2/0, NS-0, U20S, and HT1080.
[0111] In another aspect, the present invention is directed to a method of producing the antibody or antigen-binding fragment thereof including: (a) culturing the cells; and (b) recovering an antibody or antigen-binding fragment thereof from the cultured cells.
[0112] The cells can be cultured in various media. Any commercially available medium can be used as a culture medium without limitation. All other essential supplements well-known to those skilled in the art may be included in appropriate concentrations. Culture conditions such as temperature and pH are those that are conventionally used with the host cells selected for expression, which will be apparent to those skilled in the art.
[0113] The recovery of the antibody or antigen-binding fragment thereof can be carried out, for example, by centrifugation or ultrafiltration to remove impurities and further purification of the resulting product using, for example, affinity chromatography. Other additional purification techniques such as anion or cation exchange chromatography, hydrophobic interaction chromatography and hydroxyapatite (HA) chromatography may be used.
[0114] In another aspect, the present invention is directed to an antibody-drug conjugate (ADC) in which the antibody or antigen-binding fragment thereof is fused with a bioactive molecule selected from the group consisting of peptides, proteins, small-molecule drugs, nucleic acids, nanoparticles and liposomes.
[0115] The proteins include antibodies, fragments of antibodies, immunoglobulins, peptides, enzymes, growth factors, cytokines, transcription factors, toxins, antigenic peptides, hormones, transport proteins, motor function proteins, receptors, signaling proteins, storage proteins, membrane proteins, transmembrane proteins, internal proteins, external proteins, secreted proteins, viral proteins, sugar proteins, truncated proteins, protein complexes, chemically modified proteins and the like.
[0116] The term “small-molecule drugs” refers to an organic compound, an inorganic compound or an organometallic compound that has a molecular weight of less than about 1,000 daltons and has activity as a therapeutic agent for diseases, which is widely used herein. The small-molecule drug used herein includes oligopeptides and other biomolecules having a molecular weight of less than about 1,000 daltons.
[0117] As used herein, the term “nanoparticle” refers to a particle including a material having a diameter of 1 to 1,000 nm, and the nanoparticle may be a metal/metal core-shell complex including a metal nanoparticle, a metal nanoparticle core and a metal shell including the core, a metal/non-metal core-shell complex including a metal nanoparticle core and a non-metal shell surrounding the core, or a nonmetal/metal core-shell complex including a nonmetal nanoparticle core and a metal shell surrounding the core. According to one embodiment, the metal may be selected from gold, silver, copper, aluminum, nickel, palladium, platinum, magnetic iron, and oxides thereof, but is not limited thereto, and the nonmetal may be selected from silica, polystyrene, latex and acrylic substances, but is not limited thereto.
[0118] The liposome consists of one or more lipid bilayer membranes surrounding an aqueous internal compartment that can self-associate. Liposomes can be specified based on the type and size of the membrane thereof. Small unilamellar vesicles (SUVs) have a single membrane, and may have a diameter of 20 nm to 50 nm. Large unilamellar vesicles (LUV) may have a diameter of 50 nm or more. Oligolamellar large vesicles and multilamellar large vesicles have multiple, generally concentric, membrane layers, and may be 100 nm or more in diameter. Liposomes having a plurality of non-concentric membranes, that is, several small vesicles contained within larger vesicles, are called “multivesicular vesicles”.
[0119] As used herein, the term “fusion” refers to the integration of two molecules having different or identical functions or structures, and includes fusion through any physical, chemical or biological method capable of binding the antibody or antigen-binding fragment thereof to the protein, small-molecule drug, nanoparticle, or liposome. The fusion may preferably be carried out using a linker peptide, and the linker peptide may mediate the fusion with the bioactive molecule at various positions of the antibody light-chain variable region, antibody, or fragment thereof according to the present invention.
[0120] In another aspect, the present invention is directed to a pharmaceutical composition for preventing or treating inflammatory diseases containing the antibody or antigen-binding fragment thereof or the conjugate as an active ingredient.
[0121] Examples of inflammatory diseases that can be treated using the antibody according to the present invention may include allergic diseases such as atopic dermatitis, asthma, allergic rhinitis and food allergic reactions, but are not limited thereto.
[0122] In addition to allergic diseases such as atopic dermatitis, asthma, allergic rhinitis or food allergic reactions, the diseases that can be treated using the antibody according to the present invention include arthritis (including septic arthritis), herpes, chronic idiopathic urticaria, scleroderma, hypertrophic scarring, Whipple's disease, benign prostatic hyperplasia, lung disorders such as mild, moderate or severe asthma, inflammatory disorders such as inflammatory bowel disease, Kawasaki disease, sickle cell disease, Churg-Strauss syndrome, Grave's disease, pre-eclampsia, Sjogren's syndrome, autoimmune lymphocyte proliferation syndrome, autoimmune hemolysis anemia, Barrett's esophagus, autoimmune uveitis, tuberculosis, or nephropathy, but are not limited thereto.
[0123] In another aspect, the present invention is directed to a pharmaceutical composition for preventing or treating inflammatory diseases including: (a) a pharmaceutically effective amount of the antibody or antigen-binding fragment thereof according to the present invention; and (b) a pharmaceutically acceptable carrier.
[0124] In another aspect, the present invention is directed to a method for preventing or treating inflammatory diseases including administering the antibody or antigen-binding fragment thereof according to the present invention to a patient.
[0125] The antibody according to the present invention is useful for the prevention or treatment of hIL-4-mediated diseases by eliminating, inhibiting or reducing hIL-4 activity. The antibody according to the present invention can inhibit the growth of T cells and differentiation of Th2 cells by suppressing the signals of hIL-4 and hIL-13, which bind to hIL-4Rα and induce a Th2 immune response.
[0126] As used herein, the term “prevention” refers to any action causing the suppression of growth of inflammatory diseases or the delay of progression of inflammatory diseases by administration of the composition according to the present invention. The term “treatment” means suppression of the progression of inflammatory diseases or alleviation or elimination of inflammatory diseases. The antibodies of the present invention can be useful both in vitro and in vivo for applications involving hIL-4Rα-expressing cells.
[0127] The pharmaceutical composition of the present invention contains the antibody or antigen-binding fragment thereof or the conjugate according to the present invention, and the pharmaceutical composition may further contain a pharmaceutically acceptable carrier, in addition to the component for administration of the pharmaceutical composition of the present invention. The term “pharmaceutically acceptable carrier” as used herein refers to a carrier or diluent that does not impair the biological activities or properties of the administered compound and does not stimulate an organism. Pharmaceutically acceptable carriers for compositions that are formulated into liquid solutions are sterilized and biocompatible, and examples thereof include saline, sterile water, buffered saline, albumin injection solutions, dextrose solutions, maltodextrin solutions, glycerol, and mixtures of one or more thereof. If necessary, other conventional additives such as antioxidants, buffers and bacteriostatic agents may be added. In addition, diluents, dispersants, surfactants, binders and lubricants can be additionally added to formulate injectable solutions such as aqueous solutions, suspensions and emulsions, pills, capsules, granules, or tablets.
[0128] The pharmaceutical composition according to the present invention may be any one of various oral or parenteral formulations. In this regard, the pharmaceutical composition may be formulated using an ordinary diluent or excipient such as a filler, a thickener, a binder, a wetting agent, a disintegrant, a surfactant, or the like. Solid formulations for oral administration may include tablets, pills, powders, granules, capsules and the like. Such a solid formulation is prepared by mixing at least one compound with at least one excipient such as starch, calcium carbonate, sucrose, lactose or gelatin. In addition to a simple excipient, a lubricant such as magnesium stearate or talc may be further used. Liquid formulations for oral administration may include suspensions, solutions for internal use, emulsions, syrups, and the like. In addition to a simple diluent such as water or liquid paraffin, various excipients such as wetting agents, sweeteners, aromatics and preservatives may be incorporated in the liquid formulations. In addition, formulations for parenteral administration include sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilizates, suppositories and the like. Useful non-aqueous solvents and suspensions include propylene glycol, polyethylene glycol, vegetable oils such as olive oil and injectable esters such as ethyl oleate. The base ingredients of suppositories include Witepsol, macrogol, Tween 61, cacao butter, laurin butter and glycerogelatin.
[0129] The method for treating inflammatory diseases using the antibody or antigen-binding fragment thereof or the conjugate according to the present invention includes administering, to a subject, a pharmaceutically effective amount of the antibody or antigen-binding fragment thereof, or the conjugate. It will be apparent to those skilled in the art that an appropriate total daily dose can be determined based on the judgment of a medical specialist. In addition, the antibody, antigen-binding fragment thereof, or the conjugate may be administered in a single dose, or may be divided into multiple doses. However, in consideration of the objects of the present invention, the specific therapeutically effective amount for a certain patient is preferably determined depending upon a variety of factors, including the type and extent of the response to be achieved, as well as the presence of other agents used, the specific composition, the age, body weight, general state of health, gender, and diet of the patient, the administration time, the administration route, the treatment period, and drugs used in conjunction with or concurrently with the specific composition, and other similar factors well-known in the pharmaceutical field.
[0130] The subject to which the composition of the present invention is administered includes mammals including humans, without limitation thereto.
[0131] As used herein, the term “administration” refers to an action of supplying the pharmaceutical composition according to the present invention to a patient by any appropriate method, and the composition according to the present invention may be orally or parenterally administered through any one of various routes enabling the composition to be delivered to a target tissue.
[0132] The antibody or antigen-binding fragment thereof according to the present invention may be used as a single agent or in combination with a conventional therapeutic agent.
[0133] In another aspect, the present invention is directed to a composition for diagnosing inflammatory diseases including the antibody or an antigen-binding fragment thereof. Also, in another aspect, the present invention is directed to a kit for diagnosing inflammatory diseases containing the diagnostic composition.
[0134] As used herein, the term “diagnosis” means determining the presence or features of pathophysiology. In the present invention, diagnosis serves to determine the onset or progress of an inflammatory disease.
[0135] For diagnostic methods using the antibody or antigen-binding fragment thereof according to the present invention, the drug may include a detectable label used to detect the presence of hIL-4Rα antigen-expressing cells in vitro or in vivo. Radioisotopes that are detectable in vivo such as labels that can be detected using scintillation, magnetic resonance imaging or ultrasound can be used for clinical diagnostic applications. Useful scintillation labels include positron emitters and γ-emitters. Representative contrast agents as magnetic source for imaging include paramagnetic or superparamagnetic ions (e.g., iron, copper, manganese, chromium, erbium, europium, dysprosium, holmium and gadolinium), iron oxide particles, and water-soluble contrast agents. For ultrasonic detection, a gas or liquid can be trapped in the porous inorganic particles released as a microbubble contrast agent. Detectable labels useful for in-vitro detection include fluorophores, detectable epitopes or binders and radiolabels.
[0136] The kit for diagnosing inflammatory diseases may further include a composition, solution or device having one or more other components suitable for the analysis method.
[0137] In one embodiment, the kit may include a bottle, vial, bag, needle, or syringe. The container may be made from various materials, such as glass, plastic, or metal. The label on the container may provide instructions for use. The kit may further include other materials desirable from commercial and usage perspectives, such as other buffers, diluents, filters, needles and syringes.
EXAMPLES
[0138] Hereinafter, the present invention will be described in more detail with reference to examples. However, it will be obvious to those skilled in the art that these examples are provided only for illustration of the present invention and should not be construed as limiting the scope of the present invention.
Example 1: Expression of Recombinant Human Interleukin-4 Receptor α (hIL-4Rα)
[0139] An antigenic protein for deriving an antibody specific for human interleukin-4 receptor α (hIL-4Rα) was prepared. Since hIL-4Rα is a glycoprotein, an animal cell expression system was used. The full-length cDNA (Met26-Ser232) was cloned into an animal expression vector (pSecTag2A) using the restriction enzyme NheI/BamHI, and pSecTag2A-hIL-4Rα was constructed such that the 6X histidine-labeled protein was fused with the C-terminus (
[0140] The eluted protein was exchanged with a storage buffer (PBS pH 7.4) using a PD-10 desalting column (GE Healthcare), and was then concentrated using a Vivaspin 30,000 MWCO (Sartorius) centrifugal concentrator. The absorbance at a wavelength of 562 nm of the purified protein was measured and the amount thereof was quantified using a solution in the BCA protein assay kit (Thermo) according to the drawn standard curve.
[0141] In order to confirm the deglycosylated state of hIL-4Rα, the purified hIL-4Rα protein and PNGaseF (NEB) enzyme were reacted with reference to a standard protocol.
[0142] Specifically, 2 μl of GlycoBuffer 2 (10×) was added to 10 pg of hIL-4Rα protein, and the final volume was adjusted to 20 μl with deionized water. 5 μl of PNGaseF enzyme was added to this mixture, followed by incubation at 37° C. for 24 hours. The purity of 12.5 μl of the mixture and 5 μg of the purified hIL-4Rα protein was detected through SDS-PAGE analysis (
Example 2: Selection of Monoclonal Antibodies in Yeast Surface Expression Library
[0143] A yeast Fab library expressing the human antibody Fab (Baek, D S and Y S Kim (2014). J. Microbiol. Biotechnol. 24(3): 408-420) was screened to screen yeast clones expressing Fab specifically binding to the hIL-4Rα antigen protein prepared in <Example 1>.
[0144] The method of selecting a clone that specifically binds to the hIL-4Rα antigen protein from the yeast Fab library is as follows. First, the hIL-4Rα antigen protein was conjugated with biotin using a kit (EZ-LINK™ Sulfo-NHS-LC-Biotinylation kit, Pierce Inc.). The expression level of the yeast library expressing Fab can be detected through an Alexa 488-conjugated anti-IgG antibody (goat Alexa 488-conjugated anti-Fc antibody, Thermo), and the antigen-binding ability thereof can be detected using PE-conjugated streptavidin (Streptavidin-R-phycoerythrin conjugate (SA-PE), Thermo). Clones expressing a high amount of Fab and having high ability to bind to biotinylated hIL-4Rα were selected using the FACS process while reducing the concentration of the library to biotinylated hIL-4Rα, and the process of analyzing the derived pool was repeated. This process was repeated 4 times.
[0145] Finally, DNA was obtained from yeast cells expressing each individual clone that specifically binds to hIL-4Rα, and sequence analysis was performed to select 10 types of antibodies in which certain nucleotide sequences and amino acid sequences were identified.
[0146] Tables 5 and 7 show the heavy-chain CDR sequences and heavy-chain variable region sequences of 10 individual clones having binding ability to the selected hIL-4Rα, respectively, and Tables 6 and 8 show the light-chain CDR sequences and the light-chain variable region sequences, respectively.
TABLE-US-00005 TABLE 5 Heavy- chain variable region name CDR1 sequence CDR2 sequence Kabat No. 31 32 33 34 35 50 51 52 52a 53 54 55 56 57 58 59 60 61 62 63 64 65 4R14 N Y A M S A I S S G G G N I Y Y A D S V K G SEQ ID No: 11 SEQ ID No: 14 4R23 D Y A M S A I S S G G S S I Y Y A D S V K G SEQ ID No: 12 SEQ ID No: 15 4R25 N Y A M S W I S P N S G N I Y Y A D S V K G SEQ ID No: 11 SEQ ID No: 16 4R66 G Y A M S L I S H S G S N T Y Y A D S V K G SEQ ID No: 13 SEQ ID No: 17 4R67 N Y A M S G I S H G S G S I Y Y A D S V K G SEQ ID No: 11 SEQ ID No: 18 4R73 N Y A M S G I S H G N G S I Y Y A D S V K G SEQ ID No: 11 SEQ ID No: 19 4R83 N Y A M S S I S P S G S S I Y Y A D S V K G SEQ ID No: 11 SEQ ID No: 20 4R91 N Y A M S A I S P S G G S I Y Y A D S V K G SEQ ID No: 11 SEQ ID No: 21 4R33 N Y A M S A I S P G S G S T Y Y A D S V K G SEQ ID No: 11 SEQ ID No: 22 4R34 N Y A M S A I S S G G G N I Y Y A D S V K G SEQ ID No: 11 SEQ ID No: 14 Heavy-chain variable region name CDR3 sequence Kabat No. 95 96 97 98 99 100 100a 100b 100c 100d 100e 100f 100g 100h 100i 100j 101 102 4R14 L R R Y F . . . . . . . . . . . D Y SEQ ID No: 23 4R23 G P Q R S A T A V F . . . . . . D Y SEQ ID No: 24 4R25 R P L S A A W S H S S Y Y N A M D V SEQ ID No: 25 4R66 P H R A F . . . . . . . . . . . D Y SEQ ID No: 26 4R67 T G R D F . . . . . . . . . . . D Y SEQ ID No: 27 4R73 T G R H F . . . . . . . . . . . D Y SEQ ID No: 28 4R83 S Y R A F . . . . . . . . . . . D Y SEQ ID No: 29 4R91 A K R A F . . . . . . . . . . . D Y SEQ ID No: 30 4R33 F R R H F . . . . . . . . . . . D Y SEQ ID No: 31 4R34 V H R A F . . . . . . . . . . . D Y SEQ ID No: 32
TABLE-US-00006 TABLE 6 Light- chain variable region name CDR1 sequence CDR2 sequence Kabat No. 24 25 26 27 27a 27b 28 29 30 31 32 33 34 50 51 52 53 54 55 56 4R14 S G S S S N I G N N Y V N D N S H R P S SEQ ID NO: 43 SEQ ID NO: 53 4R23 S G S S S N I G N N N V S A N S K R P S SEQ ID NO: 44 SEQ ID NO: 54 4R25 T G S S S N I G S N S V N D D S H R P S SEQ ID NO: 45 SEQ ID NO: 55 4R66 T G S S S N I G S N Y V S A D S Q R P S SEQ ID NO: 46 SEQ ID NO: 56 4R67 S S S S S N I G S N Y V S S D S H R P S SEQ ID NO: 47 SEQ ID NO: 57 4R73 T G S S S N I G N N T V S D N S H R P S SEQ ID NO: 48 SEQ ID NO: 53 4R83 T G S S S N I G N N D V N Y D S Q R P S SEQ ID NO: 49 SEQ ID NO: 58 4R91 S G S S S N I G S N A V N Y D N Q R P S SEQ ID NO: 50 SEQ ID NO: 59 4R33 S G S S S N I G N N A V T D D S H R P S SEQ ID NO: 51 SEQ ID NO: 55 4R34 S G S S S N I G S N T F N A D S H R P S SEQ ID NO: 52 SEQ ID NO: 60 Light-chain variable region name CDR3 sequence Kabat No. 89 90 91 92 93 94 95 95A 95B 96 97 G T W D A S L S A Y V SEQ ID NO: 61 G S W D D S L S A Y V SEQ ID NO: 62 D A W D S S L S A Y V SEQ ID NO: 63 G T W D D S L S G Y V SEQ ID NO: 64 G S W D Y S L S A Y V SEQ ID NO: 65 G S W D Y S L S A Y V SEQ ID NO: 65 A T W D A S L S A Y V SEQ ID NO: 66 G T W D D S L N G Y V SEQ ID NO: 67 G S W D Y S L S A Y V SEQ ID NO: 65 G T W D Y S L S G Y V SEQ ID NO: 68
TABLE-US-00007 TABLE 7 Heavy- chain variable region SEQ ID name sequence NO: 4R14 EVQLLESGGGLVQPGGSLRLSCAVSGFTFSNYAMSWVRQAPGKGLEWVSAISSGGGNIYYADSVKGRFTISRDNSKNTLYLQ SEQ ID MNSLRAEDTAVYYCAKLRRYFDYWGQGTLVTVSS NO: 1 4R23 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLHLQ SEQ ID MNSLRAEDTAVYYCARGPQRSATAVFDYWGQGTLVTVSS NO: 2 4R25 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSWISPNSGNIYYADSVKGRFTISRDNSKNTLYLQ SEQ ID MNSLRAEDTAVYYCARRPLSAAWSHSSYYNAMDVWGQGTLVTVSS NO: 3 4R66 EVQLLESGGGLVQPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSLISHSGSNTYYADSVKGRFTISRDNSKNTLYLQ SEQ ID MNSLRAEDTAVYYCARPHRAFDYWGQGTLVTVSS NO: 4 4R67 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSGISHGSGSIYYADSVKGRFTISRDNSKNTLYLQ SEQ ID MNSLRAEDTAVYYCARPHRAFDYWGQGTLVTVSS NO: 5 4R73 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSGISHGNGSIYYADSVKGRFTISRDNSKNTLYLQ SEQ ID MNSLRAEDTAVYYCAKTGRHFDYWGQGTLVTVSS NO:6 4R83 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSSISPSGSSIYYADSVKGRFTISRDNSKNTLYLQ SEQ ID MNSLRAEDTAVYYCARSYRAFDYWGQGTLVTVSS NO: 7 4R91 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISPSGGSIYYADSVKGRFTISRDNSKNTLYLQ SEQ ID MNSLRAEDTAVYYCARAKRAFDYWGQGTLVTVSS NO:8 4R33 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISPGSGSTYYADSVKGRFTISRDNSKNTLYLQ SEQ ID MNSLRAEDTAVYYCAKFRRHFDYWGQGTLVTVSS NO: 9 4R34 EVQLLESGGGLVQPFFSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISSGGGNIYYADSVKGRFTISRDNSKNTLYLQ SEQ ID MNSLRAEDTAVYYCARVHRAFDYWGQGTLVTVSS NO: 10
TABLE-US-00008 TABLE 8 Light- chain variable region SEQ ID name sequence NO: 4R14 QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNYVNWYQQLPGTAPKLLIYDNSHRPSGVPDRFSGSKSGTSASLAISGLRSE SEQ ID DEADYYCGTWDASLSAYVFGGGTKLTVL NO: 33 4R23 QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNNVSWYQQLPGTAPKLLIYANSKRPSGVPDRFSGSKSGTSASLAISGLRSE SEQ ID DEADYYCGSWDDSLSAYVFGGGTKLTVL NO: 34 4R25 QSVLTQPPSAPGTPGQRVTISCTGSSSNIGSNSVNWYQQLPGTAPKLLIYDDSHRPSGVPDRFSGSKSGTSASLAISGLRSE SEQ ID DEADYYCDAWDSSLSAYVFGGGTKLTVL NO: 35 4R66 QSVLTQPPSASGTPGQRVTLSCTGSSSNIGSNYVSWYQQLPGTAPKLLIYADSQRPSGVPDRFSGSKSGTSASLAISGLRSE SEQ ID DEADYYCGTWDDSLSGYVFGGGTKLTVL NO: 36 4R67 QSVLTQPPSASFTPGQRVTISCSSSSSNIGSNYVSWYQQLPGTAPKLLIYSDSHRPSGVPDRFSGSKSGTSASLAISGLRSE SEQ ID DEADYYCGSWDYSLSAYVFGGGTKLTVL NO: 37 4R73 QSVLTQPPSASGTPGQRVTISCTGSSSNIGNNTVSWYQQLPGTAPKLLIYDNSHRPSGVPDRFSGSKSGTSASLAISGLQSE SEQ ID DEADYYCGSWKYSLSAYVFGGGTKLTVL NO: 38 4R83 QSVLTQPPSASGTPGQRVTISCTGSSSNIGNNDVNWYQQLPGTAPKLLIYYDSQRPSGVPDRFSGSKSGTSASLAISGLRSE SEQ ID DEADYYCATWDASLSAYVFGGGTKLTVL NO: 39 4R91 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNAVNWYQQLPGTAPKLLIYYDNQRPSGVPDRFSGSKSGTSASLAISGLRSE SEQ ID DEADYYCGTWDDSLNGYVFGGGTKLTVL NO: 40 4R33 QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNAVTWYQQLPGTAPKLLIYDDSHRPSGVPDRFSGSKSGTSASLAISGLRSE SEQ ID DEADYYCGSWDYSLSAYVFGGGTKLTVL NO: 41 4R34 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSSKGTSASLAISGLRSE SEQ ID DEADYYCGTWDYSLSGYVLGGGTKLTVL NO: 42
Example 3: IgG Conversion and Identification of Selected Anti-hIL-4Rα Antibodies
[0147] The 10 antibodies selected in the form of Fab and dupilumab were converted into the form of IgG1, which is a commonly used antibody. The variable regions (VH, VL) of the selected antibody Fab and dupilumab were introduced into a pcDNA3.4 vector encoding the light-chains (CH1, CH2, CH3) and heavy-chain (CL) of IgG1. Dupilumab having an IgG1 constant region was called a “dupilumab analogue”. The light and heavy chains of respective antibodies were co-transformed at a ratio of 1:1 into HEK293F cells such that the light- and heavy-chains were expressed together in the cell. The cell incubation supernatant collected according to the transient transfection method was applied to a Protein A Sepharose column and washed with PBS (12 mM phosphate, 137 mM NaCl, 2.7 mM KCl, pH 7.4). The antibody was eluted at pH 3.0 using an 0.1 M glycine and 0.5 M NaCl buffer, and the sample was immediately neutralized using a 1 M Tris buffer.
[0148] The buffer was exchanged with a storage buffer (PBS pH 7.4) using a PD-10 desalting column (GE Healthcare) and then the eluted protein was concentrated using a Vivaspin 30,000 MWCO (Sartorius) as a centrifugal concentrator. The absorbance at a wavelength of 562 nm of the purified protein was measured and the amount thereof was quantified using a solution in the BCA protein assay kit (Thermo) according to the drawn standard curve.
Example 4: Verification of Binding Ability of Selected Anti-hIL-4Rα Antibodies
[0149] The antigen-binding ability (affinity) and specificity of the antibody for the antigen were determined using indirect ELISA. To detect the specificity for the hIL-4Rα antigen protein prepared in <Example 1> above, GST (glutathione S-transferase) protein was immobilized at 50 ng/well in a 96-well plate at room temperature for 1 hour and blocked at room temperature with 0.1% PBST (0.1% Tween20, pH 7.4, 137 mM NaCl, 10 mM Phosphate, 2.7 mM KCl) containing 4% skimmed milk for 1 hour. The solution was discarded and the residue was washed three times with 0.1% PBST and then serially diluted in the range of 50 to 500 nM, each antibody was added at 25 μl to each well in the blocked plate, and the reaction was allowed to progress at room temperature for 1 hour. The solution was discarded and the residue was washed 3 times with 0.1% PBST, and then 25 μl of anti-human IgG-HRP antibody (1:8000) as a secondary antibody was added to each well, followed by reaction at room temperature for 1 hour. The solution was discarded, the residue was washed 3 times with PBST, and 25 μl of TMB solution was added to each well, followed by color development at room temperature for 1 minute. The reaction was stopped with H.sub.2SO.sub.4 (1M) and absorbance was measured at 450 nm with an ELISA reader.
[0150] As can be seen from the results of
Example 5: Evaluation of SEAP Activity Inhibition by IL-Dependent STAT6 Phosphorylation of Selected Anti-hIL-4Rα Antibodies
[0151] The biological activity of HEK-Blue-IL-4/IL-13 cells (Invivogen) can be compared by monitoring activation of cell signaling by IL-4 or IL-13 through colorimetric analysis. These cells were derived from stable cell lines obtained by transfecting the human STAT6 gene in order to provide a fully activated STAT6 pathway to HEK293 cells that sufficiently express the hIL-4 and hIL-13 receptors. In addition, these cells are transfected with the STAT6-inducible secreted embryonic alkaline phosphatase (SEAP) reporter genes. When hIL-4 or hIL-13 binds to the hIL-4 receptor or hIL-13 receptor expressed on the surface of HEK-Blue-IL-4/IL-13 cells, they activate Tyk2 and JAK1 and recruit and phosphorylate STAT6. Active phosphorylated STAT6 forms a dimer, moves to the nucleus, binds to the promoter of responsive genes, and induces the secretion of SEAP. The secreted SEAP causes a pink substrate, QUANTI-Blue to turn purple (
[0152]
[0153] Specifically, cells were seeded in an amount of 100 μl at a density of 2.5×10.sup.5 cells/mL in a 96-well plate in a culture medium (DMEM supplemented with 4.5 g/L glucose (Gibco/Invitrogen), 10% heat-inactivated FBS (Gibco/Invitrogen)), pg/mL blasticidin activated peptidyl nucleoside antibiotics (Invitrogen), 100 μg/mL Zeocin (trade name) and streptomyces). On the same day, 50 μl of 200 pM human hIL-4 (Sino Biological) and 50 μl of an anti-hIL-4Rα antibody solution previously diluted to 80 to 400 nM were added and then the 96-well plate was incubated at 37° C. and 5% CO.sub.2 for 24 hours. To measure the secreted SEAP, 20 μl of each cell supernatant was added to a transparent 96-well plate and mixed with 180 μl of a QUANTI-Blue solution, and then the 96-well plate was allowed to react at 37° C. for 1 hour and the absorbance at 620 nm was analyzed with a Cytation™ 3 cell Imaging multi-mode reader (
[0154] The result of analysis showed that all antibodies exhibited a lower hIL-4-signal-blocking effect than the dupilumab analogue, and among them, 4R25 and 4R34 exhibited a high hIL-4-signal-blocking effect (
Example 6: Analysis of Binding Ability of Selected Anti-hIL-4Rα Antibodies
[0155] In order to more quantitatively analyze the binding ability of 4R25 and 4R34 to hIL-4Rα, SPR (surface plasmon resonance) was performed using a Biacore2000 instrument.
[0156] Specifically, hIL-4Rα (Sino Biological) was diluted to a concentration of 50 μl/ml in a 10 mM NaAc buffer (pH 4.0) and immobilized to about 500 response units (RU) on a CM5 sensor chip (GE Healthcare). Then, HBS-EP buffer (10 mM Hepes, 3 mM ethylenediaminetetraacetic acid, and 0.005% surfactant P20 (pH 7.4), GE Healthcare) was analyzed at a flow rate of 30 μl/min, and 4R25 and 4R34 antibodies were analyzed at a concentration of nM to 80 nM. After binding and dissociation analysis, regeneration of the CM5 chip was carried out by flushing the CM5 chip with a buffer solution (10 mM Glycine, pH 2.0) at a flow rate of 30 μl/min for 90 seconds. The sensorgram, obtained by binding for 90 seconds and dissociation for 900 seconds, was normalized and the value of a blank cell was subtracted therefrom to calculate the affinity.
[0157] Table 9 shows the results of analysis of affinity of anti-hIL-4Rα antibodies to hIL-4Rα using SPR (BIACORE 2000). 4R25 and 4R34 exhibited high affinity of 1.21 nM and 141 pM, respectively, but this increase in affinity is considered to be due to the improved avidity effect due to antigen immobilization. In this manner, affinity may vary depending on the level of antigen immobilization.
TABLE-US-00009 TABLE 9 K.sub.on (1/Ms) K.sub.off(1/s) K.sub.D(M) 4R25 1.47 × 10.sup.5 1.77 × 10.sup.−4 1.21 × 10.sup.−9 4R34 3.51 × 10.sup.6 4.95 × 10.sup.−4 1.41 × 10.sup.−10
Example 7: Construction of Yeast Cell Surface Expression Library for Increasing 4R34-Based Affinity
[0158] The 4R34 antibody was superior to 4R25 in the affinity and the ability to inhibit SEAP activity by hIL-4 dependent STAT6 phosphorylation in <Example 5> described above. Therefore, the present inventors aimed to increase the affinity of the anti-hIL-4Rα antibody for hIL-4Rα in order to increase the biological efficacy of the anti-hIL-4Rα antibody.
[0159] First, in order to express a single-chain Fab (scFab) on the yeast surface, a 4R34 antibody was constructed in the form of a scFab in a pYDS-H vector (Baek and Kim 2014) treated with a NheI/ApaI restriction enzyme to clone the pYDS 4R34 scFab vector and a pYDS-dummy vector in which a stop codon is generated due to an open reading frame (ORF) shifted due to one additionally introduced nucleotide. By using the pYDS-dummy vector, even if a vector that has not been treated with a restriction enzyme is mixed, only the vector containing the desired library gene can express scFab on the yeast surface.
[0160] Regarding the library, random mutations were introduced into the VH-CDR2, VH-CDR3, and VL-CDR3 regions, which are predicted to play an important role in antigen binding, among the six CDRs based on the pYDS 4R34 scFab vector (
[0161] Specifically, mutations were introduced into VH-CDR2 (50, 52-57), VH-CDR3 (95-98), and VL-CDR3 (89, 90, 93, 95A) with low conservation rates, upon comparison between 10 antibody sequences. Spiked oligomers were used to prevent the loss of binding ability to hIL-4Rα because mutations were introduced simultaneously in many regions. This is a mutation method to which all amino acids can be applied while preserving the conventional wild-type 4R34 sequence with 50% probability. It is a technology that ensures 50% of wild-type amino acids during the PCR process by designing primers while maintaining 79% of wild-type nucleotides and 7% of the remaining nucleotides in the three nucleotides encoding amino acids.
[0162] Overlapping PCR was performed to prepare 12 μg of the library gene and 4 μg of the pYDS dummy vector treated with NheI/ApaI restriction enzymes. Although the pYDS dummy vector that has not been treated with the restriction enzyme remains and thus is transformed into a yeast strain, it is not expressed on the yeast surface by the stop codon. The two genes were mixed and transformed into a yeast EBY100 (MATa, Trp-) strain for yeast surface expression by electroporation, and constructed through homologous recombination. This process was repeated 10 times, serial dilution was then performed, and then the library size was detected by measuring the number of colonies grown in a SD-CAA+Trp selection medium (20 g/L glucose, 6.7 g/L yeast nitrogen base without amino acids, 5.4 g/L Na.sub.2HPO.sub.4, 8.6 g/L NaH.sub.2PO.sub.4, 5 g/L casamino acids, 0.4 mg/L tryptophan). The library that was produced had a size of about 3×10.sup.7.
Example 8: Kinetic Screening Regarding hIL-4Rα Antigen Protein of Yeast scFab Library
[0163] In order to select individual clones that bind to hIL-4Rα, clones with higher affinity were selected by competition between biotinylated hIL-4Rα (biotinylated hIL-4Rα) and non-biotin-conjugated hIL-4Rα as a competing protein at a 20 times-higher concentration.
[0164] Specifically, 1 ml of 100 nM biotinylated hIL-4Rα was bound to scFab (1×10.sup.8 scFab yeast) expressed in yeast cells at room temperature for 30 minutes, and then PE-conjugated streptavidin (Streptavidin-R-phycoerythrin, (SA-PE), Thermo) and Alexa 488 conjugated anti-IgG antibody (goat Alexa 488-conjugated anti-Fc antibody, Thermo) were bound at 4° C. for 15 minutes, and then clones expressing a high amount of scFab and having high binding ability to biotinylated hIL-4Rα were selected using FACS (fluorescence-activated cell sorting).
[0165] In the secondary FACS, 1 ml of 10 nM biotinylated hIL-4Rα was bound to 2×10.sup.7 scFab yeast at room temperature for 30 minutes, and then the result was washed with 1 ml autoMACS® Running Buffer (phosphate-buffered saline (PBS), bovine serum albumin (BSA), EDTA, and 0.09% azide, pH7.2, Miltenyi Biotec), and made to compete with 1 ml of 200 nM hIL-4Rα unconjugated with biotin at room temperature for 4 hours, to select the top 0.1% clones with the highest binding ability. Subsequently, in the tertiary FACS, 1 ml of 1 nM biotinylated hIL-4Rα was bound to 1×10.sup.7 scFab yeast at room temperature for 30 minutes, and then the top 0.2% pool was selected. Subsequently, in the quaternary FACS, 1 ml of 1 nM hIL-4Rα was bound to 1×10.sup.7 scFab yeast at 25° C. for 30 minutes, and the result was washed with 1 ml autoMACS® Running Buffer, and made to compete with 1 ml of 20 nM hIL-4Rα unconjugated with biotin at room temperature for 4 hours, and the top 0.1% clones having the highest binding ability were selected (
[0166] Four individual clones (4R34.1, 4R34.2, 4R34.19, 4R34.29) having high binding ability to hIL-4Rα were isolated from the yeast cell surface through the above selection method.
[0167] Additionally, whether or not anti-hIL-4Rα scFab binds to hIL-4 competitively against biotinylated hIL-4Rα on the yeast surface was determined. For this purpose, a full-length hIL-4 cDNA (His25-Ser153) in which DNA encoding an hIL-4 secretion signal peptide is fused with the 5′ end of pcDNA3.4, which is an animal expression vector containing a murine heavy-chain constant region (Hinge-CH2-CH3, mFc), was cloned into NotI/ApaI, to construct a vector for expressing the hIL-4-mFc protein (
[0168] Proteins were expressed and purified using transient transfection. In a shake flask, HEK293F cells suspension-grown in serum-free FreeStyle 293 expression medium were transfected with a mixture of plasmid and polyethyleneimine (PEI). Upon 100 mL transfection into the shake flask, HEK293F cells were seeded in 90 ml of medium at a density of 1.0×10.sup.6 cells/ml and incubated at 120 rpm, 8% CO.sub.2, and 37° C. The plasmid was diluted to 125 μg in 5 ml FreeStyle 293 expression medium and filtered, and PEI 375 μg (7.5 μg/ml) was mixed with 5 ml of diluted medium and allowed to react at room temperature for 10 minutes. Then, the reacted mixed medium was added to the cells seeded in 90 ml and incubated at 120 rpm and 8% CO.sub.2 for 6 days. Proteins were purified from the cell incubation supernatant, which was collected with reference to standard protocols. The antibody was applied to a Protein A Sepharose column and washed with PBS (pH 7.4). The antibody was eluted at pH 3.0 using 0.1 M glycine and 0.5 M NaCl buffer, and the sample was immediately neutralized using a 1 M Tris buffer. The eluted antibody fraction was concentrated by exchanging the buffer with PBS (pH 6.5) through a dialysis method. The absorbance of the purified protein at a wavelength of 562 nm was measured, and the amount thereof was quantified using a solution in the BCA protein assay kit (Thermo) according to the drawn standard curve. The purity was detected through SDS-PAGE analysis (
[0169] Specifically, 1 nM biotinylated hIL-4Rα or 20 nM hIL-4-mFc protein fused with biotinylated hIL-4Rα was bound to scFab yeast at room temperature for 30 minutes. Then, SA-PE was bound thereto at 4° C. for 15 minutes, and the extent of binding to biotinylated hIL-4Rα was analyzed through flow cytometry (
[0170] Tables 10 and 11 show the heavy-chain variable-region sequences and CDR sequences of four individual clones having high binding ability to the selected hIL-4Rα, and Tables 12 and show the light-chain variable-region sequences and CDR sequences.
TABLE-US-00010 TABLE 10 Heavy-chain variable region name sequence SEQ ID NO: 4R34.1 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAITSSGRSIYYADSVK SEQ ID NO: GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVHRAFDYWGQGTLVTVSS 69 4R34.2 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAITSSGANIYYADSVK SEQ ID NO: GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVHRAFDYWGQGTLVTVSS 70 4R34.19 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAITSSGGNIYYADSVK SEQ ID NO: GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVHRAFDYWGQGTLVTVSS 71 4R34.29 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAITAGGGSIYYADSVK SEQ ID NO: GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVHRAFDYWGQGTLVTVSS 72
TABLE-US-00011 TABLE 11 Heavy- chain variable region name CDR1 sequence CDR2 sequence CDR3 sequence Kabat No. 31 32 33 34 35 50 51 52 52a 53 54 55 56 57 58 59 60 61 62 63 64 65 95 96 97 98 99 101 102 4R34.1 N Y A M S A I T S S G R S I Y Y A D S V K G V H R A F D Y SEQ ID NO: 11 SEQ ID NO: 73 SEQ ID NO: 32 4R34.2 N Y A M S A I T S S G A N I Y Y A D S V K G V H R A F D Y SEQ ID NO: 11 SEQ ID NO: 74 SEQ ID NO: 32 4R34.19 N Y A M S A I T S S G G N I Y Y A D S V K G V H R A F D Y SEQ ID NO: 11 SEQ ID NO: 75 SEQ ID NO: 32 4R34.29 N Y A M S A I T A G G G S I Y Y A D S V K G V H R A F D Y SEQ ID NO: 11 SEQ ID NO: 76 SEQ ID NO: 32
TABLE-US-00012 TABLE 12 Light-chain variable region name sequence SEQ ID NO: 4R34.1 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTFNWYQQLPGTAPKLLIYADSHRPSG SEQ ID NO: 77 VPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVL 4R34.2 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTFNWYQQLPGTAPKLLIYADSHRPSG SEQ ID NO: 78 VPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDYSLRGYVLGGGTKLTVL 4R34.19 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTFNWYQQLPGTAPKLLIYADSHRPSG SEQ ID NO: 79 VPDRFSGSKSGTSASLAISGLRSEDEADYYCGYWDYSLSGYVLGGGTKLTVL 4R34.29 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTFNWYQQLPGTAPKLLIYADSHRPSG SEQ ID NO: 80 VPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVL
TABLE-US-00013 TABLE 13 Light- chain variable region name CDR1 sequence CDR2 sequence Kabat No. 24 25 26 27 27a 27b 28 29 30 31 32 33 34 50 51 52 53 54 55 56 4R34.1 S G S S S N I G S N T F N A D S H R P S SEQ ID NO: 52 SEQ ID NO: 60 4R34.2 S G S S S N I G S N T F N A D S H R P S SEQ ID NO: 52 SEQ ID NO: 60 4R34.19 S G S S S N I G S N T F N A D S H R P S SEQ ID NO: 52 SEQ ID NO: 60 4R34.29 S G S S S N I G S N T F N A D S H R P S SEQ ID NO: 52 SEQ ID NO: 60 Light-chain variable region name CDR3 sequence Kabat No. 89 90 91 92 93 94 95 95a 95b 96 97 4R34.1 G T W D Y S L S G Y V SEQ ID NO: 68 4R34.2 G T W D Y S L R G Y V SEQ ID NO: 81 4R34.19 G T W D Y S L S G Y V SEQ ID NO: 82 4R34.29 G T W D Y S L S G Y V SEQ ID NO: 68
Example 9: Analysis of Binding Ability of Antibodies
[0171] having improved affinity based on 4R34 and evaluation of SEAP activity inhibition thereof by IL-4-dependent STAT6 phosphorylation
[0172] Selected clones (4R34.1, 4R34.2, 4R34.19, 4R34.29) were each inserted into a pcDNA3.4 vector having light and heavy chains. The two vectors were simultaneously transiently transfected at a ratio of 1:1 into HEK293F protein-expressing cells such that the light and heavy chains were expressed together in the cells.
[0173] In order to quantitatively analyze the binding ability thereof to hIL-4Rα, SPR (surface plasmon resonance) was performed using a Biacore2000 instrument.
[0174] Specifically, hIL-4Rα (Sino Biological) was diluted to a concentration of 50 μl/ml in 10 mM NaAc buffer (pH 4.0) and immobilized to about 80 response units (RU) on a CM5 sensor chip (GE Healthcare). Then, HBS-EP buffer (10 mM Hepes, 3 mM ethylenediaminetetraacetic acid, and 0.005% surfactant P20 (pH 7.4), GE Healthcare) was analyzed at a flow rate of 30 μl/min, and 4R25 and 4R34 antibodies were analyzed at a concentration of nM to 80 nM. After binding and dissociation analysis, regeneration of the CM5 chip was carried out by flushing the CM5 chip with a buffer solution (10 mM Glycine, pH 2.0) at a flow rate of 30 μl/min for 90 seconds. The sensorgram obtained by binding for 90 seconds and dissociation for 900 seconds was normalized, and the value of a blank cell was subtracted therefrom to calculate the affinity.
[0175] Table 14 shows the results of analysis of affinity of anti-hIL-4Rα antibodies (4R34.1, 4R34.2, 4R34.19, 4R34.29) to hIL-4Rα using SPR (BIACORE 2000). 4R34 exhibited affinity of 3.8 nM lower than before, but this is considered to be due to the difference from other hIL-4a immobilization. Among the selected clones, 4R34.1 exhibited the highest affinity of 18.2 pM, and 4R34.2, 4R34.19, and 4R34.29 also exhibited high affinity of 131 pM to 313 pM.
TABLE-US-00014 TABLE 14 K.sub.a (M.sup.−1S.sup.−1) K.sub.b(S.sup.−1) K.sub.D(M) 4R34 3.64 × 10.sup.5 1.38 × 10.sup.−3 .sup. 3.8 × 10.sup.−9 4R34.1 6.91 × 10.sup.7 1.26 × 10.sup.−3 1.82 × 10.sup.−11 4R34.2 8.82 × 10.sup.6 2.62 × 10.sup.−3 2.97 × 10.sup.−10 4R34.19 4.18 × 10.sup.6 1.31 × 10.sup.−3 3.13 × 10.sup.−10 4R34.29 6.32 × 10.sup.6 8.29 × 10.sup.−4 1.31 × 10.sup.−10
[0176] SEAP activity inhibition by HIL-4-dependent STAT6 phosphorylation was evaluated in the same manner as in <Example 5> using clones with increased affinity (4R34.1, 4R34.2, 4R34.19, 4R34.29) and using 4R34, which was used as a library template, as a control group.
[0177] Specifically, cells were seeded in an amount of 100 μl at a density of 2.5×10.sup.5 cells/mL in each well of a 96-well plate in a culture medium (DMEM supplemented with 4.5 g/L glucose (Gibco/Invitrogen), 10% heat-inactivated FBS (Gibco/Invitrogen)), pg/mL blasticidin activated peptidyl nucleoside antibiotics (Invitrogen), 100 μg/mL Zeocin (trade name) and streptomyces). On the same day, 50 μl of 200 pM human hIL-4 (Sino Biological) and 50 μl of an anti-hIL-4Rα antibody solution previously diluted to 40 to 200 nM were added, and then the 96-well plate was incubated at 37° C. and 5% CO.sub.2 for 24 hours. To measure the secreted SEAP, 20 μl of each cell supernatant was added to a transparent 96-well plate and mixed with 180 μl of a QUANTI-Blue solution, after which the 96-well plate was allowed to react at 37° C. for 1 hour and the absorbance at 620 nm was analyzed with a Cytation™ 3 cell Imaging multi-mode reader (
[0178] The result of analysis showed that all anti-hIL-4Rα antibodies with improved affinity exhibited a higher hIL-4-signal-blocking effect than the 4R34 used as a template, and among them, the 4R34.1 antibody exhibited the highest hIL-4-signal-blocking effect (
Example 10: Construction and Selection of High-Diversity Antibody Library for Additional Affinity Improvement Based on 4R34.1 Antibody
[0179] Because it was determined that the ability to inhibit SEAP activity by hIL-4-dependent STAT6 phosphorylation can be increased by improving affinity, affinity and SEAP activity inhibition by hIL-4-dependent STAT6 phosphorylation were increased by modifying (improving) VH-CDR1 and VH-CDR1 not used in Example 7.
[0180] Specifically, similar to Example 7, mutations were introduced into VH-CDR1 (31-35) and VH-CDR1 (27-32) using a degeneration codon (NNK) in which all 20 amino acids can be arranged and using the pYDS 4R34.1 vector as a template (
[0181] Overlapping PCR was performed to prepare 12 μg of the library gene and 4 μg of the pYDS dummy vector treated with NheI/ApaI restriction enzymes. The two genes were mixed and transformed into an EBY100 (MATa, Trp-) yeast strain for yeast surface expression by electroporation, and constructed through homologous recombination. This process was repeated 10 times, serial dilution was performed, and then the library size was detected by measuring the number of colonies grown in a SD-CAA+Trp selection medium (20 g/L glucose, 6.7 g/L yeast nitrogen base without amino acids, 5.4 g/L Na.sub.2HPO.sub.24, 8.6 g/L NaH.sub.2PO.sub.2, 5 g/L casamino acids, 0.4 mg/L tryptophan).
[0182] In the primary FACS, 1 ml of 1 pM biotinylated hIL-4Rα was allowed to react with 1×10.sup.8 scFab yeast at room temperature for 30 minutes. In the secondary FACS, 1 ml of 2 nM biotinylated hIL-4Rα was allowed to react with 1×10.sup.8 scFab yeast at room temperature for 30 minutes, and then the result was washed with 1 ml autoMACS® Running Buffer and made to compete with 10 ml of 200 nM hIL-4Rα unconjugated with biotin at room temperature for hours. In the tertiary and quaternary FACS, 1 ml of 1 nM biotinylated hIL-4Rα was bound to 1×10.sup.8 scFab yeast at room temperature for 30 minutes, washed with 1 ml autoMACS® Running Buffer, and made to compete with 1 ml of 100 nM hIL-4Rα unconjugated with biotin at room temperature for 2 hours to select clones having high binding ability.
[0183] After the final quaternary FACS, individual clones having high binding ability to hIL-4Rα were classified according to the PE signal, and clones called “4R34.1.11”, “4R34.1.13”, “4R34.1.17”, “4R34.1.18”, “4R34.1.19”, and “4R34.1.21” were selected.
[0184] The six clones were converted to IgG in Example 3 above and identified. Tables 15 and 16 show the heavy-chain variable-region sequences and CDR sequences of selected six individual clones having high binding ability to hIL-4Rα, and Tables 17 and show the light-chain variable-region sequences and CDR sequences.
TABLE-US-00015 TABLE 15 Heavy- chain variable region name sequence SEQ ID NO: 4R34.1.19 EVQLLESGGGLVQPGGSLRLSCAASGFTFSRHAMAWVRQAPGK SEQ ID NO: 83 GLEWVSAITSSGRSIYYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAVYYCARVHRAFDYWGQGTLVTVSS
TABLE-US-00016 TABLE 16 Heavy- chain vari- able region CDR1 name sequence CDR2 sequence CDR3 sequence Kabat No. 31 32 33 34 35 50 51 52 52a 53 54 55 56 57 58 59 60 61 62 63 64 65 95 96 97 98 99 101 102 4R34.1. R H A M A A I T S S G R S I Y Y A D S V K G V H R A F D Y 19 SEQ ID No: 84 SEQ ID No: 85 SEQ ID No: 32
TABLE-US-00017 TABLE 17 Light- chain variable region SEQ ID name sequence NO: 4R34.1.11 QSVLTQPPSASGTPGQRVTISCSGSSANSRTDGFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSKSGTSASLA SEQ ID ISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG NO: 86 4R34.1.13 QSVLTQPPSASGTPGQRVTISCSGSAQFGSRDNFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSKSGTSASLA SEQ ID ISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG NO: 87 4R34.1.17 QSVLTQPPSASGTPGQRVTISCSGSTKQMHNYQFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSKSGTSASLA SEQ ID ISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG NO: 88 4R34.1.18 QSVLTQPPSASGTPGQRVTISCSGSLLRGENLQFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSKSGTSASLA SEQ ID ISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG NO: 89 4R34.1.19 QSVLTQPPSASGTPGQRVTISCSGSPLFPDSGSFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSKSGTSASLA SEQ ID ISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG NO: 90 4R34.1.21 QSVLTQPPSASGTPGQRVTISCSGSAALDLSPSFNWYQQLPGTAPKLLIYADSHRPSGVPDRFSGSKSGTSASLA SEQ ID ISGLRSEDEADYYCGTWDYSLSGYVLGGGTKLTVLG NO: 91
TABLE-US-00018 TABLE 18 Light- chain variable region name CDR1 sequence CDR2 sequence Kabat No. 24 25 26 27 27a 27b 28 29 30 31 32 33 34 50 51 52 53 54 55 56 4R34.1. S G S S A N S R T D G F N A D S H R P S 11 SEQ ID No: 92 SEQ ID No: 60 4R34.1. S G S A Q F G S R D N F N A D S H R P S 13 SEQ ID No: 92 SEQ ID No: 60 4R34.1. S G S T K Q M H N Y Q F N A D S H R P S 17 SEQ ID No: 92 SEQ ID No: 60 4R34.1. S G S L L R G E N L Q F N A D S H R P S 18 SEQ ID No: 92 SEQ ID No: 60 4R34.1. S G S P L F P D S G S F N A D S H R P S 19 SEQ ID No: 92 SEQ ID No: 60 4R34.1. S G S A A L D L S P S F N A D S H R P S 21 SEQ ID No: 92 SEQ ID No: 60 Light-chain variable region name CDR3 sequence Kabat No. 89 90 91 92 93 94 95 95a 95b 96 97 4R34.1.11 G T W D Y S L S G Y V SEQ ID No: 68 4R34.1.13 G T W D Y S L S G Y V SEQ ID No: 68 4R34.1.17 G T W D Y S L S G Y V SEQ ID No: 68 4R34.1.18 G T W D Y S L S G Y V SEQ ID No: 68 4R34.1.19 G T W D Y S L S G Y V SEQ ID No: 68 4R34.1.21 G T W D Y S L S G Y V SEQ ID No: 68
Example 11: Biochemical/Biological Evaluation for Antibody Selection
[0185] <Evaluation of Competitive Binding of Antibodies and human hIL-4 to hIL-4Rα>
[0186] Binding competition ELISA was performed to determine whether or not anti-hIL-4Rα antibodies compete with hIL-4 for hIL-4Rα binding sites as a criterion for selecting anti-hIL-4Rα antibodies with high biological efficacy.
[0187] Specifically, the hIL-4Rα protein purified in Example 1 was immobilized in a 96-well plate at a concentration of 50 ng/well at room temperature for 1 hour and blocked with 0.1% PBST containing 4% BSA (Bovine Serum Albumin) at room temperature for 1 hour. The solution was discarded, the residue was washed 3 times with 0.1% PBST, and a mixture of hIL-4-mFc [27 nM] and anti-hIL-4Rα antibody at different concentrations [20 nM, 100 nM, 500 nM] was prepared, added in an amount of 25 μl to each well of a blocked plate and allowed to react at room temperature for 1 hour. The solution was discarded, the residue was washed times with 0.1% PBST, and an anti-mouse IgG-HRP antibody (1:4000) as a secondary antibody was added in an amount of 25 μl to each well and allowed to react at room temperature for 1 hour. The solution was discarded, the residue was washed 3 times with PBST, and a TMB solution was added in an amount of 25 μl to each well, followed by color development at room temperature for 1 minute 30 seconds. The reaction was stopped with H.sub.2SO.sub.4 (1M), and the absorbance at 450 nm was measured with an ELISA reader. The results of ELISA showed that all anti-hIL-4Rα antibodies and hIL-4-mFc competed to bind to hIL-4R, and there was no notable difference in the competitive ability between anti-hIL-4Rα antibodies (
[0188] <Affinity Evaluation>
[0189] Table 19 shows the results of analysis of affinity of antibodies to hIL-4Rα using SPR.
TABLE-US-00019 TABLE 19 K.sub.a (M.sup.−1S.sup.−1) K.sub.b(S.sup.−1) K.sub.D(M) 4R34.1 3.64 × 10.sup.6 6.02 × 10.sup.−4 1.66 × 10.sup.−10 4R34.1.11 3.76 × 10.sup.6 3.07 × 10.sup.−4 8.15 × 10.sup.−11 4R34.1.13 4.1 × 10.sup.6 3.1 × 10.sup.−4 7.56 × 10.sup.−11 4R34.1.17 4.02 × 10.sup.6 4.13 × 10.sup.−4 1.03 × 10.sup.−10 4R34.1.18 4.57 × 10.sup.6 4.84 × 10.sup.−4 1.06 × 10.sup.−10 4R34.1.19 3.93 × 10.sup.6 5.2 × 10.sup.−4 1.32 × 10.sup.−10 4R34.1.21 3.03 × 10.sup.6 3.6 × 10.sup.−4 1.19 × 10.sup.−10
[0190] Specifically, hIL-4Rα (Sino Biological) was diluted to a concentration of 50 μl/ml in a 10 mM NaAc buffer (pH 4.0) and immobilized to about 200 response units (RU) on a CM5 sensor chip (GE Healthcare). Then, analysis was performed in HBS-EP buffer (10 mM Hepes, 3 mM ethylenediaminetetraacetic acid, and 0.005% surfactant P20 (pH 7.4), GE Healthcare) at a flow rate of μl/min, and 4R34.1, 4R34.1.11, 4R34.1.13, 4R34.1.17, 4R34.1.18, 4R34.1.19, 4R34.1.21 and dupilumab analogue antibodies were analyzed at a concentration of 1 nM to 80 nM. After binding and dissociation analysis, regeneration of the CM5 chip was carried out by flushing the CM5 chip with a buffer solution (10 mM Glycine, pH 2.0) at a flow rate of 30 μl/min for 90 seconds. The sensorgram obtained by binding for 90 seconds and dissociation for 360 seconds was normalized, and the value of a blank cell was subtracted therefrom to calculate the affinity.
[0191] The affinity of the newly derived antibodies for hIL-4Rα was found not to be greatly different from that of 4R34.1.
[0192] <Evaluation of SEAP Activity Inhibition by hIL-4-Dependent STAT6 Phosphorylation>
[0193] The hIL-4-signal-blocking effect of anti-hIL-4Rα antibodies was detected by measuring SEAP secretion of HEK-Blue IL-4/13 cells in the same manner as in Example 5 using, as a control group, 4R34.1 used as a library template with respect to 4R34.1.11, 4R34.1.13, 4R34.1.17, 4R34.1.18, 4R34.1.19 and 4R34.1.21 antibodies.
[0194] Specifically, cells were seeded in an amount of 100 μl at a density of 2.5×10.sup.5 cells/mL in each well of a 96-well plate in a culture medium (DMEM supplemented with 4.5 g/L glucose (Gibco/Invitrogen), 10% heat-inactivated FBS (Gibco/Invitrogen)), pg/mL blasticidin activated peptidyl nucleoside antibiotics (Invitrogen), 100 μg/mL Zeocin (trade name) and streptomyces). On the same day, 50 μl of 200 pM human hIL-4 (Sino Biological) and 50 μl of an anti-hIL-4Rα antibody solution previously diluted to 40 to 200 nM were added, and then the 96-well plate was incubated at 37° C. and 5% CO.sub.2 for 24 hours. To measure the secreted SEAP, 20 μl of each cell supernatant was added to a transparent 96-well plate and mixed with 180 μl of a QUANTI-Blue solution, and then the 96-well plate was allowed to react at 37° C. for 1 hour and the absorbance at 620 nm was analyzed with a Cytation™ 3 cell Imaging multi-mode reader.
[0195] The result of the analysis showed that all anti-hIL-4Rα antibodies with increased affinity had higher hIL-4-signal-blocking effects than a 4R34.1 antibody used as a template at concentrations of 20 to 100 nM, and among them, the 4R34.1.17 and 4R34.1.19 antibodies exhibited the highest hIL-4-signal-blocking effect (
[0196] <Evaluation of SEAP Activity Inhibition by hIL-13-Dependent STAT6 Phosphorylation>
[0197] The hIL-13-signal-blocking effect of anti-hIL-4Rα antibodies was detected by measuring SEAP secretion of HEK-Blue IL-4/13 cells using, as a control group, 4R34.1 used as a library template with respect to 4R34.1.17 and 4R34.1.19 antibodies, which had high ability to neutralize hIL-4.
[0198] Specifically, cells were seeded in an amount of 100 μl at a density of 2.5×10.sup.5 cells/mL in each well of a 96-well plate in a culture medium (DMEM supplemented with 4.5 g/L glucose (Gibco/Invitrogen), 10% heat-inactivated FBS (Gibco/Invitrogen)), 10 μg/mL blasticidin activated peptidyl nucleoside antibiotics (Invitrogen), 100 μg/mL Zeocin (trade name) and streptomyces). On the same day, 50 μl of 2 nM human hIL-13 (Peprotech) and 50 μl of an anti-hIL-4Rα antibody solution previously diluted to 40 to 200 nM were added, and then the 96-well plate was incubated at 37° C. and 5% CO.sub.2 for 24 hours. To measure the secreted SEAP, 20 μl of each cell supernatant was added to a transparent 96-well plate and mixed with 180 μl of a QUANTI-Blue solution, and then the 96-well plate was allowed to react at 37° C. for 1 hour and the absorbance at 620 nm was analyzed with a Cytation™ 3 cell Imaging multi-mode reader.
[0199] The result of the analysis showed that anti-hIL-4Rα antibodies with increased affinity had higher effect of blocking the signal of 1 nM hIL-13 than dupilumab analogues (
[0200] Since hIL-13 is present in a very low amount of 78.5+/−64.5 μg/ml in the serum of asthma patients, it can be expected that administration thereof to asthma patients will have similar effects to dupilumab.
Example 12: Verification of hIL-4Rα-Specific Binding Ability for Final Antibody Selection
[0201] In order to detect the specificity for hIL-4Rα, the hIL-4Rα-specific binding of the hIL-4Rα antibody was detected by FACS using the THP-1 cell line expressing hIL-4Rα (hIL-4Rα positive) and the Molt-4 cell line not expressing hIL-4Rα (hIL-4Rα negative).
[0202] Specifically, 2×10.sup.5 cells/90 μl of THP-1 and Molt-4 cells and 1 μg of hIgG (10 mg/ml) with respect to each sample were mixed and allowed to react at 4° C. for 20 minutes to block Fcγ receptors. Non-specific binding of the anti-hIL-4Rα antibody to the heavy-chain region can be excluded through this process. Then, 10 μl of 40 to 1,000 nM anti-hIL-4Rα antibodies were added to adjust the final concentration to 4 to 100 nM, followed by reaction at 4° C. for 30 minutes and washing with cold PBS (pH 7.4). Anti-human IgG Fcγ-specific F(ab′)2 secondary antibody conjugated with Alexa fluor 488 recognizing human IgG (Jackson ImmunoResearch) was allowed to react at 4° C. for 30 minutes (pH 7.4), washed, and analyzed with a FACS Calibur (BD Bioscience) flow cytometer. After analysis, a histogram graph for each sample was obtained.
[0203] The result of analysis showed that the 4R34.1.17 and 4R34.1.19 antibodies exhibited improved binding ability to hIL-4Rα in THP-1 than the control 4R34.1 antibody (
Example 13: Epitope Mapping of 4R34.1.19 Antibody
[0204]
TABLE-US-00020 TABLE 20 SEQ ID NO: 98 Met Gly Trp Leu Cys Ser Gly Leu Leu Phe Pro Val Ser Cys Leu Val Leu Leu Gln Val 1 5 10 15 20 Ala Ser Ser Gly Asn Met Lys Val Leu Gln Glu Pro Thr Cys Val Ser Asp Tyr Met Ser 21 25 30 35 40 Ile Ser Thr Cys Glu Trp Lys Met Asn Gly Pro Thr Asn Cys Ser Thr Glu Leu Arg Leu 41 45 50 55 60 Leu Tyr Gln Leu Val Phe Leu Leu Ser Glu Ala His Thr Cys Ile Pro Glu Asn Asn Gly 61 65 70 75 80 Gly Ala Gly Cys Val Cys His Leu Leu Met Asp Asp Val Val Ser Ala Asp Asn Tyr Thr 81 85 90 95 100 Leu Asp Leu Trp Ala Gly Gln Gln Leu Leu Trp Lys Gly Ser Phe Lys Pro Ser Glu His 101 105 110 115 120 Val Lys Pro Arg Ala Pro Gly Asn Leu Thr Val His Thr Asn Val Ser Asp Thr Leu Leu 121 125 130 135 140 Leu Thr Trp Ser Asn Pro Tyr Pro Pro Asp Asn Tyr Leu Tyr Asn His Leu Thr Tyr Ala 141 145 150 155 160 Val Asn Ile Trp Ser Glu Asn Asp Pro Ala Asp Phe Arg Ile Tyr Asn Val Thr Tyr Leu 161 165 170 175 180 Glu Pro Ser Leu Arg Ile Ala Ala Ser Thr Leu Lys Ser Gly Ile Ser Tyr Arg Ala Arg 181 185 190 195 200 Val Arg Ala Trp Ala Gln Cys Tyr Asn Thr Thr Trp Ser Glu Trp Ser Pro Ser Thr Lys 201 205 210 215 220 Trp His Asn Ser Tyr Arg Glu Pro Phe Glu Gln His 221 225 230 232
[0205] The binding structure of hIL-4 and hIL-4Rα is shown in PDB (Protein Database) ID: 1IAR, the residues important for binding of the two proteins are Glu33 and Arg112 of hIL-4, and Tyr38, Ser95, Asp97 and Tyr208 of hIL-4Rα, have electrostatic interactions (LaPorte et al., 2008).
[0206] In addition, Leu67, Leu68, Asp92 and Val93 are also expected to be involved in binding to hIL-4, and these residues are recognized as epitopes of Leu67, Leu68, Asp92, and Val93 by other anti-hIL-4Rα antibodies (Medimmune Limited) (Korean Patent No. 1620539).
[0207] For epitope mapping, a single mutation was introduced to convert each of the eight residues mentioned above (Tyr38, Ser95, Asp97, Tyr208, Leu67, Leu68, Asp92, Val93) to Ala, the eight hIL-4Rα proteins were purified in the same manner as in <Example 1>, and the purity was detected using 12% SDS-PAGE (
[0208] The protein was immobilized at 50 ng/well in a 96-well plate at room temperature for 1 hour and blocked at room temperature with 0.1% PBST containing 4% BSA (bovine serum albumin) for 1 hour. The solution was discarded, the residue was washed three times with 0.1% PBST, 5 nM hIL-4-mFc and 100 pM or 2.5 nM anti-HIL-4Rα antibodies (4R34 4R34.1, 4R34.1.9, Dupilumab analogue) were added at 25 μl/well to the blocked plate, and the reaction was allowed to proceed at room temperature for 1 hour. The solution was discarded, the residue was washed 3 times with 0.1% PBST, and then 25 μl of an anti-human IgG-HRP antibody (1:8000) as a secondary antibody was added to each well and allowed to react at room temperature for 1 hour. The solution was discarded, the residue was washed 3 times with PBST, and 25 μl of a TMB solution was added to each well, followed by color development at room temperature for 1 minute. The reaction was stopped with H.sub.2SO.sub.4 (1M), and absorbance was measured at 450 nm using an ELISA reader.
[0209] As a result, as can be seen from
[0210] In addition, Tyr38, Ser95, Asp97, and Tyr208 of hIL-4Rα have electrostatic interactions with Glu45 and Arg98 of hIL-13 (LaPorte et al., 2008). Thus, 4R34, 4R34.1, and 4R34.1.9 are considered to compete with hIL-13 for binding sites and inhibit the signaling of hIL-13.
Example 14: Evaluation of Ability of 4R34.1.19 Antibody to Inhibit Cell Proliferation of PHA-Activated PBMC
[0211] Human PBMCs do not express much hIL-4Rα, but has been reported to express IL-4Rα in B cells and T cells as immune cells are divided when activated using a mitogen called “PHA (phytohaemagglutinin P, Sigma-Aldrich)”. Thus, whether or not the 4R34.1.19 candidate antibody actually inhibits the proliferation of cells expressing hIL-4Rα in humans was determined using PBMC activated with PHA.
[0212] Specifically, in order to isolate immune cells (PBMC) from human peripheral blood, 5 ml of Ficoll (GE Healthcare) was charged in a 15 ml test tube. The collected blood was mixed at 1:1 with PBS (pH 7.4) and shaken, and then 10 ml of the mixture was added to a test tube containing Ficoll while preventing mixing with Ficoll, and centrifuged at 750 g in an unbroken state for 20 minutes. Then, the buffy coat formed on Ficoll was recovered and washed twice with PBS (pH 7.4) to obtain PBMCs containing T cells, B cells, NK cells and monocytes. The isolated normal PBMCs do not express a sufficiently large amount of IL-4Rα to observe the binding of IL-4Rα. Therefore, PBMCs were treated with mitogen called “PHA” (Sigma-Aldrich) for 72 hours to stimulate T cells and B cells to be activated. It has been reported that treatment with PHA causes immune cells to be divided and IL-4Rα receptors to be expressed in T cells and B cells. 1×10.sup.6 cells/ml of PBMC was added to RPMI1640 medium containing 10% FBS, and 10 μg/ml of PHA was added thereto as a mitogen, followed by incubation in an incubator at 37° C. under 5% CO.sub.2 for 72 hours. PBMCs activated with PHA were washed with cold PBS (pH 7.4), and 2×10.sup.4 cells were prepared for each sample. PHA-activated PBMC (2×10.sup.4, 100 μL) was added to a 96-well plate (SPL, Korea), 50 μl of 2 pM IL-4 diluted with RPMI1640 medium containing 10% FBS was added, and 50 μl of 4R34.1.19, 4R34, 4R34.1 and dupilumab analogue antibodies diluted to 80 to 2,000 nM were added, followed by incubation at 37° C. in 5% CO.sub.2 for 48 hours. Then, for the cell proliferation test, 70 μl of a CTG (CellTiter-Glo, Promega) reagent was added to each well and then allowed to react at room temperature for 20 hours, and luminescence was measured using a Cytation™ 3 Cell Imaging Multi-Mode Reader.
[0213] The result of analysis showed that the 4R34.1.19 antibody exhibited a notably improved effect of suppressing the proliferation of PHA-activated PBMCs than the 4R34.1 antibody as a template, and suppressed the proliferation of PHA-activated PBMCs to a degree similar to that of the control dupilumab analogue (
Example 15: Evaluation of Ability of 4R34.1.9 Antibody to Inhibit Th2 Cell Differentiation
[0214] Whether or not the 4R34.1.9 antibody inhibits the differentiation of Th2 cells by IL-4 was determined using the IL-4 ELISpot assay.
[0215] Specifically, an antibody conjugated with PE-cy5 recognizing CD4 in human PBMC, isolated in the same manner as in <Example 14> (Thermo Fisher Scientific), and an antibody conjugated with FITC, which recognizes CD45RO, a cell surface marker of memory cells (Thermo Fisher Scientific), were added and allowed to react at 4° C. for 30 minutes. The result was washed with PBS, and naive CD4.sup.+ T cells (CD4.sup.+ CD45.sup.−) were separated by FACS Aria III (BD biosciences, Korea). The isolated naive CD4.sup.+ T cells (5×10.sup.4 cells/well) were added to a 96-well flat-bottom plate, and sulfate latex beads (5×10.sup.4 cells/well) coated with anti-CD3 Ab/anti-CD28 Ab, 50 μl of Th2 differentiation medium (5 pg/ml anti-IFN-γ Ab, 5 ng/ml IL-2 and 10 ng/ml IL-4) and 50 μl of 4R34.1.9, 4R34, 4R34.1 and dupilumab analog antibodies diluted to 20-500 nM were added, followed by incubation in a 37° C., 5% CO.sub.2 incubator for 7 days. The cultured cells were washed with cold PBS (pH 7.4), 2×10.sup.4 cells for each sample were added to an ELISpot plate coated with anti-IL-4 capture antibody (Mabtech), and sulfate latex beads (2×10.sup.4 cells/well) coated with anti-CD3 Ab/anti-CD28 Ab were added thereto, followed by incubation in an incubator at 37° C. and 5% CO.sub.2 for 24 hours. The ELISpot plate was washed with cold PBS (pH 7.4), and a biotin-conjugated IL-4 detection antibody (Mabtech) was bound thereto at room temperature for 2 hours. The result was washed with PBS (pH 7.4), bound with avidin-conjugated alkaline phosphatase (AP) (Mabtech) at room temperature for 1 hour, and washed with PBS (pH 7.4), and then a BCIP/NBT-plus substrate was added thereto to develop the color of IL-4 spots. The number of IL-4 spot-forming cells was measured using an ELISpot plate reader.
[0216] The result of analysis showed that the 4R34.1.19 antibody exhibited a remarkably improved effect of inhibiting the differentiation of naive T cells from normal and asthmatic patients into Th2 cells, compared to the template 4R34.1 antibody, and an effect of inhibiting differentiation similar to that of the control dupilumab analogue. This can be seen from the quantified values and representative images (
[0217] Although specific configurations of the present invention have been described in detail, those skilled in the art will appreciate that this description is provided to set forth preferred embodiments for illustrative purposes and should not be construed as limiting the scope of the present invention. Therefore, the substantial scope of the present invention is defined by the accompanying claims and equivalents thereto.
INDUSTRIAL APPLICABILITY
[0218] The anti-hIL-4Rα antibody or antigen-binding fragment thereof of the present invention neutralizes hIL-4 activity and thereby has effects of suppressing the growth of patient-derived T cells and inhibiting the differentiation thereof into Th2 cells, thus being used for the treatment or prevention of inflammatory diseases, more particularly, allergic diseases such as dermatitis, asthma, allergic rhinitis or food allergic reactions, as well as diseases including, but not limited to, arthritis (including septic arthritis), herpes, chronic idiopathic urticaria, scleroderma, hypertrophic scarring, Whipple's disease, benign prostatic hyperplasia, lung disorders such as mild, moderate or severe asthma, inflammatory disorders such as inflammatory bowel diseases, Kawasaki disease, sickle cell disease, Churg-Strauss syndrome, Grave's disease, pre-eclampsia, Sjogren's syndrome, autoimmune lymphocytic proliferation syndrome, autoimmune hemolytic anemia, Barrett's esophagus, autoimmune uveitis, tuberculosis, and nephropathy.