METHODS OF COATING ANTIMICROBIAL PEPTIDES ON THE BIOMATERIAL AND THE BIOMATERIAL COATED THEREBY
20220226545 · 2022-07-21
Inventors
- You-Di LIAO (TAIPEI, TW)
- Dan-Wei WANG (NEW TAIPEI CITY, TW)
- Eden WU (JIAOXI TOWNSHIP, TW)
- Shih-Han WANG (TAIPEI CITY, TW)
- Wen-Hung TANG (TAICHUNG CITY, TW)
Cpc classification
A61L29/16
HUMAN NECESSITIES
A61L31/16
HUMAN NECESSITIES
A61L2300/252
HUMAN NECESSITIES
A61L27/54
HUMAN NECESSITIES
A61L2300/404
HUMAN NECESSITIES
International classification
A61L27/54
HUMAN NECESSITIES
A61L29/16
HUMAN NECESSITIES
Abstract
The present invention pertains to methods of coating antimicrobial peptides on the biomaterial and the biomaterial coated thereby. The coating solution described herein comprises one or more antimicrobial peptides (AMPs) dissolved in a buffer containing an anionic surfactant, wherein the AMPs are amphipathic and cationic.
Claims
1. A coating solution, comprising one or more antimicrobial peptides (AMPs) dissolved in a buffer containing an anionic surfactant, wherein the AMPs are amphipathic and cationic.
2. A method for coating a surface of a material, comprising (i) dissolving one or more antimicrobial peptides (AMPs) in an anionic surfactant and (ii) coating the resulting AMP solution on the surface of the material so that the AMPs attach onto the surface.
3. The method of claim 2, which comprises (i) dissolving one or more antimicrobial peptides (AMPs) in a buffer containing a lower concentration anionic surfactant than 0.002% (w/v) to form solution (a); (ii) adding an amount of a buffer containing a higher concentration anionic surfactant than 0.02% (w/v) to the solution (a) to form solution (b), wherein the amount of the buffer containing the higher concentration anionic surfactant is equal to that of the buffer containing the lower concentration anionic surfactant; and (iii) coating the solution (b) onto the surface of the material so that the AMPs attach onto the surface.
4. The method of claim 3, wherein the AMPs in the buffer containing the lower concentration anionic surfactant is in an amount ranging from about 0.002% (w/v) to about 0.02% (w/v) and the AMPs in the buffer containing the higher concentration anionic surfactant is in an amount ranging from 0.02% (w/v) to about 0.6% (w/v).
5. A material, which is coated with one or more AMPs by the method according to claim 2.
6. The method according to claim 2, wherein the anionic surfactant is sodium dodecyl sulfate (SDS), sodium lauroyl sarcosinate (sarkosyl), sodium 1-decane sulfonate (SDSn), sodium n-octyl sulfate (SOS) or sodium dodecyl benzene sulfonate (SDBS).
7. (canceled)
8. The method of claim 2, wherein the AMPs are in an amount ranging from about 0.01% (w/v) to about 0.1% (w/v).
9. The method of claim 2, wherein the material is glass, synthetic polymer, latex or metal.
10. The method of claim 2, wherein the material is used to make a medical instrument/device or a supporting stuff.
11. The method of claim 10, wherein the medical instrument/device or the supporting stuff is a film, particle, fiber, tube, frame, plate, catheter, stent, contact lens, bone implant, other surgical, dental instrument or medical device.
12. The method of claim 2, wherein the AMP is an peptide-derived antibiotic, α-helical, β-strand or coiled peptide.
13. The method of claim 2, wherein the AMP is the peptide selected from SEQ ID Nos: 1 to 23 or a mixture of any two or more thereof.
14. The method of claim 2, wherein the AMP is the peptide of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO: 18, SEQ ID NO:20 or SEQ ID NO:23 or a mixture of any two or more thereof.
15. The method of claim 2, wherein an AMP pair is used, wherein the AMP pair is a peptide-derived antibiotic in combination with any one of the peptides of SEQ ID Nos: 1 to 23.
16. The method of claim 15, wherein the AMP pair is any one of Polymyxin B, Polymyxin E and Gentamicin in combination with any one of the peptides of SEQ ID Nos: 1 to 23.
17. The method of claim 15, wherein the AMP pair is any one of Polymyxin B, Polymyxin E and Gentamicin in combination with any one of the peptide of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:16 or SEQ ID NO: 18.
18. The method of claim 15, wherein the AMP pair is SEQ ID NO:23 in combination with SEQ ID NO:3, SEQ ID NO:23 in combination with SEQ ID NO:14, SEQ ID NO:23 in combination with SEQ ID NO:15, SEQ ID NO:23 in combination with SEQ ID NO:16, SEQ ID NO:23 in combination with SEQ ID NO:20, SEQ ID NO:14 in combination with SEQ ID NO:16 or SEQ ID NO:14 in combination with SEQ ID NO:18.
19. The method of claim 10, wherein the medical instrument/device or supporting stuff has antimicrobial activity.
20. The method of claim 9, wherein the medical instrument/device or the supporting stuff inhibits both Gram-positive and Gram-negative bacteria.
21. An antimicrobial peptide, which is selected from the group consisting of: SEQ ID Nos: 2, 3, 4, 19 and 20.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
DETAILED DESCRIPTION OF THE INVENTION
[0042] While the preparation and use of various embodiments of the present invention are discussed in detail below, it should be appreciated that the present invention provides many applicable inventive concepts that can be embodied in a wide variety of specific contexts. The specific embodiments discussed herein are merely illustrative of specific ways to make and use the invention and do not delimit the scope of the invention.
[0043] To facilitate understanding of this invention, a number of terms are defined below. Terms defined herein have meanings as commonly understood by a person of ordinary skill in the areas relevant to the present invention. Terms such as “a”, “an” and “the” are not intended to refer to only a singular entity, but include the general class of which a specific example may be used for illustration. The terminology herein is used to describe specific embodiments of the invention, but their usage does not delimit the invention, except as outlined in the claims.
[0044] Bacterial biofilm formation is considered to play a major role in the pathogenesis of BAI. It is initiated by bacterial adherence to the surfaces of medical devices, followed by cell replication and production of an extracellular matrix consisting of bacteria, bacterial exopolysaccharides, proteins, extracellular DNA and host proteins. The bacteria in the biofilm are more tolerant to antibiotics and less susceptible to cells and molecules of the human immune defense system than the planktonic counterparts. These metabolically-inactive and antibiotic tolerant bacteria are able to multiply even after antibiotic treatment, which leads to the recurrence of BAI.
[0045] The antimicrobial peptides (AMPs) are effector molecules of the innate defense of animals, plants and microorganisms. They display antimicrobial activity against bacteria resistant to antibiotics and residing within the biofilm. AMPs are mostly amphipathic and cationic peptides that display broad antimicrobial activity against bacteria, fungi and enveloped viruses. The AMPs described herein include, but are not limited to, α-helical, β-strand and coiled peptides. Examples of the AMPs include, but are not limited to, SEQ ID Nos: 1 to 23. Among the AMPs, the antimicrobial peptides, SEQ ID NOs: 2, 3, 4, 19 and 20, are novel peptides having antimicrobial activity. Certain example of the AMPs is the peptide of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO: 18, SEQ ID NO:20 or SEQ ID NO:23 or a mixture of any two or more thereof.
[0046] One or more AMPs can be used in the present disclosure. Certain example is an AMP pair. The AMP pair is an peptide-derived antibiotic in combination with any one of the peptides of SEQ ID Nos: 1 to 23. Examples of the peptide-derived antibiotic include, but are not limited to, Polymyxin B, Polymyxin E and Gentamicin. In some embodiments, the AMP pair is any one of Polymyxin B, Polymyxin B, Polymyxin E and Gentamicin in combination with any one of the peptide of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:16 or SEQ ID NO: 18. In some embodiments, the AMP pair is SEQ ID NO:23 in combination with SEQ ID NO:3, SEQ ID NO:23 in combination with SEQ ID NO:14, SEQ ID NO:23 in combination with SEQ ID NO:15, SEQ ID NO:23 in combination with SEQ ID NO:16, SEQ ID NO:23 in combination with SEQ ID NO:20, SEQ ID NO:14 in combination with SEQ ID NO:16 or SEQ ID NO:14 in combination with SEQ ID NO:18.
[0047] In the present disclosure, AMPs are dissolved in anionic surfactants. In one embodiment, the AMPs are in an amount ranging from about 0.01% (w/v) to about 0.1% (w/v). The AMPs in the emulsion are attached onto the surface of biomaterials. In one embodiment, the one or more antimicrobial peptides (AMPs) form a small vesicle-like structure after the AMP(s) dissolve in the anionic surfactant.
[0048] A certain example of coating the AMP(s) of the present disclosure is a two-stage coating. One or more antimicrobial peptides (AMPs) is dissolved in a buffer containing a lower concentration anionic surfactant than 0.002% (w/v) to form a first solution (solution (a)). The resulting first solution is added to a buffer containing a higher concentration anionic surfactant than 0.02% (w/v) to the solution (a) to form a second solution (solution (b)). The amount of a buffer containing a high concentration anionic surfactant is equal to that of the buffer containing a low concentration anionic surfactant. Subsequently, the resulting second solution is coated onto the surface of the material so that the AMP attaches onto the surface. In one embodiment, the AMP in a buffer containing a low concentration anionic surfactant is in an amount ranging from about 0.002% (w/v) to about 0.02% (w/v). In some embodiments, the AMP in a buffer containing a high concentration anionic surfactant is in an amount ranging from 0.02% (w/v) to about 0.6% (w/v).
[0049] The AMPs are used to coat on the surface of various types of biomaterials. The coating can increase the half-life and reduce the side effect of AMPs in the body. Importantly, both the biofilm formation of bacteria on the implant and the colonization of bacteria in peri-implant tissue needs to be taken into consideration in designing prevention strategies. The AMPs may be coated on a variety of substrates, such as metals, ceramics, polymers, fibers and inert materials. Suitable metallic materials include metals, titanium-based alloys, stainless steel and nickel-chrome. Suitable polymeric materials include, but are not limited to, polystyrene (PS), polyethylene (PE), polypropylene (PP) and polyurethane (PU). These substrates may be in the form of, or form part of, films, particles (nanoparticles, micro-particles, beads), fibers (wound dressings, bandages, tape, pads, sponges), catheters, stents, contact lenses, bone implants, other surgical and dental instruments and/or medical devices used within or in contact with the body.
[0050] In one example, the AMP particles remain bound to polystyrene for at least 14 days in human urine and for 4 days in bovine serum. Both the remaining AMPs on the polystyrene/silicone and released AMPs in the urine/serum are bactericidal against E. coli and Pseudomonas aeruginosa PAO1. The coated AMPs are also inhibitory to the biofilm formation of P. aeruginosa 27853 in human urine.
[0051] Without further elaboration, it is believed that one skilled in the art can, based on the disclosure herein, utilize the present disclosure to its fullest extent. The following specific examples are, therefore, to be construed as merely descriptive, and not limiting of the remainder of the disclosure in any way whatsoever.
Examples
[0052] Materials and Methods
[0053] Coating Materials
[0054] The surfactants, sodium dodecyl sulfate (SDS) and sodium dodecylbenzenesulfonate (SDBS) were purchased from Bio-Rad (Hercules, Calif., USA) and Sigma-Aldrich (St. Louis, Mo., USA), respectively. Sodium octyl sulfate (SOS) and sodium 1-decane sulfonate (SDSn) were purchased from Sigma-Aldrich (St. Louis, Mo., USA). Non-tissue culture polystyrene-based 96-well microplates were obtained from Corning Inc. (NY, USA). Silicone was obtained from Momentive Company (Tokyo, Japan). Polyurethane (PU) was kindly provided by Pacific Hospital Supply Co. (Taipei, Taiwan). Titanium was a kind gift of Dr. Si-Ron Chen from China Steel Corporation (Kaohsiung, Taiwan).
[0055] The amino acid sequences of antimicrobial peptides (AMPs) including RR12, RRIKA, SAAP159, SMAP29, SMAP28-3+2, T9W, T18,19K and TP4-A12,15I are shown in Table 51. They were synthesized by Kelowna International Scientific Inc. (Taipei, Taiwan) with 95% purity and their molecular masses were verified by mass spectrometry analysis.
TABLE-US-00002 TABLE S1 Amino acid sequence of antimicrobial peptides. (The first table below discloses SEQ ID NOS 1, 24, 3, 2, 25, 6-7, 10-15, 26, 18-20, 22-23, 21, 3, and 21 and the second table below discloses SEQ ID NOS 14-16, 18, 20, 23, 3, and 21, all respectively, in order of appearance). Antimicrobial peptide Sequence [ref.] L-BMAP27 GRFKRFRKKFKKLFKKLSPVIPLLHLG-OH D-BMAP27 GRFKRFRKKFKKLFKKLSPVIPLLHLG-OH (All in D form) CAME-T18K, T19K KWKLFKKIGIGAVLKVLKKG-NH.sub.2 CAME-A12K, K15H KWKLFKKIGIGKVLHVLTTG-NH.sub.2 CAP18 GLRKRLRKFRNKIKEKIKKIGQKIQGLLPKLAPRTDY-OH Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV-OH GW-Q6 GIKIAKKAITIAKKIAKIYW-OH NLF20 H-NLFRKLTHRLFRRNFGYTLR-OH NRC12 H-GWKKWFNRAKKVGKTVGGLAVDHYL-NH.sub.2 Pilosulin-1 GLGSVFGRLARILGRVIPKV-NH.sub.2 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL-NH.sub.2 RR12 H-RRLIRLILRLLR-NH.sub.2 RRIKA H-WLRRIKAWLRRIKA-OH SAAP159 LKRLYKRVFRLLKRYYGQLRRPVR-OH SMAP29 RGLRRLGRKIAHGVKKYGPTVLRIIRIAG-NH.sub.2 SMAP28-3 RGLRRLGRKIVHVVKKYLPTVLRIIRIA-NH.sub.2 SMAP28-3 + 2 RGLRRLGRKIVHVVKKYLPTVLRIIRRL-NH.sub.2 T9F RFRRLRKKFRKRLKKI-NH.sub.2 T9W RFRRLRKKWRKRLKKI-NH.sub.2 TP4(Piscidins 4) H-FIHHIIGGLFSAGKAIHRLIRRRRR-OH T18, 19K KWKLFKKIGIGAVLKVLKKG-NH.sub.2 TP4-A12, 151 H-FIHHIIGGLFSAGKAIHRLIRRRRR-OH Antimicrobial peptide Sequence RR12 H-RRLIRLILRLLR-NH.sub.2 RRIKA H-WLRRIKAWLRRIKA-OH SAAP159 LKRLYKRVFRLLKRYYRQLRRPVR-OH SMAP29 RGLRRLGRKIAHGVKKYGPTVLRIIRIAG-NH.sub.2 SMAP2S-3 + 2 RGLRRLGRKIVHVVKKYLPTVLRIIRRL-NH.sub.2 T9W RFRRLRKKWRKRLKKI-NH.sub.2 T18, 19K KWKLFKKIGIGAVLKVLKKG-NH.sub.2 TP4-A12, 151 H-FIHHIIGGLFSAGKAIHRLIRRRRR-OH
[0056] Non-tissue culture polystyrene-based 96-well microplate was obtained from Corning Inc. (NY, USA). Cover glass (circles, 5×0.125 mm) was obtained from Assistant Company (Sondheim, Germany). Silicone was obtained from Momentive Company (Tokyo, Japan). Aluminum, stainless steel #301, latex (6×1 mm) and polypropylene carbonate (PPC, 6×1 mm) were kindly provided by Shineteh Instruments Co. (Taipei, Taiwan). Polyvinyl chloride (PVC) and polyurethane (PU) were kindly provided by Pacific Hospital Supply Co. (Taipei, Taiwan). Titanium was a kind gift of Dr. Si-Ron Chen from China Steel Corporation (Kaohsiung, Taiwan).
[0057] Coating of AMPs onto Biomaterial Discs
[0058] All of the biomaterials were shaped into round discs by a hole-puncher with diameter of 6.0 mm and placed into 96-well polystyrene-based microplates for coating. The antimicrobials including AMPs and antibiotics were dissolved in sodium phosphate buffer (10 mM, pH 7.4) containing various concentrations of surfactant and loaded into the respective wells of the biomaterial disc-containing 96-well microplates. 1× surfactant (1×SDS or SDBS) was defined as 0.075% surfactant (w/v) dissolved in phosphate buffer (10 mM sodium phosphate, pH 7.4). Various coating methods were performed and named as described below.
[0059] First, 1-step method: 8 or 24 μg antimicrobials were dissolved in 60 μl surfactant (at the indicated concentrations). The antimicrobials were loaded into respective wells of the disc-containing microplates and kept overnight for coating. The solution was then removed from the microplates and the dried microplates were kept at room temperature until use.
[0060] Second, 2-step method: 8 or 24 μg antimicrobials were dissolved in 30 μl surfactant (at low concentrations as indicated) and loaded into respective wells of the disc-containing microplates. Another 30 μl surfactant without antimicrobials (at higher concentrations) was added to the abovementioned antimicrobial-containing solution and kept overnight for coating. The solution was then removed from the microplates and the dried microplates were kept at room temperature until use.
[0061] Third, PXB-AMP mix-coating method: The PXB-AMP mixtures (16 μg, 8 μg each) were dissolved in 30 μl surfactant at lower concentration as indicated. Another 30 μl surfactant without antimicrobials (at higher concentrations) was added and loaded onto the discs that were placed in the microplates as mentioned above.
[0062] Stability of Coated AMPs Examined by Microscopy and SDS-PAGE
[0063] The stability of coated antimicrobials on the microplate when incubated in human urine, or 10-50% FBS, was analyzed at different time intervals under Nikon TMS-F inverted phase contrast microscope (Tokyo, Japan) equipped with TrueChrome IIs camera (Tucsen, China) and by 15% SDS-PAGE after dissolving the coatings in the SDS loading buffer (2% SDS, 10% glycerol, 5% 2-mercaptoethanol, 0.01% bromophenol blue, 125 mM Tris-HCl, pH6.8). The thermal stability of AMPs coated on microplate by SDS/SDBS against 37° C. and 60° C. treatment for 4 weeks was examined by microscopy and SDS-PAGE analysis after a seven-day urine incubation. The stability of AMPs coated on microplate by SDS against ethylene oxide sterilization (500 ppm) at 55° C. for 6 hr was examined by SDS-PAGE analysis. With respect to non-transparent biomaterials, such as silicone, polyurethane and titanium, only SDS-PAGE analysis was performed.
[0064] Morphology and Stability of Coated Antimicrobials Examined by Microscopy and SDS-PAGE
[0065] The morphology and stability of coated antimicrobials in human urine or 10% fetal bovine serum (FBS) was analyzed at different time intervals by both microscopic observation using Nikon TMS-F inverted phase contrast microscope (Tokyo, Japan) equipped with TrueChrome IIs camera (Tucsen, China), as well as by 15% reduced SDS-PAGE after dissolving the antimicrobials in loading buffer (2% SDS, 10% glycerol, 5% 2-mercaptoethanol, 0.01% bromophenol blue, 125 mM Tris-HCl, pH6.8). The stabilities of antimicrobials coated onto other substrates, such as silicone and titanium, in urine or serum were analyzed by 15% reduced SDS-PAGE only.
[0066] Antimicrobial Activities of Free and Coated AMPs
[0067] Bacteria. Pseudomonas aeruginosa PAO1 (ATCC BAA-47™), E. coli K-12 (MG1655), and E. coli (ATCC 23502) obtained from human clinics were cultured in/on Difco™ LB broth/agar (BD, New Jersey, USA). Staphylococcus aureus (ATCC 6538) were cultured in/on Difco™ TSB broth/agar.
[0068] Inhibition zone. Bacteria were cultured in Luria-Bertani broth and plated on Luria-Bertani agar for E. coli (ATCC 23502) and Pseudomonas aeruginosa (ATCC 27853) at 37° C. Staphylococcus aureus (ATCC 6538P) was cultured and plated in/on tryptic soy broth/agar. Candida albicans (ATCC 14053) were cultured in/on YM broth/agar at 30° C. Five ml of low melting agar (1%) mixed with 100 μl of overnight-cultured bacteria was spread on top of 1% regular agar plate. Two μl of antimicrobial peptides at various concentrations were dotted on the top layer of microbe-containing agar plates and incubated overnight for the development of inhibition zone.
[0069] Bactericidal activity of coated antimicrobials. Antimicrobials coated on the surface of polystyrene or silicone discs placed into wells of 96-well microplates were incubated in 100 μl of sterile human urine using the protocol approved by AS-IRB01-16070, or in 10% fetal bovine serum (FBS in RPMI1640), for the indicated times. The urine and serum were changed daily. 100 μl of microbes such as E. coli K-12 (1.5×10.sup.6 cfu/ml), P. aeruginosa PAOI and S. aureus (3×10.sup.6 cfu/ml) was inoculated onto the drained discs/microplates and incubated at 37° C. for 1.5 hrs. After plating onto the respective agar plates, colony forming units (cfu) were determined.
[0070] Bactericidal activity of released antimicrobials. The discs/microplates which had been coated with antimicrobials were incubated in 160 μl of sterile human urine, or in 10% FBS. The urine and serum were changed daily. 50 μl of the daily changed urine or serum was mixed with 50 μl of suspension containing E. coli K-12 (3×10.sup.5 cfu/ml) or P. aeruginosa PAOI (1.5×10.sup.5 cfu/ml), and incubated at 37° C. for 1.5 hrs. After plating onto the respective agar plates, colony forming units (cfu) were determined.
[0071] Minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC). For the determination of antimicrobial potency of free AMPs, the two-fold serially diluted AMPs (10 μl) were mixed with 90 μl of bacterial suspension (3×10.sup.5 cfu/ml) in respective medium (LB or TSB). The suspended AMPs were then loaded into wells of 96-well microplates and incubated at 37° C. overnight with gentle agitation at 100 rpm. The absorbance was measured by SpectraMax 190 microplate reader at 600 nm. The remaining cfu in the mixture was counted after plating on agar plate. Minimum inhibitory concentration (MIC) was defined as the lowest AMP concentration to keep the solution with the same absorbance as that of culture medium without bacteria. Minimum bactericidal concentration (MBC) was defined as the lowest AMP concentration which is able to kill 99.99% of inoculated microorganisms (24). Alternatively, the MIC of coated AMPs was also determined. In brief, the AMP-coated silicone discs were either immersed in 200 μl sterile human urine, or in cell culture medium (RPMI 1640+10% FBS) overnight. 190 μl of the released AMP/surfactant after two-fold serial dilution were mixed with 10 μl E. coli ATCC 23502 at the final concentration 3×10.sup.5 cfu/ml in 96-well microplates and incubated and determined for remaining cfu as mentioned above. The free form AMPs as well as surfactant were dissolved in 200 μl sterile media (cell culture medium or human urine) and used as a control for quantitation. The potency of antimicrobial activity was expressed as the dilution folds to reach the MIC, in which no bacteria grow in the medium. At least three independent experiments were performed to determine the value.
[0072] Quantitation of Released Antimicrobials by Inhibition Zone and the Minimal Inhibitory Concentration Method
[0073] The antimicrobial-immobilized silicone discs or microplates were incubated in 100 μl of human urine or in 200 μl of 10% FBS. The urine and serum were changed daily. Two μl of the incubation urine or serum being replaced (containing released/free SAAP159+PXB) or its dilutions were dotted onto the top layer of the microbe-containing agar plates and incubated at 37° C. overnight, following which the assessment of formation of growth inhibition zone was carried out. Defined amounts of mixed antimicrobials were used as a standard for the quantitation of the released antimicrobials. The amount of antimicrobial mixture which was able to form visible inhibition zone on the agar plate is defined as one unit of antimicrobial activity. For example, 5 ng PXB+2.5 ng AMP (SAAP159) in urine, and 2.5 ng PXB+1.25 ng SAAP159 in serum, respectively. Alternatively, to carry out the minimal inhibitory concentration (MIC) method, 190 μl of free antimicrobials or those that released in the serum or urine (200 μl) was mixed with 10 μl of microbes (1-30×10.sup.5 cfu/ml) in the respective wells of a 96-well microplate and incubated overnight with gentle agitation at 100 rpm. The absorbance at 600 nm was then determined by SpectraMax 190 microplate reader. Minimal inhibitory concentration (MIC), which is defined as the concentration of (diluted) sample serum or urine which is able to keep the absorbance of the bacteria-containing media no different to that of media only, was determined. The potency of antimicrobial activity, which is defined as the dilution fold of antimicrobial-containing urine or serum that achieves MIC, was also determined.
[0074] Antimicrobial Activity of Coated AMPs
[0075] 96-well microplates which had been coated with AMPs or adapted with AMP-coated silicone discs were immersed in 100 μl sterile human urine using the protocol approved by AS-IRB01-16070, or in 10% FBS dissolved in RPMI1640, with daily changes. One hundred μl of E. coli ATCC 23502 (2×10.sup.5 cfu/ml) was inoculated onto the drained discs/microplates and incubated at 37° C. for three hours before plating on the agar plates.
[0076] Bacterial Adherence
[0077] Both sides of silicone discs were coated by paired AMPs by 2-step SDS or SDBS coating method. These discs after incubation with urine were immersed in 270 μl of P. aeruginosa 27853 (2×10.sup.7 cfu/ml) in 96-well microplate and incubated at 37° C. for three hours with gentle shaking at 150 rpm for bacterial adherence. The bacteria-anchored discs were washed by 700 μl of PBS three times, and then sonicated for two min to disperse the bacteria from the discs. The bacteria in the solution were counted after plating on agar plate. Silicones disc without AMP coating acted as a control. At least three independent experiments with three discs in each experiment were performed to determine the average value.
[0078] Hemolytic Assay
[0079] Fresh mouse blood was collected following the protocol approved by IACUC Academia Sinica (AS-IUCUC-19-01-1277). The blood cells were pelleted and rinsed three times with 10% FBS in RPMI1640, and re-suspended in the same buffer. The erythrocytes (1.5×10.sup.7 cells) were then added to the solution containing free dual AMP/surfactant or overnight released components from silicone discs in 200 μl and incubation at 37° C. for one hr. The supernatants (150 μl) after centrifugation were transferred to 96-well plate for the measurement of the absorbance of released hemoglobin by SpectraMax 190 microplate reader (Molecular Devices, CA, USA) at 414 nm. Percent hemolysis was calculated using the following formula: % hemolysis=[(A414.sub.sample−A414.sub.medium)/(A414.sub.0.1% Triton-X 100−A414.sub.medium)]. Zero and 100% hemolysis were determined in medium and 0.1% Triton-X 100, respectively.
[0080] Cytotoxicity Assay
[0081] Human bladder carcinoma cell line (NTUB 1) was kindly provided by Dr. Te-Chang Lee (Institute of Biomedical Sciences, Academia Sinica, Taipei, Taiwan). Fetal bovine serum (FBS) and RPMI1640 were purchased from ThermoFisher Scientific Inc (Waltham, Mass., USA). NTUB 1 cells were maintained at 37° C. in a humidified incubator under 5% CO.sub.2 atmosphere in RPMI1640 containing 10% FBS, 100 U/ml penicillin and 100 μg/ml streptomycin. The NTUB 1 cells were seeded in the respective wells of a 96-well plate at a density of 1.5×10.sup.4 cells/1000 for 24 hr. The cells were further incubated in 2000 free antimicrobial/surfactant or components released from silicone disc after overnight incubation. After 20 hr incubation, 900 of fresh culture medium and 100 of WST-1 agent (Roche, Basel, Switzerland) were added to the drained wells and incubated for two 2 hr before measuring the absorbance by SpectraMax 190 microplate reader at 450 nm. Percent of cytotoxicity was determined using the following formula: % cytotoxicity=[(A450.sub.sample−A450.sub.positive control)/(A450.sub.negative control−A450.sub.positive control)]. Positive control was NTUB1 cells only, whereas negative control was medium without cells.
[0082] Mouse Model
[0083] Coating silicone tubing Silicone tubing with specifications of 0.3 mm (inner diameter [i.d.]) by 0.64 mm (outer diameter [o.d.]) was procured, and 4 mm segments of this tubing were used as implants in a mouse model. The coating of silicone tubing with paired AMPs was prepared by the two-step method, then cut into four mm segments before use. The needle portion of the I.V. catheter was temporarily removed from the catheter, and a four mm section from the tip of the catheter was cut off using sterile blades. Four mm segments of coated or non-coated silicone tubing were then assembled onto the original needle.
[0084] Implantation of silicone tubing in mouse bladder Eight to 10 weeks old ICR female mice were anesthetized with Zoletil® containing Tiletamine and Zolazepam (VIRVAC, France) using the protocol approved by Academia Sinica (AS-IUCUC-19-01-1277). The modified 24G catheter, mounted on the original needle, was positioned at a 30-degree angle immediately above the pubic bone with the bevel directed to the anterior. When the needle was carefully inserted into the bladder, the needle was removed while the ‘pusher’ was pushed slightly inward. This dislodged the short catheter segment into the lumen of the bladder, such that once the ‘pusher’ was removed, the only thing that remained inside the mouse bladder was the implanted four mm silicone tubing. After catheter implantation, 100 μl of E. coli 23502 (5×10.sup.9 cfu/ml) or P. aeruginosa 27853 (3×10.sup.9 cfu/ml) was injected into the bladder lumen. Urine was collected every two days using metabolic cage and quantified for the number of viable bacteria. Mice were sacrificed on day eight post-instillation. Indwelling tubing was collected, rinsed with 200 μl of sterile PBS and immersed in 200 μl of fresh PBS prior to sonication at 50/60 Hz for 10 min in an ultrasonic water bath for biofilm dispersal. The bacterial numbers were determined after serial dilutions and plating on agar plate. In addition, bacterial colonization in the urinary bladder was also measured after homogenization in 500 μl of PBS.
[0085] Statistical Analysis
[0086] For all in vitro antimicrobial assays, the average value with standard error was determined from at least three independent experiments. For determination of bacterial growth in urine and bacterial adherence to bladder and silicone tubing in the mouse model, a series of Wilcoxon rank sum tests were performed for pairwise comparisons to determine the significance of the difference found in the measured values between control non-coated tubing and experimental antimicrobial-coated tubing. P<0.05 was considered to be statistically significant.
Example 1 Coating of Antimicrobial Peptides by Anionic Surfactants
[0087] The antimicrobial peptide SMAP29 readily dissolves in aqueous solution, however if anionic surfactant, such as sarkosyl or SDS, was added, they become aggregated giving a cloudy solution appearance (data not shown). This is also shown in an SDS PAGE, where SMAP29 peptides at the indicated concentrations (8 μg, 24 μg/60 μl) were pulled down to the bottom of tube after centrifugation in the presence of 0.075% (w/v) sarkosyl or SDS, designated as 1×Sar or 1×SDS, respectively, or at lower surfactant concentrations (
[0088] In the presence of sarkosyl or SDS at the indicated concentrations, the SMAP29 peptides formed small vesicle-like structures (“vesicles”) with diameters ranging from 1-10 μm on the polystyrene-based 96-well microplates (
Example 2 Types of Antimicrobials that can be Coated onto Biomaterials by SDS
[0089] The SMAP-29-derived peptides (SMAP-28-3, SMAP28-3+2), SAAP159, TP4, and the L- and D-forms of BMAP27 (designated as L-BMAP27 and D-BMAP27, respectively) were found to be successfully coated onto the microplate by SDS and remained stable in human urine for at least three days as examined under the microscope. However, T9W and lipopeptide antibiotics such as Polymyxin B (PXB) aggregated immediately after the addition of surfactants including SDS, but they were unable to be evenly dispersed and coated on the substrate by the tested SDS concentrations (1/16×-32×).
Example 3 Coating of AMPs in Combination with Antibiotics
[0090] Improvement of coating efficiency by two-step coating method Because some AMPs aggregated after the addition of surfactants at high peptide concentrations and could not evenly and firmly attach to the microplate, we developed a two-step coating protocol to circumvent the problem. The result show that the coating efficiency and urine stability of SMAP29 peptides at day 3 and 7 by one-step coating method (24m in ⅛×SDS buffer) are much lower than that of two-step coating method (24m in first 1/16×SDS buffer, then mixed with second ½×SDS buffer) (
[0091] AMP with other antibiotics To increase the antimicrobial efficacy and to broaden the antimicrobial spectrum of coated antimicrobials, AMPs in combination with antibiotics were simultaneously coated onto the same substrate. The SAAP159 in combination with Polymyxin B (PXB) or Polymyxin E (PXE) were coated onto the microplate by the 2-step SDS coating method. The vesicles exerted by PXB-SAAP159 and PXE-SAAP159 pairs were stable in urine for more than four days as observed under the microscope (
[0092] PXB with other AMPs In addition to the above mentioned mix-coated PXB-AMP pairs, the following AMPs, including RR12, NRC12, Pleurocidin, Epinecidin-1, Pilosulin-1, TP4, GW-Q6 and RRIKA, were also successfully coated in combination with PXB onto the substrate at the indicated SDS concentrations. Moreover, SDS-PAGE shows they were stable in urine for 7 to 14 days and in serum for 2 to 3 days.
[0093] Other surfactants In addition to SDS, the following surfactants, including SDBS, sarkosyl, SDSn and SOS, when used to dissolve the antimicrobials were also able to successfully coat the PXB+SAAP159 and PXB+TP4 pairs onto the microplate. But only those coated using SDBS and sarkosyl as well as SDS remained stable in urine for two days, whereas those coated using SDSn and SOS were not stable under the same conditions (
[0094] Other biomaterials In addition to polystyrene, the PXB-SAAP159 pair could also be successfully coated onto silicone, glass and aluminum discs. These antimicrobials also remained stable in serum for two to three days as shown in
[0095] Thermo-stability To monitor the potential damages of coated PXB-AMP that may be attributed to the sterilization process of medical devices by ethylene oxide, or that which may occur during the transportation of microplates, the stability of PXB-SAAP159 coated on the microplates were examined following a 60° C. overnight incubation. No significant change was seen on the stability of the antimicrobials in water and in urine for at least 14 days and in serum for at least three days. Furthermore, after a four-weeks incubation at 60° C., PXB-SAAP159 was also found to remain stable in urine for at least seven days.
Example 4 Bactericidal Activities of AMP-PXB Pairs Coated on Polystyrene and Silicone
[0096] The 13 AMP-PXB pairs coated on polystyrene microplates possessed full bactericidal activities against E. coli even after a 14-day urine incubation with daily changes of fresh urine. These antimicrobials also exhibited strong bactericidal activity against P. aeruginosa and S. aureus after a three-day 10% serum incubation (Table 1). With respects to AMP-PXB pairs coated on silicone discs, four pairs out of seven pairs selected for testing possessed full bactericidal activity against E. coli K-12 even after a 14-day urine incubation (Table 2).
TABLE-US-00003 TABLE 1 Bactericidal activity of PXB + AMP coated on polystyrene E. coli K-12 P. aeruginosa PAO1 S. aureus Surfactant urine 10% serum AMPs SDS (x) 7 day 14 day 1 day 2 day 3 day 1 day 2 day 3 day PXB + SMAP29 1/16 + ½ 0 0 0 0 1 0 1 8 PXB + SMAP28-3 1/10 + 1 0 0 0 0 0 0 0 2 PXB + SMAP28-3 + 2 ¼ + ⅓ 0 0 0 0 0 0 0 3 PXB + BMAP27 1/10 + ½ 0 1 0 0 0 0 0 4 PXB + SAAP159 1/16 + 1 0 0 0 0 0 0 0 0 PXB + TP4 1/16 + 1 0 0 0 0 0 0 0 0 PXB + RR12 ⅛ + 1 0 0 0 0 0 0 1 1 PXB + NRC12 ⅛ + 1 0 0 0 0 0 1 1 1 PXB + Pleurocidin ⅛ + 1 0 0 0 0 0 0 0 0 PXB + Epinecidin-1 ⅛ + 1 0 0 0 0 0 1 1 1 PXB + Pilosulin-1 1/16 + 1 0 0 0 0 0 0 1 1 PXB + GW-Q6 1/16 + 1 0 0 0 0 0 0 0 3 PXB + RRIKA ⅛ + 1 0 0 0 0 0 0 6 5 Values represent percentage (%) of colony forming units (cfu) remaining compared with cfu found in the positive control group (without AMP-PXB coating).
TABLE-US-00004 TABLE 2 Bactericidal activity of PXB + AMP coated on silicone disc against E. coli E. coli K-12 Surfactant urine AMPss SDS (x) 7 day 14 day PXB + SMAP29 1/16 + ½ 0 7 PXB + SMAP28-3 1/10 + 1 0 20 PXB + SMAP28-3 + 2 ¼ + ⅓ 0 0 PXB + BMAP27 1/10 + ½ 0 8 PXB + SAAP159 1/16 + 1 0 0 PXB + Pleurocidin ⅛ + 1 0 0 PXB + RRIKA ⅛ + 1 0 0 Values represent percentage (%) of colony forming units (cfu) remaining compared with cfu found in the positive control group (without AMP-PXB coating).
Example 5 Bactericidal Activities of AMP-PXB Pairs Released in the Urine and Serum
[0097] Urine and serum samples obtained during daily urine/serum changes from eight groups of PXB/AMP pairs (coated on polystyrene) were tested for antimicrobial activities. Antimicrobial activities were determined by calculating the survival rate of inoculated microbes seven and 14 days after inoculation and is expressed as percentage of colony forming units (cfu) remaining compared with cfu found in the positive control group (without AMP-PXB coating). The results showed that some of the coated antimicrobials can consistently release into the urine over time and exhibit bactericidal activities against E. coli for at least eight to nine days (Table 3). Furthermore, these antimicrobials can also release into 10% serum and exhibit bactericidal activities against P. aeruginosa for at least two to three days (Table 4).
TABLE-US-00005 TABLE 3 Bactericidal activities against E. coli of PXB + AMPs that were released from polystyrene substrate into urine* E. coli K-12 AMPs day 1 day 2 day 3 day 4 day 5 day 6 day 7 day 8 day 9 PXB + SMAP29 0 0 0 0 32 100 90 91 100 PXB + SMAP28-3 0 0 0 0 0 0 0 0 22 PXB + SMAP28-3 + 2 0 0 0 0 26 68 100 90 100 PXB + SAAP159 0 0 0 0 0 0 0 0 0 PXB + NRC12 0 0 0 0 0 0 0 0 0 PXB + Pleurocidin 0 0 0 0 0 0 1 100 50 PXB + GW-Q6 0 0 0 0 0 0 0 0 0 PXB + RRIKA 0 0 0 0 0 0 0 0 12 Values represent percentage (%) of colony forming units (cfu) remaining compared with cfu found in the positive control group (without AMP-PXB coating). *PXB + AMPs were coated in 96-well plate and incubated with 160 μl urine. And 50 μl from daily changed urine was used for analysis.
TABLE-US-00006 TABLE 4 Bactericidal activities against P. aeruginosa of PXB + AMPs that were released from polystyrene substrate into serum* P. aeruginosa PAO1 AMPs day 1 day 2 day 3 day 4 day 5 PXB + SMAP29 0 0 36 69 81 PXB + SMAP28-3 0 0 0 77 78 PXB + SMAP28-3 + 2 0 0 86 100 84 PXB + SAAP159 0 0 0 88 93 PXB + NRC12 0 0 0 61 92 PXB + Pleurocidin 0 0 45 55 78 PXB + GW-Q6 0 0 26 69 92 PXB + RRIKA 0 0 0 60 74 Values represent percentage (%) of colony forming units (cfu) remaining compared with cfu found in the positive control group (without AMP-PXB coating). *PXB + AMPs were coated in 96-well plate and incubated with 160 μl urine. And 50 μl from daily changed urine was used for analysis.
Example 6 Quantitation of AMP-PXB Pairs Released into Urine and Serum by Inhibition Zone Assay
[0098] The bactericidal activities of PXB/SAAP159 released from silicone discs into urine or 10% serum was semi-quantitated by measuring the diameters of the inhibition zones formed. Briefly, a 2 μl sample taken from the daily changed urine (100 μl)/serum (200 μl) was dotted onto LB agar plate containing E. coli. The bactericidal activity was determined by comparing the diameter of visible inhibition zones that formed as a result of the antimicrobials with known amount of PXB/SAAP159. The results demonstrate that the SAAP159/PXB pairs coated on silicone consistently released into urine for at least nine days (
Example 7 Cytotoxic and Hemolytic Activities of AMP/PXB Coated on Silicone Discs
[0099] To identify the key component(s) which is released from the coated antimicrobials and is responsible for the cytotoxicity and hemolytic activities, individual components involved in the coating of antimicrobials, namely SDS, PXB and SAAP159, were examined. If the full amount of SDS (30 μl of ⅛×SDS plus 30 μl of 1×SDS) was coated onto the substrate (5.8 mm in diameter) and also subsequently completely released into the serum, the maximal amount of SDS would be 25 μg. The cytotoxicity of 25 μg of SDS toward NTUB1 cells in 200 μl was 99%, while this activity was reduced to 35% if half of the total amount was employed for the assay (
TABLE-US-00007 TABLE 5 Potency of PXB + AMP released from silicone disc and expressed in dilution fold (x). Potency (x) Cytotoxicity to Hemolysis of MIC to NTUB1*.sup.3 RBC E. coli*.sup.4 AMPs IC.sup.50 HC.sup.50 Serum Urine Free form*.sup.1 16 μg PXB <1 <1 512 128 25 μg SDS 1-2 1-2 <1 <1 SAAP159/PXB <1 <1 512 128 SMAP29/PXB <1 <1 256 128 RRIKA/PXB <1 <1 512 128 PXB/SDS 2-4 1-2 256 128 SAAP159/PXB/SDS 2-4 2-4 512 128 SMAP29/PXB/SDS 2-4 2-4 256 128 RRIKA/PXB/SDS 2-4 2-4 512 128 Released from silicone o/n*.sup.2 SAAP159/PXB/SDS 1-2 1-2 128 16 SMAP29/PXB/SDS <1 1-2 128 16 RRIKA/PXB/SDS 1-2 1-2 128 16 *.sup.11× free antimicrobials contains 8 μg AMP, 16 μg PXB, and/or 25 μg SDS in 200 μl. *.sup.2 The released antimicrobial was taken from the serum or urine (200 μl) in which antimicrobial-coated silicone disc was immersed overnight. *.sup.3NTUB1 cells were seeded at 1.5 × 10.sup.4 cell/well *.sup.4E. coli (ATCC23502) was seeded at 3 × 10.sup.6 cfu/ml
Example 8 PXB-AMPs Coated onto Silicone Tubing for the Prevention of Urinary Tract Infection in Mouse
[0100] The E. coli 23502 bacterial growth in urine of mouse implanted with uncoated silicone tubing remained constant (2-4×10.sup.5 cfu/ml on average) from day two to day eight after bacterial instillation, whereas mice implanted with PXB-SAAP159 or PXB-RRIKA-coated tubing markedly reduced the survival of E. coli (2-6×10.sup.2 cfu/ml). The viable bacteria that adhered onto the bladder and silicone tubing were also counted after homogenization and sonication, respectively. Bacteria that adhered on the bladder after sacrifice at day eight was 5×10.sup.3 cfu/bladder in the control group, while E. coli in the PXB-SAAP159-coated group and in the PXB-RRIKA-coated group was found to be 58 cfu/bladder and zero cfu, respectively. Furthermore, the amount of bacteria that adhered to uncoated silicone tubing was 1.2×10.sup.4 cfu/tubing, whereas no bacteria was found to be adherent to the tubing coated with either PXB-SAAP159 or PXB-RRIKA (
Example 9 Vesicle Formation and Coating of Antimicrobial Peptides onto Polystyrene by Anionic Surfactants
[0101] The antimicrobial peptides (AMPs) T9W, SAAP159, RRIKA and T18,19K readily dissolved in aqueous solution, however they became cloudy in appearance if anionic surfactants, such as SDS or SDBS, was added at a wide range of concentrations. They existed in small vesicle-like structures (hereinafter referred to as vesicles) and are deposited on the polystyrene-based 96-well microplates with diameters ranging from 1-10 μm, when they were coated by the two-step surfactant coating method. The concentration of 0.075% (w/v) surfactant, SDS and SDBS, was designated as 1×SDS and 1×SDBS, respectively. The optimal conditions for vesicle formation of these AMPs, T9W, SAAP159, RRIKA and T18,19K, were selected as shown in
Example 10 Coating of Two AMPs Simultaneously on Polystyrene by SDS and SDBS
[0102] 1. Coating of SMAP29 Peptides on Microplates by SDS and Sarkosyl and Stability in Urine
[0103] The individual AMPs as mentioned above exhibited differential antimicrobial activities against Gram-negative (E. coli 23502, Pseudomonas aeruginosa 27853), Gram-positive (Staphylococcus aureus) bacteria and fungus (Candida albicans) as determined by the inhibition zone assay on agar plate (
TABLE-US-00008 TABLE S2 MIC (μg/ml) and MBC (μg/ml) of individual AMPs against E. coli and S. aureus. E. coil 23502; LB S. aureus; TSB (3.5 × 10.sup.5 cfu/ml) (4 × 10.sup.5 cfu/ml) AMP MIC MBC MIC MBC T9W >512 >512 >512 >512 SAAP159 64 64 512 >512 RR1KA 128 128 64 128 T18,19K 64 64 >512 >512 RR12 4 4 4 4 TP4-A12,151 32 32 32 32 SMAP29 4 4 4 4 SMAP28-3 + 2 4 8 32 32
Example 11 Coating of AMP Pairs onto Silicone, Polyurethane and Titanium
[0104] Silicone is widely used in biomedical devices including central venous catheter and urinary catheter, therefore AMP pairs were coated onto silicone discs by SDS or SDBS and examined for their coating efficiency and stability in urine and in 10% FBS under the microscopy first, then by SDS-PAGE analysis. The individual AMPs of two selected AMP pairs (T9W+SAAP159, T9W+RRIKA) coated by either SDS or SDBS were tightly bound to the substrate after a 12-day urine incubation with daily changes of fresh urine (
Example 12 Bactericidal Activity of AMP Pairs Coated by SDS and SDBS
[0105] After a 12-day urine treatment with daily changes of fresh urine, the selected AMP pairs (T9W+SAAP159 and T9W+RRIKA) coated by the two-step (⅛×+½×) SDS buffer onto polystyrene microplates retained strong bactericidal activities against human isolate E. coli 23502 (10.sup.3-10.sup.4-folds reduction), while their bactericidal activity lasted for only for one to two days in 10% FBS (Table 6). In contrast, these AMP pairs coated by two-step (⅛×+1×) SDBS buffer did not exert bactericidal activity even without urine treatment (less than 10-folds reduction), because they were tightly bound to the substrate even after the 12-day urine treatment as shown in
TABLE-US-00009 TABLE 6 Bactericidal activity of paired AMPs coated on polystyrene against E. coli after urine or 10% serum treatment. Bacteria growth of E. coli 23502 (cfu/ml)*.sup.1 Surfactant urine 10% serum in RPMI AMPs (x) 0 day 3 day 6 day 12 day 0 day 1 day 2 day 3 day Control*.sup.2 1.4 × 10.sup.7 3.9 × 10.sup.7 3.2 × 10.sup.7 1.9 × 10.sup.7 3.1 × 10.sup.7 2.7 × 10.sup.7 1.6 × 10.sup.7 2.6 × 10.sup.7 T9W/SAA159 SDS 0 0 1.0 × 10.sup.2 3.0 × 10.sup.3 0 8.7 × 10.sup.3 3.9 × 10.sup.3 1.0 × 10.sup.7 T9W/RRIKA (⅛ + ½) 0 0 1.0 × 10.sup.2 2.6 × 10.sup.4 0 2.0 × 10.sup.2 1.7 × 10.sup.5 1.8 × 10.sup.7 T9W/SAAP159 SDBS 2.0 × 10.sup.6 n.d. n.d. n.d. 3.1 × 10.sup.3 3.9 × 10.sup.2 4.0 × 10.sup.2 7.0 × 10.sup.5 T9W/RRIKA (⅛ + 1) 1.6 × 10.sup.6 1.8 × 10.sup.3 3.7 × 10.sup.4 3.9 × 10.sup.4 1.55 × 10.sup.6 *.sup.1The E. coli ATCC23502 was seeded at 2 × 10.sup.5 cfu/ml. *.sup.2Microplate without coating was used as control.
Example 13 Inhibition of Bacterial Adherence
[0106] To determine this approach's potential application in reducing biomaterial-associated infections in clinics especially in the urinary tract, the adherence of bacteria to silicone which is the major material for human catheter, was evaluated. The adherence of Pseudomonas aeruginosa 27853 to silicone disc was markedly decreased (100-folds reduction) by two AMP pairs (T9W+SAAP159 and T9W+RRIKA) coated by either SDS or SDBS even after a 14-day urine incubation with daily changes of fresh urine (Table 7). These results are in a good agreement with the amount of AMPS that remained on the silicone discs (
TABLE-US-00010 TABLE 7 Anti-adherence activities of paired AMPs on silicone disc against P. aeruginosa 27853 after urine treatment. Bacteria adhered on silicone disc (cfu/disc)* Surfactant Pre-treated with urine AMPs (x) 0 day 3 day 7 day 10 day 14 day Control 3.5 × 10.sup.5 3.5 × 10.sup.5 4.1 × 10.sup.5 7.9 × 10.sup.5 3.5 × 10.sup.5 T9W/SAAP159 SDS 7 × 10.sup.1 1.3 × 10.sup.2 6.7 × 10.sup.3 1.8 × 10.sup.3 4.8 × 10.sup.3 T9W/RRIKA (⅛ + ½) 0 5.1 × 10.sup.2 4.2 × 10.sup.2 2.3 × 10.sup.3 2.6 × 10.sup.3 T9W/SAAP159 SDBS 3.4 × 10.sup.2 4.6 × 10.sup.2 2.3 × 10.sup.3 5.6 × 10.sup.2 1.8 × 10.sup.3 T9W/RRIKA (⅛ + 1) 3.7 × 10.sup.2 2 × 10.sup.1 7.4 × 10.sup.2 8 × 10.sup.1 4.7 × 10.sup.3 *.sup.1The E. coli ATCC23502 was seeded at 2 × 10.sup.5 cfu/ml. *.sup.2Microplate without coating was used as control.
Example 14 Cytotoxic, Hemolytic and Bactericidal Activities of Paired AMPs Coated on Silicone Discs
[0107] The maximal amount of surfactant that may be coated on both sides of silicone discs and released into solution is 14 μg for SDS and 25 μg for SDBS per disc. In 200 μl of assay medium, concentrations up to this maximal amount of SDS and SDBS did not exert bactericidal activity against E. coli 23502 in urine or in 10% FBS, and the SDS (14 μg) exhibited only low cytotoxicity toward human bladder cells (NTUB1) and hemolytic activity toward mouse red blood cells (
[0108] For the combination of the above-mentioned surfactant SDS and paired AMPs that may be coated onto both sides of silicone discs and released as free form, they exerted significant bactericidal activities either in the urine (two- to four-fold dilutions for MIC) or in serum (eight-fold dilution for MIC). These SDS and paired AMPs still exhibited low cytotoxicity (one- to two-fold dilutions for IC.sub.50) and hemolytic activity (one- to two-fold dilutions for IC.sub.50) (
Example 15 Prevention of Urinary Tract Infection by Paired AMPs in a Mouse Model
[0109] The planktonic growth of E. coli 23502 in urine of mice was not significantly reduced (1-10×10.sup.5 cfu/ml) by the silicone tubing which had been coated with T9W+SAAP159 or T9W+RRIKA, in the presence of SDS and implanted in the bladder. Whereas those implanted with silicone tubing coated with T9W-SAAP159 or T9W+RRIKA, in the presence of surfactant SDBS markedly reduced planktonic growth of E. coli 23502 by two- and 10-folds (1-2×10.sup.3 cfu/ml), respectively, at day eight after bacterial instillation. The amount of viable bacteria that adhered on the bladder in the control group and also in the groups coated with T9W-SAAP159 or T9W-RRIKA, in the presence of SDS were not significantly changed at day eight (2-12×10.sup.3 cfu/bladder), whereas the planktonic growth of E. coli 23502 in those groups which had AMP pairs coated in the presence of SDBS were markedly reduced by approximately 100-fold (20 cfu/bladder). Most importantly, the amount of bacteria that adhered to the silicone tubing without coating or to those silicone tubing coated with T9W+SAAP159 and T9W+RRIKA in the presence of SDS were not significantly changed (2-40×10.sup.3 cfu/tubing), whereas no bacteria were found on the tubing coated with either T9W+SAAP159 or T9W+RRIKA in the presence of SDBS (
Example 16 Stability of Paired AMPs Treated by Heat or Ethylene Oxide
[0110] To monitor the potential damages to the coated AMP pairs that are attributed to the sterilization or transportation processes, the stability of T9W+SAAP159 on the microplates coated by SDS or SDBS were examined. No significant change was seen on the stability of these AMPs in urine for seven days after a four-week treatment at 37° C. or 60° C. (