GENE KNOCK-OUTS TO IMPROVE T CELL FUNCTION
20220226380 · 2022-07-21
Assignee
Inventors
- Hongbo CHI (Memphis, TN, US)
- Jun WEI (Memphis, TN, US)
- Terrence GEIGER (Memphis, TN, US)
- Wenting ZHENG (Memphis, TN, US)
Cpc classification
C12N9/22
CHEMISTRY; METALLURGY
A61K35/17
HUMAN NECESSITIES
C07K2319/33
CHEMISTRY; METALLURGY
C12N2800/80
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
A61K48/00
HUMAN NECESSITIES
A61K48/005
HUMAN NECESSITIES
C12N15/1034
CHEMISTRY; METALLURGY
C07K14/4705
CHEMISTRY; METALLURGY
C07K14/70578
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
C12N2310/20
CHEMISTRY; METALLURGY
A61K31/7088
HUMAN NECESSITIES
C12N2740/16043
CHEMISTRY; METALLURGY
A61K38/465
HUMAN NECESSITIES
C12N15/11
CHEMISTRY; METALLURGY
C40B40/02
CHEMISTRY; METALLURGY
C12N2740/15043
CHEMISTRY; METALLURGY
C12Y205/01026
CHEMISTRY; METALLURGY
C12N2740/13043
CHEMISTRY; METALLURGY
C40B40/06
CHEMISTRY; METALLURGY
International classification
A61K35/17
HUMAN NECESSITIES
A61K31/7088
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
C12N15/90
CHEMISTRY; METALLURGY
Abstract
The present application provides methods of enhancing T cell function (e.g., expansion, persistence and/or effector functions), particularly by genetic modification of the Regnase-1, Batf, and additional genes (alone or in combination). The application also provides modified T cells manufactured using the methods provided by this invention and related pharmaceutical compositions. The application further provides methods of using the modified T cells for treating a disease (e.g., a cancer or an infectious disease).
Claims
1. A method of enhancing expansion and/or persistence and/or an anti-tumor function and/or an anti-infection function of a T cell, comprising modifying one or more genes selected from Regnase-1 (REGNASE-1, Zc3h12a, MCPIP1), Ptpn2, Socs1, Agps, Rc3h1, and Rcor1 or gene product(s) thereof in the T cell such that the expression and/or function of said gene(s) or gene product(s) in the T cell is reduced or eliminated.
2-26. (canceled)
27. A modified T cell produced by the method of claim 1.
27-32. (canceled)
33. A pharmaceutical composition comprising the modified T cell of claim 27 and a pharmaceutically acceptable carrier and/or excipient.
34. A method of treating a disease in a subject in need thereof comprising administering to the subject an effective amount of the modified T cells of claim 27 or a pharmaceutical composition comprising said modified T cells and a pharmaceutically acceptable carrier and/or excipient.
35-43. (canceled)
44. A method of enhancing expansion and/or persistence and/or an anti-tumor function and/or an anti-infection function of a T cell, comprising increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
45. The method of claim 44, wherein the T cell is selected from a CD8.sup.+αβ T cell receptor (TCR) T cell, a CD4.sup.+ αβ TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a γϵ T cell.
46-47. (canceled)
48. The method of claim 44, wherein the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR).
49. The method of claim 48, wherein the CAR targets a tumor antigen or an infectious antigen.
50. The method of claim 44, wherein the method comprises introducing into the T cell a polynucleotide encoding a BATF protein, or functional fragment or derivative thereof.
51. The method of claim 50, wherein the polynucleotide encoding a BATF protein comprises the nucleotide sequence of SEQ ID NO: 27, or a nucleotide sequence having at least 80% identity thereof, or wherein the BATF protein encoded by the polynucleotide comprises the amino acid sequence of SEQ ID NO: 25, or an amino acid sequence having at least 80% identity thereof.
52. (canceled)
53. The method of claim 50, wherein the polynucleotide encoding a BATF protein, or functional fragment or derivative thereof, is introduced into the T cell in a recombinant vector.
54. The method of claim 53, wherein the recombinant vector is a viral vector, or a non-viralRNA and/or DNA vector.
55. The method of claim 54, wherein the viral vector is a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated virus vector, an alphaviral vector, a herpes virus vector, or a vaccinia virus vector.
56-57. (canceled)
58. The method of , further comprising claim 44, further comprising modifying one or more additional genes or gene products in the T cell such that the expression and/or function of said additional gene(s) or gene product(s) in said T cell is reduced or eliminated, wherein said additional gene(s) or gene product(s) are selected from Regnase-1 (REGNASE-1, Zc3h12a, MCPIP 1), Ptpn2, Socs 1 , Agps, Rc3h1, and Rcor 1 .
59. (canceled)
60. The method of claim 58, wherein the modifying of one or more additional genes comprises disrupting said gene(s) with a site-specific nuclease, or administering an RNA interference (RNAi) molecule or an antisense oligonuclcotide, or modifying of one or more additional gene products comprising adminstering one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
61. The method of claim 60, wherein the site-specific nuclease comprises a Cas protein and a guide RNA, or a zinc finger nuclease (ZFN), or a TALEN nuclease, or a mega-TALEN nuclease.
62. The method of claim 61, wherein the Cas protein is a Cas9 protein.
63. (canceled)
64. The method of claim 61, wherein the guide RNA comprises TTCACACCATCACGACGCGTNGG (SEQ ID NO: 29), CAGCTCCCTCTAGTCCCGCGNGG (SEQ ID NO: 34), TTCACACCATCACGACGCGT (SEQ ID NO: 36), or CAGCTCCCTCTAGTCCCGCG (SEQ ID NO: 41), or a nucleotide sequence having at least 80% identity thereof.
65-77. (canceled)
78. A modified T cell produced by the method of claim 44.
79-83. (canceled)
84. A pharmaceutical composition comprising the modified T cell of claim 78 and a pharmaceutically acceptable carrier and/or excipient.
85. A method of treating a disease in a subject in need thereof comprising administering to the subject an effective amount of the modified T cells of claim 78 or a pharmaceutical composition comprising said modified T cells and a pharmaceutically acceptable carrier and/or excipient.
86-94. (canceled)
95. A method of improving mitochondrial biogenesis and/or function in a T cell comprising modifying one of more genes selected from Regnase-1 (REGNASE-1, Zc3h12a, MCPIP1), Ptpn2, Socs1, Agps, Rc3h1, and Rcor1 or gene product(s) thereof in the T cell such that the expression and/or function of said gene(s) or gene product(s) in the T cell is reduced or eliminated and/or increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
96. (canceled)
97. An isolated polynucleotide, comprising the nucleotide sequence of any one of SEQ ID NOs: 1-9, 29-34 and 36-42, or a nucleotide sequence having at least 80% identity thereof.
98-140. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0063] U.S. Provisional Application Nos. 62/838,060 and 62/912,231 contain copies of several of the drawing(s) below in color, which can be provided by the United States Patent and Trademark Office upon request and payment of the necessary fee.
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
DETAILED DESCRIPTION
[0097] The present invention generally provides methods for enhancing expansion and/or persistence and/or effector function (e.g., an anti-tumor or an anti-infection function) of T cells. The present invention also provides modified T cells with enhanced expansion and/or persistence and/or effector function (e.g., an anti-tumor or an anti-infection function), as well as pharmaceutical compositions comprising such modified T cells. The present invention further provides methods of using such modified T cells to treat a disease (e.g., cancer or infectious disease) in a subject.
[0098] T cells undergo extensive metabolic programing during differentiation and in adaptation to different contexts. T cell longevity and function in cancer immunotherapy have been proposed to be closely correlated with cell metabolic fitness.sup.13,14, although the underlying molecular mechanisms are unclear. The present invention is based on an unexpected discovery that Regnase-1 (also known as Zc3h12a or MCPIP1) is a major negative regulator of antitumor responses, whose deficiency results in drastically increased CD8.sup.+ T cell accumulation in tumors. Data in support of these findings is presented in the Examples section, below. For instance, it was demonstrated that Regnase-1 deficient CD8.sup.+ T cells are long-lived effector cells with extensive accumulation, better persistence and robust effector function in tumors. Surprisingly, Regnase-1-deficient CD8.sup.+ T cells show profoundly improved therapeutic efficacy in mouse melanoma and leukemia tumor models. Regnase-1-deficient CD8.sup.+ T cells are reprogrammed specifically in tumor microenvironment (TME) to acquire naive/memory cell-associated gene signatures for better persistence and survival advantage, but also retain high-level expression of effector molecules such as IFN-y and granzyme B.
[0099] The present invention is also based on another unexpected discovery that BATF is a key functional target of Regnase-1 in reprogramming antitumor responses of CD8.sup.+ T cells. As detailed in the Examples section below, through a secondary in vivo genome-scale CRISPR-Cas9 screening, BATF was identified as the key target of Regnase-1 and a rheostat in shaping antitumor responses. Loss of BATF suppresses the elevated accumulation and mitochondrial fitness of Regnase-1-deficient CD8.sup.+ T cells. Moreover, genome-scale CRISPR-Cas9 screening also identifies additional genes, such as Ptpn2, Socs1 and Rc3h1, that could be targeted alone or in combination with Regnase-1 and/or Batf to further improve T-cell based therapy.
Definitions
[0100] The terms “T cell” and “T lymphocyte” are interchangeable and used synonymously herein. As used herein, T cell includes thymocytes, naive T lymphocytes, immature T lymphocytes, mature T lymphocytes, resting T lymphocytes, or activated T lymphocytes. A T cell can be a T helper (Th) cell, for example a T helper 1 (Thl), a T helper 2 (Th2) cell, a T helper 17 (Th17) or regulatory T (Treg) cell. The T cell can be a T helper cell (Th; CD4.sup.+ T cell) CD4.sup.+ T cell, a cytotoxic T cell (CTL; CD8.sup.+ T cell), a tumor infiltrating cytotoxic T cell (TIL; CD8.sup.+ T cell), CD4.sup.+ CD8.sup.+ T cell, or any other subset of T cells. Other illustrative populations of T cells suitable for use in particular embodiments include naive T cells and memory T cells. Also included are “NKT cells”, which refer to a specialized population of T cells that express a semi-invariant αβ T-cell receptor, but also express a variety of molecular markers that are typically associated with NK cells, such as NK1.1. NKT cells include NK1.1.sup.+ and NK1.1.sup.−, as well as CD4.sup.+, CD4.sup.−, CD8.sup.+and CD8.sup.− cells. The TCR on NKT cells is unique in that it recognizes glycolipid antigens presented by the MEW I-like molecule CD Id. NKT cells can have either protective or deleterious effects due to their abilities to produce cytokines that promote either inflammation or immune tolerance. Also included are “gamma-delta T cells (γϵ T cells),” which refer to a specialized population that to a small subset of T cells possessing a distinct TCR on their surface, and unlike the majority of T cells in which the TCR is composed of two glycoprotein chains designated α- and β TCR chains, the TCR in γϵ T cells is made up of a γ-chain and a δ-chain. γϵ T cells can play a role in immunosurveillance and immunoregulation, and were found to be an important source of IL-17 and to induce robust CDS.sup.+cytotoxic T cell response. Also included are “regulatory T cells” or “Tregs” refers to T cells that suppress an abnormal or excessive immune response and play a role in immune tolerance. Tregs cells are typically transcription factor Foxp3-positive CD4.sup.+ T cells and can also include transcription factor Foxp3-negative regulatory T cells that are IL-10-producing CD4.sup.+ T cells.
[0101] The terms “natural killer cell” and “NK cell” are used interchangeable and used synonymously herein. As used herein, NK cell refers to a differentiated lymphocyte with a CD 16.sup.+ CD56.sup.+and/or CD57.sup.+ TCR- phenotype. NKs are characterized by their ability to bind to and kill cells that fail to express “self” MHC/HLA antigens by the activation of specific cytolytic enzymes, the ability to kill tumor cells or other diseased cells that express a ligand for NK activating receptors, and the ability to release protein molecules called cytokines that stimulate or inhibit the immune response.
[0102] The term “chimeric antigen receptor” or “CAR” as used herein is defined as a cell-surface receptor comprising an extracellular target-binding domain, a transmembrane domain and a cytoplasmic domain, comprisilng a lymphocyte activation domain and optionally at least one co-stimulatory signaling domain, all in a combination that is not naturally found together on a single protein. This particularly includes receptors wherein the extracellular domain and the cytoplasmic domain are not naturally found together on a single receptor protein. The chimeric antigen receptors of the present invention are intended primarily for use with lymphocyte such as T cells and natural killer (NK) cells.
[0103] As used herein, the term “antigen” refers to any agent (e.g., protein, peptide, polysaccharide, glycoprotein, glycolipid, nucleic acid, portions thereof, or combinations thereof) molecule capable of being bound by a T-cell receptor. An antigen is also able to provoke an immune response. An example of an immune response may involve, without limitation, antibody production, or the activation of specific immunologically competent cells, or both. A skilled artisan will understand that an antigen need not be encoded by a “gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample, or might be macromolecule besides a polypeptide. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components, organisms, subunits of proteins/antigens, killed or inactivated whole cells or lysates.
[0104] The term “antigen-binding moiety” refers to a target-specific binding element that may be any ligand that binds to the antigen of interest or a polypeptide or fragment thereof, wherein the ligand is either naturally derived or synthetic. Examples of antigen-binding moieties include, but are not limited to, antibodies; polypeptides derived from antibodies, such as, for example, single chain variable fragments (scFv), Fab, Fab′, F(ab′)2, and Fv fragments; polypeptides derived from T Cell receptors, such as, for example, TCR variable domains; secreted factors (e.g., cytokines, growth factors) that can be artificially fused to signaling domains; and any ligand or receptor fragment (e.g., CD27, NKG2D) that binds to the antigen of interest. Combinatorial libraries could also be used to identify peptides binding with high affinity to the therapeutic target.
[0105] Terms “antibody” and “antibodies” refer to monoclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, chimeric antibodies, single-chain Fvs (scFv), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), intrabodies, minibodies, diabodies and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antigen-specific TCR), and epitope-binding fragments of any of the above. The terms “antibody” and “antibodies” also refer to covalent diabodies such as those disclosed in U.S. Pat. Appl. Pub. 2007/0004909 and Ig-DARTS such as those disclosed in U.S. Pat. Appl. Pub. 2009/0060910. Antibodies useful as a TCR-binding molecule include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an antigen-binding site. Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgMl, IgM2, IgA1 and IgA2) or subclass.
[0106] The terms “activation” or “stimulation” means to induce a change in their biologic state by which the cells (e.g., T cells and NK cells) express activation markers, produce cytokines, proliferate and/or become cytotoxic to target cells. All these changes can be produced by primary stimulatory signals. Co-stimulatory signals can amplify the magnitude of the primary signals and suppress cell death following initial stimulation resulting in a more durable activation state and thus a higher cytotoxic capacity. A “co-stimulatory signal” refers to a signal, which in combination with a primary signal, such as TCR/CD3 ligation, leads to T cell and/or NK cell proliferation and/or upregulation or downregulation of key molecules.
[0107] The term “proliferation” refers to an increase in cell division, either symmetric or asymmetric division of cells. The term “expansion” refers to the outcome of cell division and cell death.
[0108] The term “differentiation” refers to a method of decreasing the potency or proliferation of a cell or moving the cell to a more developmentally restricted state.
[0109] The terms “express” and “expression” mean allowing or causing the information in a gene or DNA sequence to become produced, for example producing a protein by activating the cellular functions involved in transcription and translation of a corresponding gene or DNA sequence. A DNA sequence is expressed in or by a cell to form an “expression product” such as a protein. The expression product itself, e.g., the resulting protein, may also be said to be “expressed” by the cell. An expression product can be characterized as intracellular, extracellular or transmembrane.
[0110] The term “transfection” means the introduction of a “foreign” (i.e., extrinsic or extracellular) nucleic acid into a cell using recombinant DNA technology. The term “genetic modification” means the introduction of a “foreign” (i.e., extrinsic or extracellular) gene, DNA or RNA sequence to a host cell, so that the host cell will express the introduced gene or sequence to produce a desired substance, typically a protein or enzyme coded by the introduced gene or sequence. The introduced gene or sequence may also be called a “cloned” or “foreign” gene or sequence, may include regulatory or control sequences operably linked to polynucleotide encoding the chimeric antigen receptor, such as start, stop, promoter, signal, secretion, or other sequences used by a cell's genetic machinery. The gene or sequence may include nonfunctional sequences or sequences with no known function. A host cell that receives and expresses introduced DNA or RNA has been “genetically engineered.” The DNA or RNA introduced to a host cell can come from any source, including cells of the same genus or species as the host cell, or from a different genus or species.
[0111] The term “transduction” means the introduction of a foreign nucleic acid into a cell using a viral vector.
[0112] The terms “genetically modified” or “genetically engineered” refers to the addition of extra genetic material in the form of DNA or RNA into a cell.
[0113] As used herein, the term “derivative” in the context of proteins or polypeptides (e.g., CAR constructs or domains thereof) refer to: (a) a polypeptide that has at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 99.5% sequence identity to the polypeptide it is a derivative of; (b) a polypeptide encoded by a nucleotide sequence that has at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 99.5% sequence identity to a nucleotide sequence encoding the polypeptide it is a derivative of; (c) a polypeptide that contains 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acid mutations (i.e., additions, deletions and/or substitutions) relative to the polypeptide it is a derivative of (d) a polypeptide encoded by nucleic acids can hybridize under high, moderate or typical stringency hybridization conditions to nucleic acids encoding the polypeptide it is a derivative of; (e) a polypeptide encoded by a nucleotide sequence that can hybridize under high, moderate or typical stringency hybridization conditions to a nucleotide sequence encoding a fragment of the polypeptide, it is a derivative of, of at least 20 contiguous amino acids, at least 30 contiguous amino acids, at least 40 contiguous amino acids, at least 50 contiguous amino acids, at least 75 contiguous amino acids, at least 100 contiguous amino acids, at least 125 contiguous amino acids, or at least 150 contiguous amino acids; or (f) a fragment of the polypeptide it is a derivative of.
[0114] The term “functional fragment” or “functional derivative” as used herein refers to a fragment or derivative of the polypeptide or protein, or a polynucleotide encoding the polypeptide or protein, that retains at least one function of the full-length polypeptide or protein, or the polypeptide or protein it is a derivative of A functional fragment may comprise an amino acid sequence of at least 5 contiguous amino acid residues, at least 6 contiguous amino acid residues, at least 7 contiguous amino acid residues, at least 8 contiguous amino acid residues, at least 9 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 11 contiguous amino acid residues, at least 12 contiguous amino acid residues, at least 13 contiguous amino acid residues, at least 14 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least contiguous 80 amino acid residues, at least contiguous 90 amino acid residues, at least contiguous 100 amino acid residues, at least contiguous 125 amino acid residues, at least 150 contiguous amino acid residues, at least contiguous 175 amino acid residues, at least contiguous 200 amino acid residues, or at least contiguous 250 amino acid residues of the amino acid sequence of the full-length polypeptide or protein. The functional fragment or functional derivative of a polypeptide or protein may retain one, two, three, four, five, or more functions of the full-length polypeptide or protein, or the polypeptide or protein it is a derivative of.
[0115] Percent sequence identity can be determined using any method known to one of skill in the art. In a specific embodiment, the percent identity is determined using the “Best Fit” or “Gap” program of the Sequence Analysis Software Package (Version 10; Genetics Computer Group, Inc., University of Wisconsin Biotechnology Center, Madison, Wisconsin). Information regarding hybridization conditions (e.g., high, moderate, and typical stringency conditions) have been described, see, e.g., U.S. Patent Application Publication No. US 2005/0048549 (e.g., paragraphs 72-73).
[0116] The terms “vector”, “cloning vector” and “expression vector” mean the vehicle by which a DNA or RNA sequence (e.g., a foreign gene) can be introduced into a host cell, so as to genetically modify the host and promote expression (e.g., transcription and translation) of the introduced sequence. Vectors include plasmids, synthesized RNA and DNA molecules, phages, viruses, etc. In certain embodiments, the vector is a viral vector such as, but not limited to, viral vector is an adenoviral, adeno-associated, alphaviral, herpes, lentiviral, retroviral, or vaccinia vector.
[0117] The term “regulatory element” refers to any cis-acting genetic element that controls some aspect of the expression of nucleic acid sequences. In some embodiments, the term “promoter” comprises essentially the minimal sequences required to initiate transcription. In some embodiments, the term “promoter” includes the sequences to start transcription, and in addition, also include sequences that can upregulate or downregulate transcription, commonly termed “enhancer elements” and “repressor elements”, respectively.
[0118] As used herein, the term “operatively linked,” and similar phrases, when used in reference to nucleic acids or amino acids, refer to the operational linkage of nucleic acid sequences or amino acid sequence, respectively, placed in functional relationships with each other. For example, an operatively linked promoter, enhancer elements, open reading frame, 5′ and 3′ UTR, and terminator sequences result in the accurate production of a nucleic acid molecule (e.g., RNA). In some embodiments, operatively linked nucleic acid elements result in the transcription of an open reading frame and ultimately the production of a polypeptide (i.e., expression of the open reading frame). As another example, an operatively linked peptide is one in which the functional domains are placed with appropriate distance from each other to impart the intended function of each domain.
[0119] The terms “enhance” or “promote” or “increase” or “expand” or “improve” refer generally to the ability of a composition contemplated herein to produce, elicit, or cause a greater physiological response (i.e., downstream effects) compared to the response caused by either vehicle or a control molecule/composition. A measurable physiological response may include an increase in T cell expansion, activation, effector function, persistence, and/or an increase in cancer cell death killing ability, among others apparent from the understanding in the art and the description herein. In certain embodiments, an “increased” or “enhanced” amount can be a “statistically significant” amount, and may include an increase that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response produced by vehicle or a control composition.
[0120] The terms “decrease” or “lower,” or “lessen,” or “reduce,” or “abate” refer generally to the ability of composition contemplated herein to produce, elicit, or cause a lesser physiological response (i.e., downstream effects) compared to the response caused by either vehicle or a control molecule/composition. In certain embodiments, a “decrease” or “reduced” amount can be a “statistically significant” amount, and may include a decrease that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response (reference response) produced by vehicle, a control composition, or the response in a particular cell lineage.
[0121] The terms “treat” or “treatment” of a state, disorder or condition include: (1) preventing, delaying, or reducing the incidence and/or likelihood of the appearance of at least one clinical or sub-clinical symptom of the state, disorder or condition developing in a subject that may be afflicted with or predisposed to the state, disorder or condition, but does not yet experience or display clinical or subclinical symptoms of the state, disorder or condition; or (2) inhibiting the state, disorder or condition, i.e., arresting, reducing or delaying the development of the disease or a relapse thereof or at least one clinical or sub-clinical symptom thereof; or (3) relieving the disease, i.e., causing regression of the state, disorder or condition or at least one of its clinical or sub-clinical symptoms. The benefit to a subject to be treated is either statistically significant or at least perceptible to the patient or to the physician.
[0122] The term “effective” applied to dose or amount refers to that quantity of a compound or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a subject in need thereof. Note that when a combination of active ingredients is administered, the effective amount of the combination may or may not include amounts of each ingredient that would have been effective if administered individually. The exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the condition being treated, the particular drug or drugs employed, the mode of administration, and the like.
[0123] The phrase “pharmaceutically acceptable”, as used in connection with compositions described herein, refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to a mammal (e.g., a human). Preferably, the term “pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans.
[0124] The term “protein” is used herein encompasses all kinds of naturally occurring and synthetic proteins, including protein fragments of all lengths, fusion proteins and modified proteins, including without limitation, glycoproteins, as well as all other types of modified proteins (e.g., proteins resulting from phosphorylation, acetylation, myristoylation, palmitoylation, glycosylation, oxidation, formylation, amidation, polyglutamylation, ADP-ribosylation pegylation, biotinylation, etc.).
[0125] The terms “nucleic acid”, “nucleotide”, and “polynucleotide” encompass both DNA and RNA unless specified otherwise. By a “nucleic acid sequence” or “nucleotide sequence” is meant the nucleic acid sequence encoding an amino acid, the term may also refer to the nucleic acid sequence including the portion coding for any amino acids added as an artifact of cloning, including any amino acids coded for by linkers
[0126] The terms “patient”, “individual”, “subject”, and “animal” are used interchangeably herein and refer to mammals, including, without limitation, human and veterinary animals (e.g., cats, dogs, cows, horses, sheep, pigs, etc.) and experimental animal models. In a preferred embodiment, the subject is a human.
[0127] The term “carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions. Alternatively, the carrier can be a solid dosage form carrier, including but not limited to one or more of a binder (for compressed pills), a glidant, an encapsulating agent, a flavorant, and a colorant. Suitable pharmaceutical carriers are described in “Remington' s Pharmaceutical Sciences” by E. W. Martin.
[0128] Singular forms “a”, “an”, and “the” include plural references unless the context clearly dictates otherwise. Thus, for example, a reference to “a method” includes one or more methods, and/or steps of the type described herein and/or which will become apparent to those persons skilled in the art upon reading this disclosure.
[0129] The term “about” or “approximately” includes being within a statistically meaningful range of a value. Such a range can be within an order of magnitude, preferably within 50%, more preferably within 20%, still more preferably within 10%, and even more preferably within 5% of a given value or range. The allowable variation encompassed by the term “about” or “approximately” depends on the particular system under study, and can be readily appreciated by one of ordinary skill in the art.
[0130] The practice of the present invention employs, unless otherwise indicated, conventional techniques of statistical analysis, molecular biology (including recombinant techniques), microbiology, cell biology, and biochemistry, which are within the skill of the art. Such tools and techniques are described in detail in e.g., Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual. 3rd ed. Cold Spring Harbor Laboratory Press: Cold Spring Harbor, New York; Ausubel et al. eds. (2005) Current Protocols in Molecular Biology. John Wiley and Sons, Inc.: Hoboken, N J; Bonifacino et al. eds. (2005) Current Protocols in Cell Biology. John Wiley and Sons, Inc.: Hoboken, N J; Coligan et al. eds. (2005) Current Protocols in Immunology, John Wiley and Sons, Inc.: Hoboken, N J; Coico et al. eds. (2005) Current Protocols in Microbiology, John Wiley and Sons, Inc.: Hoboken, N J; Coligan et al. eds. (2005) Current Protocols in Protein Science, John Wiley and Sons, Inc.: Hoboken, N J; and Enna et al. eds. (2005) Current Protocols in Pharmacology, John Wiley and Sons, Inc.: Hoboken, N J. Additional techniques are explained, e.g., in U.S. Pat. No. 7,912,698 and U.S. Patent Appl. Pub. Nos. 2011/0202322 and 2011/0307437.
[0131] The technology illustratively described herein suitably may be practiced in the absence of any element(s) not specifically disclosed herein.
[0132] The terms and expressions which have been employed are used as terms of description and not of limitation, and use of such terms and expressions do not exclude any equivalents of the features shown and described or portions thereof, and various modifications are possible within the scope of the technology claimed.
Methods of Enhancing T Cell Function
[0133] In one aspect, the present disclosure provides a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell. The method includes modifying a Regnase-1 gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated.
[0134] The terms “expand” or “expansion” when used in relation to a T cell refer to the ability of the T cell to undergo cellular proliferation (i.e., to increase the number of cells). The terms used herein encompass both in vivo and in vitro T cell expansion.
[0135] The terms “persist” or “persistence” when used in relation to a T cell refer to the ability of the T cell (and/or its progenies) to be maintained in a recipient (e.g., a subject) for a period of time. The terms used herein encompass both in vivo and in vitro T cell persistence.
[0136] The term “anti-tumor function” as used herein refers to the ability of a T cell to inhibit tumor growth and/or to kill the tumor cells (cancer cells).
[0137] The term “anti-infection function” as used herein refers to the ability of a T cell to inhibit the growth of a pathogen or a population of pathogens and/or kill a pathogen or a population of pathogens. A pathogen may be a virus, a bacterium, a fungus, a parasite, or a prion, or the like.
[0138] Regnase-1, also known as Zc3h12a or MCPIP1, is an RNase that destabilizes a set of mRNAs, through cleavage of their 3′ untranslated regions (UTRs). The Regnase-1 gene has NCBI gene IDs of 80149 (human) and 230738 (mouse). As described in the Examples section below, Regnase-1 was identified as a major regulator of T cell effector responses, whose deficiency can cause reprogramming of T cells (specifically in the TME), resulting in markedly improved therapeutic efficacy. While not wishing to be bound by theory, Regnase-1 may function after initial T cell activation.sup.15,16 to enable precise temporal and spatial control of effector T cell responses. Further, Regnase-1 may restrain mitochondrial oxidative metabolism to limit effector T cell responses in tumor immunity, and function through a gene target BATF (
[0139] T cells that may be used in the present disclosure include, but are not limited to, thymocytes, naive T lymphocytes, immature T lymphocytes, mature T lymphocytes, resting T lymphocytes, or activated T lymphocytes. A T cell can be a T helper (Th) cell, for example a T helper 1 (Th1) or a T helper 2 (Th2) cell. The T cell can be a helper T cell (HTL; CD4.sup.+ T cell) CD4.sup.+ T cell, a cytotoxic T cell (CTL; CD8.sup.+ T cell), a tumor infiltrating cytotoxic T cell (TIL; CD8.sup.+ T cell), CD4.sup.+ CD8.sup.+ T cell, or any other subset of T cells. Other illustrative populations of T cells suitable for use in particular embodiments include naive T cells memory T cells, and NKT cells.
[0140] In some embodiments, the T cell a CD8.sup.+ αβ T cell receptor (TCR) T cell, a CD4.sup.+ αβ TCR T cell, a regulatory T cell (Treg), a natural killer T (NKT) cell, or a γϵ T cell. In a specific embodiment, the T cell is a CD8.sup.+ αβ TCR T cell. In another specific embodiment, the T cell is a CD4.sup.+ αβ TCR T cell. In a specific embodiment, the T cell is a regulatory T cell (Treg). The T cell may have the ability to target a tumor antigen or an infectious antigen.
[0141] T cells may be further engineered to express a T cell receptor or a chimeric antigen receptor (CAR). The T cell receptor or CAR may have an antigen-binding moiety that is capable of targeting a tumor antigen or an infectious antigen.
[0142] Non-limiting examples of tumor antigens that may be targeted by the modified T cell described herein include human epidermal growth factor receptor 2 (HER2), interleukin-13 receptor subunit alpha-2 (IL-13Ra2), ephrin type-A receptor 2 (EphA2), A kinase anchor protein 4 (AKAP-4), adrenoceptor beta 3 (ADRB3), anaplastic lymphoma kinase (ALK), immunoglobulin lambda- like polypeptide 1 (IGLL1), androgen receptor, angiopoietin-binding cell surface receptor 2 (Tie 2), B7H3 (CD276), bone marrow stromal cell antigen 2 (BST2), carbonic anhydrase IX (CAIX), CCCTC-binding factor (Zinc Finger Protein)-like (BORIS), CD171, CD179a, CD24, CD300 molecule-like family member f (CD300LF), CD38, CD44v6, CD72, CD79a, CD79b, CD97, chromosome X open reading frame 61 (CXORF61), claudin 6 (CLDN6), CS-1 (CD2 subset 1, CRACC, SLAMF7, CD319, or 19A24), C-type lectin domain family 12 member A (CLEC12A), C-type lectin-like molecule-1 (CLL-1), Cyclin B 1, Cytochrome P450 1B 1 (CYP1B 1), EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2), epidermal growth factor receptor (EGFR), ERG (transmembrane protease, serine 2 (T1VIPRSS2) ETS fusion gene), ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML), Fc fragment of IgA receptor (FCAR), Fc receptor-like 5 (FCRLS), Fms-like tyrosine kinase 3 (FLT3), Folate receptor beta, Fos-related antigen 1, Fucosyl GM1, G protein-coupled receptor 20 (GPR20), G protein-coupled receptor class C group 5, member D (GPRCSD), ganglioside GD3, ganglioside GM3, glycoceramide (GloboH), Glypican-3 (GPC3), Hepatitis A virus cellular receptor 1 (HAVCR1), hexasaccharide portion of globoH, high molecular weight-melanoma-associated antigen (HMWMAA), human Telomerase reverse transcriptase (hTERT), interleukin 11 receptor alpha (IL-11Ra), KIT (CD117), leukocyte-associated immunoglobulin-like receptor 1 (LAIR1), leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2), Lewis(Y) antigen, lymphocyte antigen 6 complex, locus K 9 (LY6K), lymphocyte antigen 75 (LY75), lymphocyte-specific protein tyrosine kinase (LCK), mammary gland differentiation antigen (NY-BR-1), melanoma cancer testis antigen-1 (MAD-CT-1), melanoma cancer testis antigen-2 (MAD-CT-2), melanoma inhibitor of apoptosis (ML-IAP), mucin 1, cell surface associated (MUC1), N-acetyl glucosaminyl-transferase V (NA17), neural cell adhesion molecule (NCAM), o-acetyl-GD2 ganglioside (OAcGD2), olfactory receptor 51E2 (OR51E2), p53 mutant, paired box protein Pax-3 (PAX3), paired box protein Pax-5 (PAXS), pannexin 3 (PANX3), placenta-specific 1 (PLAC1), platelet-derived growth factor receptor beta (PDGFR-beta), Polysialic acid, proacrosin binding protein sp32 (OY-TES 1), prostate stem cell antigen (PSCA), Protease Serine 21 (PRSS21), Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2), Ras Homolog Family Member C (RhoC), sarcoma translocation breakpoints, sialyl Lewis adhesion molecule (sLe), sperm protein 17 (SPA17), squamous cell carcinoma antigen recognized by T cells 3 (SART3), stage-specific embryonic antigen-4 (SSEA-4), synovial sarcoma, X breakpoint 2 (SSX2), TCR gamma alternate reading frame protein (TARP), TGS5, thyroid stimulating hormone receptor (TSHR), Tn antigen (Tn Ag), tumor endothelial marker 1 (TEM1/CD248), tumor endothelial marker 7-related (TEM7R), uroplakin 2 (UPK2), vascular endothelial growth factor receptor 2 (VEGFR2), v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN), Wilms tumor protein (WT1), and X Antigen Family, Member 1A (XAGE1), or a fragment or variant thereof.
[0143] Additional antigens that may be targeted by the modified T cell described herein include, but are not limited to, carbonic anhydrase EX, alpha-fetoprotein, A3, antigen specific for A33 antibody, Ba 733, BrE3-antigen, CA125, CD1, CD1a, CD3, CDS, CD15, CD16, CD19, CD20, CD21, CD22, CD23, CD25, CD30, CD33, CD38, CD45, CD74, CD79a, CD80, CD138, colon-specific antigen-p (CSAp), CEA (CEACAMS), CEACAM6, CSAp, EGFR, EGP-I, EGP-2, Ep-CAM, EphAl, EphA3, EphA4, EphA5, EphA6, EphA7, EphA8, EphAl 0, EphB1, EphB2, EphB3, EphB4, EphB6, FIt-I, Flt-3, folate receptor, HLA-DR, human chorionic gonadotropin (HCG) and its subunits, hypoxia inducible factor (HIF-I), Ia, IL-2, IL-6, IL-8, insulin growth factor-1 (IGF-I), KC4-antigen, KS-1-antigen, KS1-4, Le-Y, macrophage inhibition factor (MIF), MAGE, MUC1, MUC2, MUC3, MUC4, NCA66, NCA95, NCA90, antigen specific for PAM-4 antibody, placental growth factor, p53, prostatic acid phosphatase, PSA, PSMA, RS5, S100, TAC, TAG-72, tenascin, TRAIL receptors, Tn antigen, Thomson-Friedenreich antigens, tumor necrosis antigens, VEGF, ED-B fibronectin, 17-1A-antigen, an angiogenesis marker, an oncogene marker or an oncogene product.
[0144] An infectious antigen may be a viral antigen, a bacterial antigen, a fungal antigen, a parasite antigen, or a prion antigen, or the like. Infectious antigens include the intact microorganism (e.g., virus, bacterium, fungus) as well as natural isolates and fragments or derivatives thereof and also synthetic or recombinant compounds which are identical to or similar to natural microorganism antigens and induce an immune response specific for that microorganism (e.g., virus, bacterium, fungus). A compound is similar to a natural microorganism antigen if it induces an immune response (humoral and/or cellular) to a natural microorganism antigen. Such antigens are used routinely in the art and are well known to the skilled artisan.
[0145] An infectious antigen may be an infectious virus or derived from an infectious virus. Non-limiting examples of infectious viruses that have been found in humans include but are not limited to: Adenoviridae (most adenoviruses); Arena viridae (hemorrhagic fever viruses); Birnaviridae; Bungaviridae (e.g., Hantaan viruses, bunga viruses, phleboviruses and Nairo viruses); Calciviridae (e.g., strains that cause gastroenteritis); Coronoviridae (e.g., coronaviruses); Filoviridae (e.g., ebola viruses); Flaviridae (e.g., dengue viruses, encephalitis viruses, yellow fever viruses); Hepadnaviridae (Hepatitis B virus); Herpesviridae (herpes simplex virus (HSV) 1 and 2, varicella zoster virus, cytomegalovirus (CMV), herpes virus); Iridoviridae (e.g., African swine fever virus); Norwalk and related viruses, and astroviruses.; Orthomyxoviridae (e.g., influenza viruses); Papovaviridae (papilloma viruses, polyoma viruses); Paramyxoviridae (e.g., parainfluenza viruses, mumps virus, measles virus, respiratory syncytial virus); Parvovirida (parvoviruses); Picornaviridae (e.g., polio viruses, hepatitis A virus; enteroviruses, human Coxsackie viruses, rhinoviruses, echoviruses); Poxviridae (variola viruses, vaccinia viruses, pox viruses); Reoviridae (e.g., reoviruses, orbiviurses and rotaviruses); Retroviridae (e.g., human immunodeficiency viruses, such as HIV-1 (also referred to as HTLV-III, LAV or HTLV-III/LAV, or HIV-III); and other isolates, such as HIV-LP); Rhabdoviradae (e.g., vesicular stomatitis viruses, rabies viruses); Togaviridae (e.g., equine encephalitis viruses, rubella viruses); and unclassified viruses (e.g., the etiological agents of Spongiform encephalopathies, the agent of delta hepatitis, the agents of non-A, non-B hepatitis (class 1=internally transmitted; class 2=parenterally transmitted (i.e. Hepatitis C)).
[0146] An infectious antigen may be an infectious bacterium or derived from an infectious bacterium. Both gram negative and gram positive bacteria can serve as antigens in vertebrate animals. Such gram positive bacteria include, but are not limited to, Pasteurella species, Staphylococci species and Streptococcus species. Grain negative bacteria include, but are not limited to, Escherichia coli, Pseudomonas species, and Salmonella species. Non-limiting examples of infectious bacteria include but are not limited to: Actinomyces israelli, Bacillus antracis, Bacteroides sp., Borelia burgdorferi, Chlamydia., Clostridium perfringens, Clostridium tetani, Corynebacterium diphtherias, Corynebacterium sp., Enterobacter aerogenes, Enterococcus sp., Erysipelothrix rhusiopathiae, Fusobacterium nucleatum, Haemophilus influenzae, Helicobacter pyloris, Klebsiella pneumoniae, Legionella pneumophilia, Leptospira, Listeria monocytogenes, Mycobacteria sps. (e.g., M tuberculosis, M avium, M gordonae, M intracellulare, M kansaii), Neisseria gonorrhoeae, Neisseria meningitidis, Pasturella multocida, pathogenic Campylobacter sp., Rickettsia, Staphylococcus aureus, Streptobacillus monihformis, Streptococcus (anaerobic sps.), Streptococcus (viridans group), Streptococcus agalactiae (Group B Streptococcus), Streptococcus bovis, Streptococcus faecalis, Streptococcus pneumoniae, Streptococcus pyogenes (Group A Streptococcus), Treponema pallidium, and Treponema pertenue.
[0147] An infectious antigen may be or derived from other infectious microorganisms. Non-limiting examples of infectious fungi include Cryptococcus neoformans, Histoplasma capsulatuin, Coccidioides immitis, Blastomyces dernatitidis, Chlamydia trachomatis and Candida albicans. Other infectious organisms (i.e., protists) include: Plasmodium such as Plasmodium falciparum, Plasmodium malariae, Plasmodium ovale, Plasmodium vivax, Toxoplasma gondii and Shistosoma. Other medically relevant microorganisms have been descried extensively in the literature, e.g., see C. G. A. Thomas, “Medical Microbiology”, Bailliere Tindall, Great Britain 1983, which is hereby incorporated by reference in its entirety.
[0148] Other non-limiting examples of infectious antigens include viral antigens such as HIV antigens (e.g., gp120, gp160, p18, Tat, Gag, Pol, Env, Nef), glycoprotein from Herpesvirus, and surface antigen and core antigen from Hepatitis B virus; bacterial antigens such as OspA, OspB and OspC antigens from Borrelia sp; fungal and parasite antigens such as MP65 from Candida albicans and CS protein from Plasmodium sp.
[0149] In some embodiments, modifying the Regnase-1 gene and/or gene product in the T cell improves in vivo accumulation of the T cell. In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 10-fold as compared an unmodified T cell measured at day 7 after the Regnase-1 modification. In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 10-fold, about 30-fold, about 50-fold, about 70-fold, about 90-fold, about 100-fold, about 110-fold, about 120-fold, about 130-fold, about 140-fold, about 150-fold, about 160-fold, about 180-fold, about 200-fold, about 230-fold, about 250-fold or more as compared an unmodified T cell measured at day 7 after the Regnase-1 modification.
[0150] In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 100-fold as compared an unmodified T cell measured at day 14 after the Regnase-1 modification. In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 100-fold, about 200-fold, about 300-fold, about 400-fold, about 500-fold, about 550-fold, about 600-fold, about 650-fold, about 670-fold, about 690-fold, about 700-fold, about 710-fold, about 720-fold, about 730-fold, about 740-fold, about 750-fold, about 760-fold, about 770-fold, about 780-fold, about 790-fold, about 800-fold, about 900-fold, about 1000-fold or more as compared an unmodified T cell measured at day 14 after the Regnase-1 modification.
[0151] In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 1000-fold as compared an unmodified T cell measured at day 21 after the Regnase-1 modification. In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 1000-fold, about 1100-fold, about 1200-fold, about 1300-fold, about 1400-fold, about 1500-fold, about 1600-fold, about 1700-fold, about 1800-fold, about 1900-fold, about 2000-fold, about 2100-fold, about 2200-fold, about 2300-fold, about 2350-fold, about 2400-fold, about 2500-fold, about 2550-fold, about 2600-fold, about 2700-fold, about 2800-fold, about 2900-fold, about 3000-fold, or more as compared an unmodified T cell measured at day 14 after the Regnase-1 modification.
[0152] In addition to Regnase-1, additional gene(s) or gene product(s) in the T cell may be modified alone or in combination with Regnase-1 to enhance expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell. Additional genes or gene products that may be modified can be selected from Ptpn2, Socs1, Agps, Rc3h1, and Rcor1. Other suitable genes or gene products that may be modified include Ireb2, Vtila, or Pex13. Additional suitable genes or gene products that may be modified include those listed in Table 1. Modifying one or more of such genes or gene products in addition to Regnase-1 may have synergetic or additive effects in enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell.
[0153] Ptpn2 has NCBI gene IDs of 5771 (human) and 19255 (mouse). Socs1 has NCBI gene IDs of 8651 (human) and 12703 (mouse). Agps has NCBI gene IDs of 8540 (human) and 228061 (mouse). Rc3h1 (Roquin-1) has NCBI gene IDs of 149041 (human) and 381305 (mouse). Rcor1 has NCBI gene IDs of 23186 (human) and 217864 (mouse). Ireb2 has NCBI gene IDs of 3658 (human) and 64602 (mouse). Vtila has NCBI gene IDs of 143187 (human) and 53611 (mouse). Pex13 has NCBI gene IDs of 5194 (human) and 72129 (mouse).
[0154] In some embodiments, the Regnase-1 gene and/or any additional gene(s) (e.g., Ptpn2, Socs1, Agps, Rc3h1, Rcor1, Ireb2, Vtila, or Pex13) in the T cell are modified with a site-specific nuclease. The term “site-specific nuclease” as used herein refers to a nuclease capable of specifically recognizing and cleaving a nucleic acid (DNA or RNA) sequence. Suitable site-specific nucleases for use in the present invention include, but are not limited to, an RNA-guided endonuclease (e.g., CRISPR-associated (Cas) proteins), a zinc finger nuclease, a TALEN nuclease, or a mega-TALEN nuclease.
[0155] Site-specific nucleases may create double-strand breaks (DSBs) or single-strand breaks (i.e., nicks) in a genomic DNA of a cell. Although not wishing to be bound by theory, these breaks are typically repaired by the cell using one of two mechanisms: non-homologous end joining (NHEJ) and homology-directed repair (HDR). In NHEJ, the double-strand breaks are repaired by direct ligation of the break ends to one another. As a result, no new nucleic acid material is inserted into the site, although a few bases may be lost or added, resulting in a small insertions and deletion (indel). In HDR, a donor polynucleotide with homology to the cleaved target DNA sequence is used as a template to repair the cleaved target DNA sequence, resulting in the transfer of genetic information from the donor polynucleotide to the target DNA. As such, new nucleic acid material may be inserted or copied into the cleavage site. In some cases, an exogenous donor polynucleotide can be provided to the cell. The modifications of the target DNA due to NHEJ and/or HDR may lead to, for example, gene correction, gene replacement, gene tagging, transgene insertion, nucleotide deletion, gene disruption, gene mutation, sequence replacement, etc. Accordingly, cleavage of DNA by a site-directed nuclease may be used to delete nucleic acid material from a target DNA sequence by cleaving the target DNA sequence and allowing the cell to repair the sequence in the absence of an exogenously provided donor polynucleotide. Thus, the methods can be used to knock out a gene (resulting in complete lack of transcription or altered transcription) or to knock in genetic material (e.g., a transgene) into a locus of choice in the target DNA.
[0156] In some embodiments, the site-specific nuclease is an RNA-guided endonuclease. In particular, a group of RNA-guided endonucleases known as CRISPR-associated (Cas) proteins may be employed to genetically modify the T cell. A Cas protein may form an RNA-protein complex (referred to as RNP) with a guide RNA (gRNA) and is capable of cleaving a target site bearing sequence complementarity to a short sequence (typically about 20-40nt) in the gRNA.
[0157] Examples of Cas proteins useful in the methods of the present disclosure include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas5e (CasD), Cas6, Cas6e, Cas6f, Cas7, Cas8a1, Cas8a2, Cas8b, Cas8c, Cas9 (Csn1 or Csx12), Cas10, Cas10d, CasF, CasG, CasH, Cpf1, Csy 1, Csy2, Csy3, Cse1 (CasA), Cse2 (CasB), Cse3 (CasE), Cse4 (CasC), Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb 1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, Csf4, and Cu1966, and homologs or modified versions thereof.
[0158] In some embodiments, the Cas protein used in the methods described herein is a Cas9 protein. The Cas9 protein may be from S. pyogenes, Streptococcus thermophilus, Neisseria meningitidis, F. novicida, S. mutans or Treponema denticola.
[0159] Cas proteins can be wild type proteins (i.e., those that occur in nature), modified Cas proteins (i.e., Cas protein variants), or fragments of wild type or modified Cas proteins. Cas proteins can also be active variants or fragments with respect to catalytic activity of wild type or modified Cas proteins. Active variants or fragments with respect to catalytic activity can comprise at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more sequence identity to the wild type or modified Cas protein or a portion thereof, wherein the active variants retain the ability to cut at a desired cleavage site and hence retain nick-inducing or double-strand-break-inducing activity.
[0160] A “guide RNA” or “gRNA” is an RNA molecule that binds to a Cas protein (e.g., Cas9 protein), or functional fragment or derivative thereof, and targets the Cas protein to a specific location within a target DNA. In some embodiments, the guide RNA is a single guide RNA (sgRNA). For Cas9, for example, a single-guide RNA can comprise a crRNA fused to a tracrRNA (e.g., via a linker). In some embodiments, the sgRNA is designed to target a locus within or near the Regnase-1 gene. In some embodiments, the sgRNA is designed to target a locus within or near the Ptpn2 gene. In some embodiments, the sgRNA is designed to target a locus within or near the Socs1 gene. In some embodiments, the sgRNA is designed to target a locus within or near the Agps gene. In some embodiments, the sgRNA is designed to target a locus within or near the Rc3h1 gene. In some embodiments, the sgRNA is designed to target a locus within or near the Rcor 1 gene. In some embodiments, the sgRNA is designed to target a locus within or near the Ireb2 gene. In some embodiments, the sgRNA is designed to target a locus within or near the Vti1a gene. In some embodiments, the sgRNA is designed to target a locus within or near the Pex13 gene.
[0161] Exemplary sgRNAs useful for modifying a target gene described in the present disclosure include those that comprise a nucleotide sequence set forth in any one of SEQ ID NOs: 1, 2, and 5-9. For example, a sgRNA targeting the Regnase-1 gene may comprise a nucleotide sequence of SEQ ID NO: 1 or SEQ ID NO: 2, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 1 or SEQ ID NO: 2. For example, a sgRNA targeting the Ptpn2 gene may comprise a nucleotide sequence of SEQ ID NO: 5 or SEQ ID NO: 6, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 5 or SEQ ID NO: 6. For example, a sgRNA targeting the Socs1 gene may comprise a nucleotide sequence of SEQ ID NO: 7 or SEQ ID NO: 8, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 7 or SEQ ID NO: 8. For example, a sgRNA targeting the Agps gene may comprise a nucleotide sequence of SEQ ID NO: 9, or a variant having at least at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 9. For example, a sgRNA targeting the Rc3h1 gene may comprise a nucleotide sequence of SEQ ID NO: 42, or a variant having at least at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 42.
[0162] Further exemplary sgRNAs targeting the Regnase-1 gene include those that comprise a nucleotide sequence set forth in any one of SEQ ID NOs: 29-34 and 36-41. For example, an sgRNA targeting the Regnase-1 gene may comprise a nucleotide sequence of any one of SEQ ID NOs: 29-34 and 36-41, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NOs: 29-34 and 36-41.
[0163] In one embodiment, the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 29. In another embodiment, the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 34.
[0164] In one embodiment, the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 36. In another embodiment, the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 41.
[0165] In alternative embodiments, the site-specific nuclease used in the methods described herein is a zinc finger nuclease, a transcription activator-like effector nuclease (TALEN), a mega-TALEN nuclease, and/or a restriction endonuclease.
[0166] The site-specific nuclease used in the methods described herein may include a zinc finger nuclease (ZFN). Zinc finger nucleases (ZFNs) are a class of engineered DNA-binding proteins that assist targeted editing of the genome by creating double-strand breaks in DNA at targeted locations. ZFNs typically comprise two functional domains: a) a DNA-binding domain comprising a chain of two-finger modules (each recognizing a unique hexamer (6 bp) sequence of DNA-two-finger modules are stitched together to form a Zinc Finger Protein, each with specificity of about 24 bp or more) and b) a DNA-cleaving domain comprising the nuclease domain of Fok I. When the DNA-binding and -cleaving domains are fused together, a ZFN can act like a highly-specific pair of “genomic scissors”.
[0167] The site-specific nuclease used in the methods described herein may include a transcription activator-like effector nuclease (TALEN). Transcription activator-like effector nucleases (TALEN) are a class of sequence-specific nucleases that can be used to make double-strand breaks at specific target sequences in the genome of a prokaryotic or eukaryotic organism. They typically comprise a TAL effector DNA-binding domain fused to a DNA cleavage domain (a nuclease which cuts DNA strands). TAL effector nucleases can be created by fusing a native or engineered transcription activator-like (TAL) effector, or functional part thereof, to the catalytic domain of an endonuclease, such as, for example, FokI. The unique, modular TAL effector DNA binding domain allows for the design of proteins with potentially any given DNA recognition specificity. Thus, the DNA binding domains of the TAL effector nucleases can be engineered to recognize specific DNA target sites and thus, used to make double-strand breaks at desired target sequences. See, WO 2010/079430; Morbitzer et al. (2010) PNAS 10.1073/pnas.1013133107; Scholze & Boch (2010) Virulence 1:428-432; Christian et al. Genetics (2010) 186:757-761; Li et al. (2010) Nuc. Acids Res. doi: 10.1093/nar/gkq704; and Miller et al. (2011) Nature Biotechnology 29:143-148; all of which are herein incorporated by reference in their entirety and for all purposes.
[0168] In some embodiments, the method involves silencing a Regnase-1 mRNA with an RNA interference (RNAi) molecule or an antisense oligonucleotide. RNA interference (RNAi) refers to the process of sequence-specific post-transcriptional gene silencing in animals mediated by small interfering RNAs (siRNAs) (Fire et al., 1998, Nature, 391, 806; Hamilton et al., 1999, Science, 286, 950-951). Any small nucleic acid molecules capable of mediating RNAi, such as a short interfering nucleic acid (siNA), a small interfering RNA (siRNA), a double-stranded RNA (dsRNA), a micro-RNA (miRNA), and a short hairpin RNA (shRNA), may be used to inhibit the expression of the Regnase-1 gene. An antisense oligonucleotide (ASO) is a short nucleotide sequence that can hybridize or bind (e.g., by Watson-Crick base pairing) in a complementary fashion to its target sequence.
[0169] In some embodiments, the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA). siRNAs, also known as short interfering RNA or silencing RNA, are a class of double-stranded RNA molecules, 20-25 base pairs in length, and operating within the RNA interference (RNAi) pathway. shRNAs or short hairpin RNAs are a group of artificial RNA molecules with a tight hairpin turn that can be used to silence target gene expression via RNA interference (RNAi).
[0170] In some embodiments, the methods also include inhibiting a Regnase-1 protein with one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
[0171] In some embodiments, Regnase-1 inhibitors may include a Zc3h12a gene inhibitor and a Zc3h12a protein inhibitor as those described in U.S. Pat. No. 8,894,996, which is incorporated herein by reference in its entirety.
[0172] In another aspect, the present disclosure provides a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell, comprising increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
[0173] BATF, also known as basic leucine zipper transcription factor, ATF-like, is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The Batf gene has NCBI gene IDs of 10538 (human) and 53314 (mouse). As described in the Examples section below, BATF was identified as a key target of Regnase-1. BATF may serve as a limiting factor for programming effective antitumor responses, in part through shaping mitochondrial metabolism.
[0174] In some embodiments, the method comprises introducing into the T cell a polynucleotide encoding a BATF protein, or functional fragment or derivative thereof.
[0175] As a non-limiting example, the BATF protein encoded by the polynucleotide comprises the amino acid sequence of MPHS SD S SD S SF SRSPPPGKQD S SDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLE SEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLC SVLAASTP SPPEVVYSAHAFHQ PHVSSPRFQP (Homo sapiens; UniProtKB-Q16520; SEQ ID NO: 25), or an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more sequence identity to SEQ ID NO: 25. As another non-limiting example, the BATF protein encoded by the polynucleotide comprises the amino acid sequence of MPHS SD S SD S SF SRSPPPGKQD S SDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLE SEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQ PHISSPRFQP (Mus musculus; UniProtKB-035284; SEQ ID NO: 26), or an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more sequence identity to SEQ ID NO: 26.
[0176] As a non-limiting example, the polynucleotide encoding a BATF protein comprises the nucleotide sequence of aaagcgagcgacatgtecctttggggagcagtccctctgcaccccagagtgaggaggacgcaggggtcagaggtggctacagggc aggcagaggaggcacctgtagggggtggtgggctggtggcccaggagaagtcaggaagggagcccagctggtgacaagagagc ccagaggtgcctggggctgagtgtgagagcccggaagatttcagccatgcctcacagctccgacagcagtgactccagatcagcc gctctectccccctggcaaacaggactcatctgatgatgtgagaagagttcagaggagggagaaaaatcgtattgccgcccagaaga gccgacagaggcagacacagaaggccgacaccctgcacctggagagcgaagacctggagaaacagaacgcggctctacgcaag gagatcaagcagctcacagaggaactgaagtacttcacgteggtgctgaacagccacgagcccctgtgctcggtgctggccgccag cacgccctcgccccccgaggtggtgtacagcgcccacgcattccaccaacctcatgtcagctccccgcgcttccagccctgagcttcc gatgeggggagagcagagcctegggaggggcacacagactgtggcagagctgcgcccatcccgcagaggccectgtccacctgg agacccggagacagaggcctggacaaggagtgaacacgggaactgtcacgactggaagggcgtgaggcctcccagcagtgccg cagcgtttcgaggggcgtgtgctggaccccaccactgtgggttgcaggcccaatgcagaagagtattaagaaagatgctcaagtecc atggcacagagcaaggcgggcagggaacggttatttttctaaataaatgctttaaaagaaa (Homo sapiens; NCBI gene ID of 10538; SEQ ID NO: 27), or a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more sequence identity to SEQ ID NO: 27. As another non-limiting example, the polynucleotide encoding a BATF protein comprises the nucleotide sequence of gcagtecctctgcacccgagagagaggaggacgcaggggtctgtcagaggttgctgttgggcaagcaggggaggtacctgtggaa ggtggtgtgctggtggcccectagcagtcaagaaggggagccagctagtgagaagatcgcccagaggcatctgggacggtgtggg agagcccggaagattagaaccatgcctcacagctccgacagcagtgactccagatcagccgctctcctccccctggcaaacaggac tcatctgatgatgtgaggaaagttcagaggagagagaagaatcgcatcgctgcccagaagagccgacagagacagacacagaaag ccgacaccatcacctggagagtgaggacctggagaaacagaacgcagctctccgcaaagagatcaaacagctcaccgaggagct caagtacttcacatcagtgctgagcagccacgagccectgtgctccgtgctggccagtggcaccccctcgccccccgaggtggtata cagtgcccatgccttccaccagcctcacatcagctcgccacgcttccagccctgaccttctggacaagaagggcgatgctactcccgt gatccatggaggggcatgtaaactgaggccgggctgccctcatacctctacccagaggcccagtggcagaggcctggacaagtatt gaacacaagaactgtagtggtcagagggacttaaggcctcccagggaagtatagtcaatgtactggactctcccagggaagtcgagc caatgtactggacccaaaaaatgacaagtcaaccctggactgtcatgaatgatgcccaaaatacacagcacagagggaggagggca gggggtggatagttttctaaataaatattttctaaaaaacca (Mus musculus; NCBI gene ID of 53314; SEQ ID NO: 28), or a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more sequence identity to SEQ ID NO: 28.
[0177] In certain embodiments, the polynucleotide encoding a BATF protein, or functional fragment or derivative thereof, is introduced into the T cell in a recombinant vector. The recombinant vector may be a viral vector or non-viral vector, such as those described herein.
[0178] In certain embodiments, increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell is achieved by administering to the T cell an agent (e.g., a small molecule or an antibody) that upregulates Batf gene expression and/or directly enhances or activates the BATF protein function.
[0179] In certain embodiments, in addition to increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell, the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Regnase-1 (REGNASE-1, Zc3h12a, MCPIP1), Ptpn2, Socs1, Agps, Rc3h1, and Rcor1. In some embodiments, the additional gene(s) or gene product(s) is Regnase-1 (REGNASE-1, Zc3h12a, MCPIP1).
[0180] In another aspect, the present disclosure provides a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell, comprising modifying a Regnase-1 (REGNASE-1, Zc3h12a, MCPIP1) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell. In certain embodiments, the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of said additional gene(s) or gene product(s) in said T cell is reduced or eliminated, wherein said additional gene(s) or gene product(s) are selected from Ptpn2, Socs1, Agps, Rc3h1, and Rcor1.
[0181] In another aspect, the present disclosure provides a method of improving mitochondrial biogenesis and/or function in a T cell comprising modifying a Regnase-1 (REGNASE-1, Zc3h12a, MCPIP1) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and/or increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell. In certain embodiments, the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of said additional gene(s) or gene product(s) in said T cell is reduced or eliminated, wherein said additional gene(s) or gene product(s) are selected from Ptpn2, Socs1, Agps, Rc3h1, and Rcor1.
[0182] As used herein, the term “mitochondrial biogenesis” refers to the process by which cells increase mitochondrial mass. As used herein, the term “mitochondrial function” refers to any mitochondria-dependent cellular metabolism.
[0183] Effects of improved mitochondrial function and/or mitochondrial biogenesis may include without limitation observations that the method of this invention improves T accumulation and function in tumors, helps promote endurance, helps promote recovery after exercise, helps reduce muscle fatigue, helps reduce muscle soreness, complements the immediate short term effect of caffeine with a sustained effect on energy generation, helps promote energy generation from fat, helps lower plasma lactate during exercise, helps maintain muscle force in conditions of oxidative stress, helps protect against exercise-induced oxidative stress, helps the body to come up with more energy in a natural and sustained way, helps the body to find more energy without getting too much caffeine, gives long-lasting energy to sustain through busy schedule, helps boost body's own energy production in a natural sustained way, helps maintain more even energy levels throughout the day, helps the body to adapt to exercise, helps prepare the body for exercise goals, helps revamp shape, facilitates the restart of exercise program, increased muscle work capacity, improved aerobic capacity, enhanced physical performance, enhanced exercise performance, improved running endurance, improved running distance and/or improved running time, or stimulate energy formation from nutrients.
[0184] Isolation/Enrichment of T cells
[0185] The T cells may be autologous/autogeneic (“self”) or non-autologous (“non-self,” e.g., allogeneic, syngeneic or xenogeneic). In some embodiments, the T cells are obtained from a mammalian subject. In other embodiments, the T cells are obtained from a primate subject. In some embodiments, the T cells are obtained from a human subject.
[0186] Lymphocytes can be obtained from sources such as, but not limited to, peripheral blood mononuclear cells, bone marrow, lymph nodes tissue, cord blood, thymus issue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. Lymphocytes may also be generated by differentiation of stem cells. In some embodiments, lymphocytes can be obtained from blood collected from a subject using techniques generally known to the skilled person, such as sedimentation, e.g., FICOLL™ separation.
[0187] In some embodiments, the T cell is derived from a blood, marrow, tissue, or tumor sample.
[0188] In some embodiments, cells from the circulating blood of a subject are obtained by apheresis. An apheresis device typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In some embodiments, the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing. The cells can be washed with PBS or with another suitable solution that lacks calcium, magnesium, and most, if not all other, divalent cations. A washing step may be accomplished by methods known to those in the art, such as, but not limited to, using a semiautomated flowthrough centrifuge (e.g., Cobe 2991 cell processor, or the Baxter CytoMate). After washing, the cells may be resuspended in a variety of biocompatible buffers, cell culture medias, or other saline solution with or without buffer.
[0189] In some embodiments, T cells can be isolated from peripheral blood mononuclear cells (PBMCs) by lysing the red blood cells and depleting the monocytes. As an example, the cells can be sorted by centrifugation through a PERCOLL™ gradient. In some embodiments, after isolation of PBMC, both cytotoxic and helper T lymphocytes can be sorted into naive, memory, and effector T cell subpopulations either before or after activation, expansion, and/or genetic modification.
[0190] In some embodiments, T lymphocytes can be enriched. For example, a specific subpopulation of T lymphocytes, expressing one or more markers such as, but not limited to, CD3, CD4, CD8, CD14, CD15, CD16, CD19, CD27, CD28, CD34, CD36, CD45RA, CD45RO, CD56, CD62, CD62L, CD122, CD123, CD127, CD235a, CCR7, HLA-DR or a combination thereof using either positive or negative selection techniques. In some embodiments, the T lymphocytes for use in the compositions of the invention do not express or do not substantially express one or more of the following markers: CD57, CD244, CD160, PD-1, CTLA4, TIM3, and LAG3.
[0191] Stimulation/Activation of T cells
[0192] In order to reach sufficient therapeutic doses of T cell compositions, T cells are often subjected to one or more rounds of stimulation/activation. In some embodiments, a method of producing T cells for administration to a subject comprises stimulating the T cells to become activated in the presence of one or more stimulatory signals or agents (e.g., compound, small molecule, e.g., small organic molecule, nucleic acid, polypeptide, or a fragment, isoform, variant, analog, or derivative thereof). In some embodiments, a method of producing T cells for administration to a subject comprises stimulating the T cells to become activated and to proliferate in the presence of one or more stimulatory signals or agents.
[0193] T cells can be activated by inducing a change in their biologic state by which the cells express activation markers, produce cytokines, proliferate and/or become cytotoxic to target cells. All these changes can be produced by primary stimulatory signals. Co-stimulatory signals amplify the magnitude of the primary signals and suppress cell death following initial stimulation resulting in a more durable activation state and thus a higher cytotoxic capacity.
[0194] T cells can be activated generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; and 6,867,041, each of which is incorporated herein by reference in its entirety.
[0195] In some embodiments, the T cells can be activated by binding to an agent that activates CD3ζ.
[0196] In other embodiments, a CD2-binding agent may be used to provide a primary stimulation signal to the T cells. For example, and not by limitation, CD2 agents include, but are not limited to, CD2 ligands and anti-CD2 antibodies, e.g., the Tl 1.3 antibody in combination with the Tl 1.1 or Tl 1.2 antibody (Meuer, S. C. et al. (1984) Cell 36:897-906) and the 9.6 antibody (which recognizes the same epitope as TI 1.1) in combination with the 9-1 antibody (Yang, S. Y. et al. (1986) J. Immunol. 137:1097-1100, which is incorporated herein by reference in its entirety). Other antibodies which bind to the same epitopes as any of the above described antibodies can also be used.
[0197] In some embodiments, the T cells are activated by administering phorbol myristate acetate (PMA) and ionomycine. In some embodiments, the T cells are activated by administering an appropriate antigen that induces activation and then expansion. In some embodiments, PMA, ionomycin, and/or appropriate antigen are administered with CD3 induce activation and/or expansion.
[0198] In general, the activating agents used in the present invention includes, but is not limited to, an antibody, a fragment thereof and a proteinaceous binding molecule with antibody-like functions. Examples of (recombinant) antibody fragments are Fab fragments, Fv fragments, single-chain Fv fragments (scFv), a divalent antibody fragment such as an (Fab)2′-fragment, diabodies, triabodies (Iliades, P., et al., FEBS Lett (1997) 409, 437-441, which is incorporated herein by reference in its entirety), decabodies (Stone, E., et al., Journal of Immunological Methods (2007) 318, 88-94, which is incorporated herein by reference in its entirety) and other domain antibodies (Holt, L. J., et al., Trends Biotechnol. (2003), 21, 11, 484-490, which is incorporated herein by reference in its entirety). The divalent antibody fragment may be an (Fab)2′-fragment, or a divalent single-chain Fv fragment while the monovalent antibody fragment may be selected from the group consisting of a Fab fragment, a Fv fragment, and a single-chain Fv fragment (scFv).
[0199] In some embodiments, one or more binding sites of the CD3ζ agents may be a bivalent proteinaceous artificial binding molecule such as a dimeric lipocalin mutein (i.e., duocalin). In some embodiments the receptor binding reagent may have a single second binding site, (i.e., monovalent). Examples of monovalent agents include, but are not limited to, a monovalent antibody fragment, a proteinaceous binding molecule with antibody-like binding properties or an MHC molecule. Examples of monovalent antibody fragments include, but are not limited to a Fab fragment, a Fv fragment, and a single-chain Fv fragment (scFv), including a divalent single-chain Fv fragment.
[0200] The agent that specifically binds CD3 includes, but is not limited to, an anti-CD3-antibody, a divalent antibody fragment of an anti-CD3 antibody, a monovalent antibody fragment of an anti-CD3-antibody, and a proteinaceous CD3-binding molecule with antibody-like binding properties. A proteinaceous CD3-binding molecule with antibody-like binding properties can be an aptamer, a mutein based on a polypeptide of the lipocalin family, a glubody, a protein based on the ankyrin scaffold, a protein based on the crystalline scaffold, an adnectin, and an avimer. It also can be coupled to a bead.
[0201] In some embodiments, the activating agent (e.g., CD3-binding agents) can be present in a concentration of about 0.1 to about 10 pg/ml. In some embodiments, the activating agent (e.g., CD3-binding agents) can be present in a concentration of about 0.2 μg/ml to about 9 μg/ml, about 0.3 μg/m1 to about 8 μg/ml, about 0.4 μg/ml to about 7 μg/ml, about 0.5 μg/ml to about 6 μg/ml, about 0.6 g/ml to about 5 μg/ml, about 0.7 g/ml to about 4 μg/ml, about 0.8 μg/ml to about 3 μg/ml, or about 0.9 μg/ml to about 2 μg/ml. In some embodiments, the activating agent (e.g., CD3-binding agents) is administered at a concentration of about 0.1 μg/ml, about 0.2 μg/ml, about 0.3 μg/ml, about 0.4 μg/ml, about 0.5 μg/ml, about 0.6 μg/ml, about 0.7 μg/ml, about 0.8 μM, about 0.9 μg/ml, about 1 μg/ml, about 2 μg/ml, about 3 μg/ml, about 4 μM, about 5 μg/ml, about 6 μg/ml, about 7 μg/ml, about 8 μg/ml, about 9 μg/ml, or about 10 μg/ml. In some embodiments, the CD3-binding agents can be present in a concentration of 1 μg/ml.
[0202] In some embodiments, the activating agent is attached to a solid support such as, but not limited to, a bead, an absorbent polymer present in culture plate or well or other matrices such as, but not limited to, Sepharose or glass; may be expressed (such as in native or recombinant forms) on cell surface of natural or recombinant cell line by means known to those skilled in the art.
[0203] Polynucleotide and/or Polypeptide Transfer in T cells
[0204] In some embodiments, the T cells are genetically modified by introducing polynucleotides and/or polypeptide (e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, an antisense oligonucleotide, a CAR, or polynucleotides encoding the same) into the cells. The T cells can be genetically modified after stimulation/activation. In some embodiments, the T cells are modified within 12 hours, 16 hours, 24 hours, 36 hours, or 48 hours of stimulation/activation. In some embodiments, the cells are modified within 16 to 24 hours after stimulation/activation. In some embodiments, the T cells are modified within 24 hours.
[0205] In order to genetically modify the T cell, the polynucleotides and/or polypeptide (e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, an antisense oligonucleotide, a CAR, a BAFT protein, or polynucleotides encoding the same) must be transferred into the cell. Polynucleotide and/or polypeptide transfer may be via viral, non-viral gene delivery methods, or a physical method. Suitable methods for polynucleotide and/or polypeptide delivery for use with the current methods include any method known by those of skill in the art, by which a polynucleotide and/or polypeptide can be introduced into an organelle, cell, tissue or organism.
[0206] In various embodiments, polypeptides or polynucleotides (e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, an antisense oligonucleotide, a CAR, a BAFT protein, or polynucleotides encoding the same) described in the present invention are introduced to the T cell via a recombinant vector.
[0207] In some embodiments, the vector is a viral vector. Suitable viral vectors that can be used in the present invention include, but are not limited to, a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated viral (AAV) vector, a herpes viral vector, or a baculoviral vector. In one specific embodiment, the viral vector is a lentiviral vector. In one specific embodiment, the viral vector is a retroviral vector.
[0208] In some embodiments, the T cells can be transduced via retroviral transduction. References describing retroviral transduction of genes are Anderson et al., U.S. Pat. No. 5,399,346; Mann et al., Cell 33:153 (1983); Temin et al., U.S. Pat. No. 4,650,764; Temin et al., U.S. Pat. No. 4,980,289; Markowitz et al., J. Virol. 62:1120 (1988); Temin et al., U.S. Pat. No. 5,124,263; International Patent Publication No. WO 95/07358, published Mar. 16, 1995, by Dougherty et al.; and Kuo et al., Blood 82:845 (1993), each of which is incorporated herein by reference in its entirety.
[0209] One method of genetic modification includes ex vivo modification. Various methods are available for transfecting cells and tissues removed from a subject via ex vivo modification. For example, retroviral gene transfer in vitro can be used to genetically modified cells removed from the subject and the cell transferred back into the subject. See e.g., Wilson et al., Science, 244:1344-1346, 1989 and Nabel et al., Science, 244(4910):1342-1344, 1989, both of which are incorporated herein by reference in their entity. In some embodiments, the T cells may be removed from the subject and transfected ex vivo using the polynucleotides (e.g., expression vectors) of the invention. In some embodiments, the T cells obtained from the subject can be transfected or transduced with the polynucleotides (e.g., expression vectors) of the invention and then administered back to the subject.
[0210] In some embodiments, polynucleotides and/or polypeptides are transferred to the cell in a non-viral vector (e.g., a transposon, a plasmid). The non-viral vector may be an RNA and/or DNA vector.
[0211] Nucleic acid vaccines may also be used to transfer polynucleotides into the T cells. Such vaccines include, but are not limited to non-viral polynucleotide vectors, “naked” DNA and RNA, and viral vectors. Methods of genetically modifying cells with these vaccines, and for optimizing the expression of genes included in these vaccines are known to those of skill in the art.
[0212] In some embodiments, the polynucleotide(s) is operatively linked to at least one regulatory element for expression of the gene product (e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, a CAR, a BAFT protein). The regulatory element can be capable of mediating expression of the gene product in the host cell (e.g., modified T cell). Regulatory elements include, but are not limited to, promoters, enhancers, initiation sites, polyadenylation (polyA) tails, IRES elements, response elements, and termination signals. In some embodiments, the regulatory element regulates expression of the gene product. In some embodiments, the regulatory element increased the expression of the gene product. In some embodiments, the regulatory element increased the expression of the gene product once the host cell (e.g., modified T cell) is activated. In some embodiments, the regulatory element decreases expression of the gene product. In some embodiments, the regulatory element decreases expression of the gene product once the host cell (e.g., modified T cell) is activated.
[0213] In various embodiment, polypeptides or polynucleotides (e.g., a CAR, a signaling molecule, site-specific nuclease, an RNAi molecule or an antisense oligonucleotide, a BAFT protein, or polynucleotides encoding the same) are introduced into the modified T cell using a physical means. Suitable physical means include, but are not limited to, electroporation, microinjection, magnetofection, ultrasound, a ballistic or hydrodynamic method, or a combination thereof.
[0214] Electroporation is a method for polynucleotide and/or polypeptide delivery. See e.g., Potter et al., (1984) Proc. Nat'l Acad. Sci. USA, 81, 7161-7165 and Tur-Kaspa et al., (1986) Mol. Cell Biol., 6, 716-718, both of which are incorporated herein in their entirety for all purposes. Electroporation involves the exposure of a suspension of cells and DNA to a high-voltage electric discharge. In some embodiments, cell wall-degrading enzymes, such as pectin-degrading enzymes, can be employed to render the T cells more susceptible to genetic modification by electroporation than untreated cells. See e.g., U.S. Pat. No. 5,384,253, incorporated herein by reference in its entirety for all purposes.
[0215] In vivo electroporation involves a basic injection technique in which a vector is injected intradermally in a subject. Electrodes then apply electrical pulses to the intradermal site causing the cells localized there (e.g., resident dermal dendritic cells), to take up the vector. These tumor antigen-expressing dendritic cells activated by local inflammation can then migrate to lymph-nodes.
[0216] Methods of electroporation for use with this invention include, for example, Sardesai, N. Y., and Weiner, D. B., Current Opinion in Immunotherapy 23:421-9 (2011) and Ferraro, B. et al., Human Vaccines 7:120-127 (2011), both of which are hereby incorporated by reference herein in their entirety for all purposes.
[0217] In some embodiments, the present invention provides a method of modifying a gene in a cell, comprising introducing into the cell a site-specific nuclease via electroporation. In some embodiments, Cas9 protein and one or more guide RNAs are combined to form a ribonucleoprotein (RNP) complex. In some embodiments, the guide RNA comprises a nucleotide sequence as set forth in any one of SEQ ID NOs: 1-9, 29-34 and 36-42, or a nucleotide sequence having at least 80% identity thereof. In some embodiments, the guide RNA comprises the nucleotide sequence of SEQ ID NO: 29, SEQ ID NO: 34, SEQ ID NO: 36 or SEQ ID NO: 41. An exemplary protocol is detailed in Example 14 in the Examples section below. It was shown in Example 14 that this method results in higher targeting efficiency compared to application of CRISPR/Cas9 for gene editing using viral delivery of Cas9 and guide RNA. Using this method to edit a gene (e.g., Regnase-1), the editing efficiency was greater than 90% based on deep sequencing results. The RNP electroporation method also had lower toxicity for T cells compared to DNA electroporation.
[0218] Another method for polynucleotide and/or polypeptide transfer includes injection. In some embodiments, a polypeptide, a polynucleotide or viral vector may be delivered to a cell, tissue, or organism via one or more injections (e.g., a needle injection). Non-limiting methods of injection include injection of a composition (e.g., a saline based composition). Polynucleotides and/or polynucleotides can also be introduced by direct microinjection. Non-limiting sites of injection include, subcutaneous, intradermal, intramuscular, intranodal (allows for direct delivery of antigen to lymphoid tissues). intravenous, intraprotatic, intratumor, intralymphatic (allows direct administration of DCs) and intraperitoneal. It is understood that proper site of injection preparation is necessary (e.g., shaving of the site of injection to observe proper needle placement).
[0219] Additional methods of polynucleotide and/or polypeptide transfer include liposome-mediated transfection (e.g., polynucleotide entrapped in a lipid complex suspended in an excess of aqueous solution. See e.g., Ghosh and Bachhawat, (1991) In: Liver Diseases, Targeted Diagnosis and Therapy Using Specific Receptors and Ligands. pp. 87-104). Also contemplated is a polynucleotide and/or polypeptide complexed with Lipofectamine, or Superfect); DEAE-dextran (e.g., a polynucleotide is delivered into a cell using DEAE-dextran followed by polyethylene glycol. See e.g., Gopal, T. V., Mol Cell Biol. 1985 May; 5(5):1188-90); calcium phosphate (e.g., polynucleotide is introduced to the cells using calcium phosphate precipitation. See e.g., Graham and van der Eb, (1973) Virology, 52, 456-467; Chen and Okayama, Mol. Cell Biol., 7(8):2745-2752, 1987), and Rippe et al., Mol. Cell Biol., 10:689-695, 1990); sonication loading (introduction of a polynucleotide by direct sonic loading. See e.g., Fechheimer et al., (1987) Proc. Nat'l Acad. Sci. USA, 84, 8463-8467); microprojectile bombardment (e.g., one or more particles may be coated with at least one polynucleotide and/or polypeptide and delivered into cells by a propelling force. See e.g., U .S. Pat. Nos. 5,550,318; 5,538,880; 5,610,042; and PCT Application WO 94/09699; Klein et al., (1987) Nature, 327, 70-73, Yang et al., (1990) Proc. Nat'l Acad. Sci. USA, 87, 9568-9572); and receptor-mediated transfection (e.g., selective uptake of macromolecules by receptor-mediated endocytosis that will be occurring in a target cell using cell type-specific distribution of various receptors. See e.g., Wu and Wu, (1987) J. Biol. Chem., 262, 4429-4432; Wagner et al., Proc. Natl. Acad. Sci. USA, 87(9):3410-3414, 1990; Perales et al., Proc. Natl. Acad. Sci. USA, 91:4086-4090, 1994; Myers, EPO 0273085; Wu and Wu, Adv. Drug Delivery Rev., 12:159-167, 1993; Nicolau et al., (1987) Methods Enzymol., 149, 157-176), each reference cited here is incorporated by reference in their entirety for all purposes.
[0220] Expansion/Proliferation of T cells
[0221] After the T cells are activated and transduced, the cells are cultured to proliferate. T cells may be cultured for at least 1, 2, 3, 4, 5, 6, or 7 days, at least 2 weeks, at least 1, 2, 3, 4, 5, or 6 months or more with 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more rounds of expansion.
[0222] Agents that can be used for the expansion of T cells can include interleukins, such as IL-2, IL-7, IL-15, or IL-21 (see for example Cornish et al. 2006, Blood. 108(2):600-8, Bazdar and Sieg, 2007, Journal of Virology, 2007, 81(22):12670-12674, Battalia et al, 2013, Immunology, 139(1):109-120, each of which is incorporated by reference in their entirety for all purposes). Other illustrative examples for agents that may be used for the expansion of T cells are agents that bind to CD8, CD45 or CD90, such as α CD8, α CD45 or α CD90 antibodies. Illustrative examples of T cell population including antigen-specific T cells, T helper cells, cytotoxic T cells, memory T cell (an illustrative example of memory T-cells are CD62L|CD8| specific central memory T cells) or regulatory T cells (an illustrative example of Treg are CD4.sup.+CD25.sup.+CD45RA.sup.+ Treg cells).
[0223] Additional agents that can be used to expand T lymphocytes includes methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; and 6,867,041, each of which is incorporated herein by reference in its entirety.
[0224] In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 20 units/ml to about 200 units/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 25 units/ml to about 190 units/ml, about 30 units/ml to about 180 units/ml, about 35 units/ml to about 170 units/ml, about 40 units/ml to about 160 units/ml, about 45 units/ml to about 150 units/ml, about 50 units/ml to about 140 units/ml, about 55 units/ml to about 130 units/ml, about 60 units/ml to about 120 units/ml, about 65 units/ml to about 110 units/ml, about 70 units/ml to about 100 units/ml, about 75 units/ml to about 95 units/ml, or about 80 units/ml to about 90 units/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 20 units/ml, about 25 units/ml, about 30 units/ml, 35 units/ml, 40 units/ml, 45 units/ml, about 50 units/ml, about 55 units/ml, about 60 units/ml, about 65 units/ml, about 70 units/ml, about 75 units/ml, about 80 units/ml, about 85 units/ml, about 90 units/ml, about 95 units/ml, about 100 units/ml, about 105 units/ml, about 110 units/ml, about 115 units/ml, about 120 units/ml, about 125 units/ml, about 130 units/ml, about 135 units/ml, about 140 units/ml, about 145 units/ml, about 150 units/ml, about 155 units/ml, about 160 units/ml, about 165 units/ml, about 170 units/ml, about 175 units/ml, about 180 units/ml, about 185 units/ml, about 190 units/ml, about 195 units/ml, or about 200 units/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 5 mg/ml to about 10 ng/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 5.5 ng/ml to about 9.5 ng/ml, about 6 ng/ml to about 9 ng/ml, about 6.5 ng/ml to about 8.5 ng/ml, or about 7 ng/ml to about 8 ng/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 5 ng/ml, 6 ng/ml, 7 ng/ml, 8 ng/ml, 9, ng/ml, or 10 ng/ml.
[0225] Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media (MEM), RPMI Media 1640, Lonza RPMI 1640, Advanced RPMI, Clicks, AIM-V, DMEM, a-MEM, F-12, TexMACS, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion).
[0226] Examples of other additives for T cell expansion include, but are not limited to, surfactant, piasmanate, pH buffers such as HEPES, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol, Antibiotics (e.g., penicillin and streptomycin), are included only in experimental cultures, not in cultures of cells that are to be infused into a subject. The target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C.) and atmosphere (e.g., air plus 5% CO2).
[0227] In further embodiments, methods of the present disclosure described herein (e.g., modifying a Regnase-1 gene or gene product) may be applied to enhance a NK cell function. NK cell refers to a differentiated lymphocyte with a CD3- CD16.sup.+, CD3- CD56.sup.+, CD16.sup.+ CD56.sup.+ and/or CD57.sup.+ TCR- phenotype.
[0228] In some embodiments, NK cells can be isolated and/or enriched. For example, a specific subpopulation of T lymphocytes, expressing one or more markers such as, but not limited to, CD2, CD16, CD56, CD57, CD94, CD122 or a combination thereof may be selected using either positive or negative selection techniques.
[0229] NK cells can be activated generally using methods as described, for example, in U.S. Pat. Nos. 7,803,376, 6,949,520, 6,693,086, 8,834,900, 9,404,083, 9,464,274, 7,435,596, 8,026,097, 8,877,182; U.S. Patent Applications US2004/0058445, US2007/0160578, US2013/0011376, US2015/0118207, US2015/0037887; and PCT Patent Application WO2016/122147, each of which is incorporated herein by reference in its entirety.
[0230] In some embodiments, the NK based host cells can be activated by, for example and not limitation, inhibition of inhibitory receptors on NK cells (e.g., KIR2DL1, KIR2DL2/3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR3DL1, KIR3DL2, KIR3DL3, LILRB1, NKG2A, NKG2C, NKG2E or LILRB5 receptor).
[0231] In some embodiments, the NK cells can be activated by, for example and not limitation, feeder cells (e.g., native K562 cells or K562 cells that are genetically modified to express 4-1BBL and cytokines such as IL15 or IL21).
[0232] In some embodiments, interferons or macrophage-derived cytokines can be used to activate NK cells. For example and not limitation, such interferons include but are not limited to interferon alpha and interferon gamma, and such cytokines include but are not limited to IL-15, IL-2, IL-21.
[0233] In some embodiments, the NK activating agent can be present in a concentration of about 0.1 to about 10 μg/ml. In certain embodiments, the NK activating agent can be present in a concentration of about 0.2 μg/ml to about 9 μg/ml, about 0.3 μg/ml to about 8 μg/ml, about 0.4 μg/ml to about 7 μg/ml, about 0.5 μg/ml to about 6 μg/ml, about 0.6 μg/ml to about 5 μg/ml, about 0.7 μg/ml to about 4 μg/ml, about 0.8 μg/ml to about 3 μg/ml, or about 0.9 μg/ml to about 2 μg/ml. In certain embodiments, the NK activating agent is administered at a concentration of about 0.1 μg/ml, about 0.2 μg/ml, about 0.3 μg/ml, about 0.4 μg/ml, about 0.5 μg/ml, about 0.6 μg/ml, about 0.7 μg/ml, about 0.8 μM, about 0.9 μg/ml, about 1 μg/ml, about 2 μg/ml, about 3 μg/ml, about 4 μM, about 5 μg/ml, about 6 μg/ml, about 7 μg/ml, about 8 μg/ml, about 9 μg/ml, or about 10 μg/ml. In certain embodiments, the NK activating agent can be present in a concentration of 1 μg/ml.
[0234] After the NK cells are activated and transduced, the cells are cultured to proliferate. NK cells may be cultured for at least 1, 2, 3, 4, 5, 6, or 7 days, at least 2 weeks, at least 1, 2, 3, 4, 5, or 6 months or more with 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more rounds of expansion.
[0235] Agents that can be used for the expansion of NK cells can include agents that bind to CD16 or CD56, such as for example aCD16 or aCD56 antibodies. In some embodiments, the binding agent includes antibodies (see for example Hoshino et al, Blood. 1991 Dec. 15; 78(12):3232-40.). Other agents that may be used for expansion of NK cells may be IL-15 (see for example Vitale et al. 2002. The Anatomical Record. 266:87-92, which is incorporated by reference in their entirety for all purposes).
Compositions of the Invention
[0236] Compositions of the present disclosure include, but are not limited to, cell compositions and pharmaceutical compositions.
[0237] In one aspect, the present disclosure provides modified T cells produced by the methods described herein. Modified T cells of the present disclosure have enhanced expansion and/or persistence and/or anti-tumor or anti-infection function. In some embodiments, the T cell is a CD8.sup.+ αβ TCR T cell. In some embodiments, the T cell is a CD4.sup.+ αβ TCR T cell. In some embodiments, the T cell is a regulatory T cell (Treg). In some embodiments, the T cell is engineered to express a T cell receptor or chimeric antigen receptor (CAR).
[0238] In one aspect, the present disclosure provides a pharmaceutical composition comprising the modified T cells prepared using the methods described herein and a pharmaceutically acceptable carrier and/or excipient. Examples of pharmaceutical carriers include but are not limited to sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions.
[0239] Compositions comprising modified T cells disclosed herein may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
[0240] Compositions comprising modified T cells disclosed herein may comprise one or more of the following: sterile diluents such as water for injection, saline solution, preferably physiological saline, Ringer's solution, isotonic sodium chloride, fixed oils such as synthetic mono or diglycerides which may serve as the solvent or suspending medium, polyethylene glycols, glycerin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic. An injectable pharmaceutical composition is preferably sterile.
[0241] In some embodiments, the compositions are formulated for parenteral administration, e.g., intravascular (intravenous or intraarterial), intraperitoneal, intratumoral, intraventricular, intrapleural or intramuscular administration. In some embodiments, the composition is reconstituted from a lyophilized preparation prior to administration.
[0242] In some embodiments, the modified T cells may be mixed with substances that adhere or penetrate prior to their administration, e.g., but not limited to, nanoparticles.
[0243] In another aspect, provided herein are isolated polynucleotides for use in the methods and compositions described herein. In some embodiments, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of any one of SEQ ID NOs: 1-9, 29-34 and 36-42, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with any one of SEQ ID NOs: 1-9, 29-34 and 36-42.
[0244] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 1.
[0245] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 2.
[0246] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 29.
[0247] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 34.
[0248] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 36.
[0249] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 41.
[0250] In various embodiments, the isolated polynucleotide is a DNA molecule. In various embodiments, the isolated polynucleotide is an RNA molecule. In some embodiments, the isolated polynucleotide may comprise modified nucleotides. Modified nucleotides may include any of those known to a skilled artisan.
[0251] In some embodiments, the isolated polynucleotide is a guide RNA. In some embodiments, the guide RNA is a single guide RNA (sgRNA).
[0252] In some embodiments, the isolated polynucleotide is or is encoded in a recombinant vector. The recombinant vector may be a viral vector or non-viral vector, such as those described herein.
Therapeutic Methods
[0253] In one aspect, the present disclosure provides a method of treating a disease in a subject in need thereof, including administering to the subject an effective amount of the modified T cells or the pharmaceutical composition described herein. The modified T cells may be prepared using the methods as disclosed above.
[0254] In some embodiments, the modified T cells are autologous cells. In some embodiments, the modified T cells are allogeneic cells.
[0255] The treatment may be carried out by isolating a T cell or a population of T cells from the subject (e.g., for autologous cell transfer) or a donor (e.g., for allogeneic cell transfer); modifying a Regnase-1 gene or gene product in the T cell(s) such that the expression and/or function of Regnase-1 in the T cell(s) is reduced or eliminated; and administering an effective amount of the modified T cells to the subject. Optionally, the T cell(s) may be activated and/or expanded before or after the modification step. In some embodiments, one or more additional genes or gene products, including but not limited to Ptpn2, Socs1, Agps, Rc3h1, Rcor1, Ireb2, Vti1a, or Pex13, may be modified alone or in combination with Regnase-1 and/or Batf in the T cell(s) such that the expression and/or function of the modified gene(s) in the T cell(s) is reduced or eliminated.
[0256] The treatment may be carried out by isolating a T cell or a population of T cells from the subject (e.g., for autologous cell transfer) or a donor (e.g., for allogeneic cell transfer); increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell; and administering an effective amount of the modified T cells to the subject. Optionally, the T cell(s) may be activated and/or expanded before or after the modification step. In some embodiments, the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Regnase-1 (REGNASE-1, Zc3h12a, MCPIP1), Ptpn2, Socs1, Agps, Rc3h1, and Rcor1. In some embodiments, the additional gene(s) or gene product(s) is Regnase-1 (REGNASE-1, Zc3h12a, MCPIP1).
[0257] In some embodiments, the disease being treated by the therapeutic methods of the present disclosure is a cancer or an infectious disease.
[0258] The terms “cancer” and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. The term “cancer” includes, for example, the soft tissue tumors (e.g., lymphomas), and tumors of the blood and blood-forming organs (e.g., leukemias), and solid tumors, which is one that grows in an anatomical site outside the bloodstream (e.g., carcinomas). Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma (e.g., osteosarcoma or rhabdomyosarcoma), and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g., epithelial squamous cell cancer), adenosquamous cell carcinoma, lung cancer (e.g., including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung), cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer (e.g., including gastrointestinal cancer, pancreatic cancer), cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, primary or metastatic melanoma, multiple myeloma and B-cell lymphoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, brain (e.g., high grade glioma, diffuse pontine glioma, ependymoma, neuroblastoma, or glioblastoma), as well as head and neck cancer, and associated metastases. Additional examples of cancer can be found in The Merck Manual of Diagnosis and Therapy, 19th Edition, § on Hematology and Oncology, published by Merck Sharp & Dohme Corp., 2011 (ISBN 978-0-911910-19-3); The Merck Manual of Diagnosis and Therapy, 20th Edition, § on Hematology and Oncology, published by Merck Sharp & Dohme Corp., 2018 (ISBN 978-0-911-91042-1) (2018 digital online edition at interne website of Merck Manuals); and SEER Program Coding and Staging Manual 2016, each of which are incorporated by reference in their entirety for all purposes.
[0259] In some embodiments, the cancer is a solid tumor. Non-limiting examples of solid tumors that may be treated by the therapeutic methods of this present disclosure include ovarian cancer, lung cancer (e.g., non-small cell lung squamous cell carcinoma, adenocarcinoma, large cell carcinoma types, and small cell lung cancer), breast cancer, colon cancer, kidney cancer (e.g., renal cell carcinomas), bladder cancer, liver cancer (e.g., hepatocellular carcinoma), stomach cancer, cervical cancer, prostate cancer, testicular cancer, pancreatic cancer, nasopharyngeal cancer, thyroid cancer (e.g., thyroid papillary carcinoma), skin cancers (e.g., melanoma), brain cancer (e.g., glioma, astrocytoma and medulloblastoma) and sarcoma (e.g., osteosarcoma and Ewing's sarcoma). In some embodiments, the cancer is a melanoma, colon cancer, breast cancer, or brain cancer.
[0260] In some embodiments, the cancer is a blood cancer. In some embodiments, the blood cancer is a lymphoma, leukemia, or multiple myeloma. Non-limiting examples of leukemia that may be treated by the therapeutic methods of this present disclosure include acute lymphoblastic leukemia (ALL), B-cell acute lymphoblastic leukemia, T-cell acute lymphoblastic leukemia, acute non-lymphocytic leukemia (ANLL), acute myeloblastic leukemia (AML), acute promyelocytic leukemia (APL), acute monocytic leukemia, acute erythroleukemia leukemia, acute megakaryoblastic leukemia, chronic myelogenous leukemia (CIVIL), hairy cell leukemia, and chronic lymphocytic leukemia (CLL). Non-limiting examples of lymphoma that may be treated by the therapeutic methods of this present disclosure include lymphoplasmacytic lymphoma, small lymphocytic lymphoma (SLL), splenic marginal zone B cell lymphoma, nodal marginal band B cell lymphoma, prolymphocytic white blood, follicular lymphoma (FL), mantle cell lymphoma (MCL), Burkitt's lymphoma, and diffuse large B-cell lymphoma (DLBCL) Hodgkin lymphoma, lymphoblastic lymphoma, anaplastic large cell lymphoma (ALCL), subcutaneously T cell lymphoma, peripheral T-cell lymphoma, angioimmunoblastic ball lymphoma, angiocentric lymphoma (nasal type T cell lymphoma), malignant lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma, follicular lymphoma, and other lymphomas of lymphoid origin and skin.
[0261] In some embodiments of therapeutic methods described above, the composition is administered in a therapeutically effective amount. The dosages of the composition administered in the methods of the invention will vary widely, depending upon the subject's physical parameters, the frequency of administration, the manner of administration, the clearance rate, and the like. The initial dose may be larger, and might be followed by smaller maintenance doses. The dose may be administered as infrequently as weekly or biweekly, or fractionated into smaller doses and administered daily, semi-weekly, etc., to maintain an effective dosage level. It is contemplated that a variety of doses will be effective to achieve in vivo persistence of the modified T cells. It is also contemplated that a variety of doses will be effective to improve in vivo effector function of the modified T cells.
[0262] In some embodiments, composition comprising the T cells manufactured by the methods described herein may be administered at a dosage of 10.sup.2 to 10.sup.10 cells/kg body weight, 10.sup.5 to 10.sup.9 cells/kg body weight, 10.sup.5 to 10.sup.8 cells/kg body weight, 10.sup.5 to 10.sup.7 cells/kg body weight, 10.sup.7 to 10.sup.9 cells/kg body weight, or 10.sup.7 to 10.sup.8 cells/kg body weight, including all integer values within those ranges. The number of T cells will depend on the therapeutic use for which the composition is intended for.
[0263] Modified T cells may be administered multiple times at dosages listed above. The T cells may be allogeneic, syngeneic, xenogeneic, or autologous to the patient undergoing therapy.
[0264] The compositions and methods described in the present disclosure may be utilized in conjunction with other types of therapy for cancer, such as chemotherapy, surgery, radiation, gene therapy, and so forth.
[0265] The compositions and methods described in the present disclosure may be used to treat an infectious disease. Infectious diseases are well known to those skilled in the art, and non-limiting examples include but are not limited to infections of viral etiology such as HIV, influenza, Herpes, viral hepatitis, Epstein Bar, polio, viral encephalitis, measles, chicken pox, Papilloma virus; infections of bacterial etiology such as pneumonia, tuberculosis, syphilis; or infections of parasitic etiology such as malaria, trypanosomiasis, leishmaniasis, trichomoniasis, amoebiasi s.
[0266] It is also contemplated that when used to treat various diseases/disorders, the compositions and methods of the present disclosure can be utilized with other therapeutic methods/agents suitable for the same or similar diseases/disorders. Such other therapeutic methods/agents can be co-administered (simultaneously or sequentially) to generate additive or synergistic effects. Suitable therapeutically effective dosages for each agent may be lowered due to the additive action or synergy.
[0267] In some embodiments of any of the above therapeutic methods, the method further comprises administering to the subject one or more additional compounds selected from the group consisting of immuno-suppressives, biologicals, probiotics, prebiotics, and cytokines (e.g., IFN or IL-2).
[0268] As a non-limiting example, the invention can be combined with other therapies that block inflammation (e.g., via blockage of ILL INFα/β, IL6, TNF, IL23, etc.).
[0269] The methods and compositions of the disclosure can be combined with other immunomodulatory treatments such as, e.g., therapeutic vaccines (including but not limited to GVAX, DC-based vaccines, etc.), checkpoint inhibitors (including but not limited to agents that block CTLA4, PD1, LAG3, TIM3, etc.) or activators (including but not limited to agents that enhance 4-1BB, OX40, etc.). The methods of the invention can be also combined with other treatments that possess the ability to modulate NKT function or stability, including but not limited to CD1d, CD1d-fusion proteins, CD dimers or larger polymers of CD either unloaded or loaded with antigens, CD1d-chimeric antigen receptors (CD1d-CAR), or any other of the five known CD1 isomers existing in humans (CD1a, CD1b, CD1c, CD1e). The methods of the invention can also be combined with other treatments such as midostaurin, enasidenib, or a combination thereof.
[0270] Therapeutic methods of the disclosure can be combined with additional immunotherapies and therapies. For example, when used for treating cancer, the compositions of the invention can be used in combination with conventional cancer therapies, such as, e.g., surgery, radiotherapy, chemotherapy or combinations thereof, depending on type of the tumor, patient condition, other health issues, and a variety of factors. In certain aspects, other therapeutic agents useful for combination cancer therapy with the inhibitors of the invention include anti-angiogenic agents. Many anti-angiogenic agents have been identified and are known in the art, including, e.g., TNP-470, platelet factor 4, thrombospondin-1, tissue inhibitors of metalloproteases (TIMP1 and TIMP2), prolactin (16-Kd fragment), angiostatin (38-Kd fragment of plasminogen), endostatin, bFGF soluble receptor, transforming growth factor beta, interferon alpha, soluble KDR and FLT-1 receptors, placental proliferin-related protein, as well as those listed by Carmeliet and Jain (2000). In one embodiment, the T cells of the invention can be used in combination with a VEGF antagonist or a VEGF receptor antagonist such as anti-VEGF antibodies, VEGF variants, soluble VEGF receptor fragments, aptamers capable of blocking VEGF or VEGFR, neutralizing anti-VEGFR antibodies, inhibitors of VEGFR tyrosine kinases and any combinations thereof (e.g., anti-hVEGF antibody A4.6.1, bevacizumab or ranibizumab).
[0271] Non-limiting examples of chemotherapeutic compounds which can be used in combination treatments of the present invention include, for example, aminoglutethimide, amsacrine, anastrozole, asparaginase, azacitidine, bcg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, decitabine, dienestrol, diethylstilbestrol, docetaxel, doxorubicin, epirubicin, estradiol, estramnustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, genistein, goserelin, hydroxyurea, idarubicin, ifosfamide, imatinib, interferon, irinotecan, ironotecan, letrozole, leucovorin, leuprolide, levamisole, lomustine, mechlorethamine, medroxyprogesterone, megestrol, melphalan, mercaptopurine, mesna, methotrexate, mitomycin, mitotane, mitoxantrone, nilutamide, nocodazole, octreotide, oxaliplatin, paclitaxel, pamidronate, pentostatin, plicamycin, porfimer, procarbazine, raltitrexed, rituximab, streptozocin, suramin, tamoxifen, temozolomide, teniposide, testosterone, thioguanine, thiotepa, titanocene dichloride, topotecan, trastuzumab, tretinoin, vinblastine, vincristine, vindesine, and vinorelbine.
[0272] These chemotherapeutic compounds may be categorized by their mechanism of action into, for example, following groups: anti-metabolites/anti-cancer agents, such as pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine) and purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthracyclines, bleomycin, busulfan, camptothecin, carboplatin, chlorambucil, cisplatin, cyclophosphamide, cytoxan, dactinomycin, daunorubicin, doxorubicin, epirubicin, hexamethyhnelamineoxaliplatin, iphosphamide, melphalan, merchlorehtamine, mitomycin, mitoxantrone, nitrosourea, plicamycin, procarbazine, taxol, taxotere, teniposide, triethylenethiophosphoramide and etoposide (VP16)); antibiotics such as dactinomycin (actinomycin D), daunorubicin, doxorubicin (adriamycin), idarubicin, anthracyclines, mitoxantrone, bleomycins, plicamycin (mithramycin) and mitomycin; enzymes (L-asparaginase which systemically metabolizes L-asparagine and deprives cells which do not have the capacity to synthesize their own asparagine); antiplatelet agents; antiproliferative/antimitotic alkylating agents such as nitrogen mustards (mechlorethamine, cyclophosphamide and analogs, melphalan, chlorambucil), ethylenimines and methylmelamines (hexamethylmelamine and thiotepa), alkyl sulfonates-busulfan, nitrosoureas (carmustine (BCNU) and analogs, streptozocin), trazenes-dacarbazinine (DTIC); antiproliferative/antimitotic antimetabolites such as folic acid analogs (methotrexate); platinum coordination complexes (cisplatin, carboplatin), procarbazine, hydroxyurea, mitotane, aminoglutethimide; hormones, hormone analogs (estrogen, tamoxifen, goserelin, bicalutamide, nilutamide) and aromatase inhibitors (letrozole, anastrozole); anticoagulants (heparin, synthetic heparin salts and other inhibitors of thrombin); fibrinolytic agents (such as tissue plasminogen activator, streptokinase and urokinase), aspirin, dipyridamole, ticlopidine, clopidogrel , abciximab; antimigratory agents; anti secretory agents (breveldin); immunosuppressives (cyclosporine, tacrolimus (FK-506), sirolimus (rapamycin), azathioprine, mycophenolate mofetil); anti-angiogenic compounds (e.g., TNP-470, genistein, bevacizumab) and growth factor inhibitors (e.g., fibroblast growth factor (FGF) inhibitors); angiotensin receptor blocker; nitric oxide donors; anti-sense oligonucleotides; antibodies (trastuzumab); cell cycle inhibitors and differentiation inducers (tretinoin); mTOR inhibitors, topoisomerase inhibitors (doxorubicin (adriamycin), amsacrine, camptothecin, daunorubicin, dactinomycin, eniposide, epirubicin, etoposide, idarubicin and mitoxantrone, topotecan, irinotecan), corticosteroids (cortisone, dexamethasone, hydrocortisone, methylpednisolone, prednisone, and prenisolone); growth factor signal transduction kinase inhibitors; mitochondrial dysfunction inducers and caspase activators; and chromatin disruptors.
[0273] In various embodiments of the therapeutic methods described herein, the subject is a human. The subject may be a juvenile or an adult, of any age or sex.
[0274] In accordance with the present invention there may be numerous tools and techniques within the skill of the art, such as those commonly used in molecular biology, pharmacology, and microbiology. Such tools and techniques are described in detail in e.g., Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual. 3rd ed. Cold Spring Harbor Laboratory Press: Cold Spring Harbor, New York; Ausubel et al. eds. (2005) Current Protocols in Molecular Biology. John Wiley and Sons, Inc.: Hoboken, N.J.; Bonifacino et al. eds. (2005) Current Protocols in Cell Biology. John Wiley and Sons, Inc.: Hoboken, N.J.; Coligan et al. eds. (2005) Current Protocols in Immunology, John Wiley and Sons, Inc.: Hoboken, N.J.; Coico et al. eds. (2005) Current Protocols in Microbiology, John Wiley and Sons, Inc.: Hoboken, N.J.; Coligan et al. eds. (2005) Current Protocols in Protein Science, John Wiley and Sons, Inc.: Hoboken, N.J.; and Enna et al. eds. (2005) Current Protocols in Pharmacology, John Wiley and Sons, Inc.: Hoboken, N.J.
EXAMPLES
[0275] The present invention is also described and demonstrated by way of the following examples. However, the use of these and other examples anywhere in the specification is illustrative only and in no way limits the scope and meaning of the invention or of any exemplified term. Likewise, the invention is not limited to any particular preferred embodiments described here. Indeed, many modifications and variations of the invention may be apparent to those skilled in the art upon reading this specification, and such variations can be made without departing from the invention in spirit or in scope. The invention is therefore to be limited only by the terms of the appended claims along with the full scope of equivalents to which those claims are entitled.
Example 1
Identification of Regnase-1 as a Major Negative Regulator of CD8.SUP.+ T cell Antitumor Responses using in vivo CRISPR-Cas9 Mutagenesis Screening
[0276] To systematically investigate metabolism-associated factors whose loss can improve T cell accumulation within tumors, a pooled CRISPR-Cas9 mutagenesis screening approach was developed in a mouse melanoma ACT model (
[0277] First, constitutive Rosa26-Cas9-expressing mice.sup.18 (The Jackson Laboratory) were crossed with OT-I T-cell receptor transgenic mice.sup.19 (The Jackson Laboratory) to express Cas9 in ovalbumin-specific CD8.sup.+ T cells (OT-I cells) that recognize B16 melanoma cells expressing ovalbumin as a surrogate tumor antigen (B16-Ova cells).sup.20. All mice were kept in a specific pathogen-free facility in the Animal Resource Center at St. Jude Children's Research Hospital. Animal protocols were approved by the Institutional Animal Care and Use Committee of St. Jude Children's Research Hospital. Naïve Cas9-expressing OT-I cells were isolated from the spleen and peripheral lymph nodes (PLNs) of Cas9-OT-I mice using naive CD8α.sup.+ T cell isolation kit (Miltenyi Biotec 130-096-543) according to manufacturer's instructions. Purified na-ve OT-I cells were activated in vitro for 18 h with 10 μg/m1 anti-CD3 (2C11; Bio X Cell), 5 μg/ml anti-CD28 (37.51; Bio X Cell) before viral transduction.
[0278] Next, two sub-libraries of sgRNAs were developed, each consisting of 9,051 sgRNAs targeting 3,017 cell metabolism-related genes (6 sgRNAs per gene altogether) encoding metabolic enzymes, small molecule transporters, and metabolism-related transcriptional regulators.sup.21, as well as 500 non-targeting control sgRNAs in a lentiviral vector containing Ametrine fluorescent protein. Viral transduction was performed by spin-infection at 800 g at 25° C. for 3 h with 10 μg/ml polybrene (Sigma). Cells were continued to culture with human IL-2 (20 UI/ml; PeproTech), mouse IL-7 (25 ng/ml; PeproTech) and IL-15 (12.5 ng/ml; PeproTech) for 3-4 days. Transduced cells were sorted using a Reflection (i-Cyt) before adoptive transfer into recipients.
[0279] After transduction of the sgRNA library and in vitro activation and expansion to allow gene editing to occur, sgRNA-transduced OT-I cells were adoptively transferred into B16-Ova melanoma-bearing mice. Seven days later, OT-I cells in tumor-infiltrating lymphocytes (TILs) were purified by flow cytometry, and library representation in TILs and pre-transfer (input) OT-I cells was examined by deep sequencing of sgRNA cassette. sgRNAs capable of improving ACT were expected to be enriched in tumor-infiltrating OT-I cells. After merging the quantification results from two sub-libraries, candidate genes were ranked based on the average enrichment of their 6 gene-specific sgRNAs in tumor-infiltrating OT-I cells relative to input (log.sub.2 ratio (TIL/input); adjusted P<0.05).
[0280] There were a total of 218 genes significantly depleted (by less than −1.0 log.sub.2 ratio (TIL/input); adjusted P<0.05) in the screening, indicative of impaired survival or expansion in the absence of these putative positive regulators of T cell responses, including Txnrd1.sup.22 (log.sub.2 ratio (TIL/input)=−4.23), Ldha.sup.23 (log.sub.2 ratio (TIL/input)=−3.30), Fth1.sup.24 (log.sub.2 ratio (TIL/input)=−3.25), and Foxol.sup.25,26 (log.sub.2 ratio (TIL/input)=−2.39) that are important regulators of T cell survival and expansion (
[0281] For the lentiviral sgRNA metabolic library CRISPR-Cas9 mutagenesis screening, the following methods were used.
[0282] Lentiviral and retroviral sgRNA vector design: The lentiviral sgRNA vector was generated from lentiGuide-puro vector by replacing the “EF-1α PuroR” fragment with a mouse PGK promoter-driven Ametrine (or GFP or mCherry) fluorescent protein. The retroviral sgRNA vector was generated from pLMPd-Amt vector.sup.27 by replacing the miR30 shRNA cassette with the U6 promoter driven gRNA cassette from the lentiGuide-puro vector.
[0283] Lentiviral sgRNA metabolic library construction: The gene list of mouse metabolic library was based on the reported human metabolic genes.sup.21. A total of 6 gRNAs were designed for each mouse metabolic gene according to previously-published selection criteria.sup.28 and were split into two sub-libraries (AAAQ05 and AAAR07), each containing 500 non-targeting controls. sgRNAs were designed by using the online sgRNA design tool (portal s.broadinstitute. org/gpp/public/analysi s-tool s/sgrna-design). Oligonucleotides containing the guide sequence were synthesized (Custom Array), PCR amplified, and cloned into the recipient vector via a Golden Gate cloning procedure, including 5 μl Tango Buffer (ThermoFisher), 5 μl DTT (10 mM stock); 5 μl ATP (10 mM stock); 500 ng vector, pre-digested with Esp3I, gel-extracted, and isopropanol-precipitation purified; 100 ng insert PCR product; 1 μl Esp3I (ThermoFisher ER0452); 1 μl T7 ligase (Enzymatics, 3,000 Units/L6020L); and water, up to 50 and incubated in cycle (5 min at 37° C. and 5 min at 20° C.) for 100 times. The product was then purified by isopropanol precipitation and electroporated into STBL4 cells (Life Technologies 11635018). The distribution of the library was determined by Illumina sequencing.
[0284] Selected sgRNAs used in this study were as follows:
TABLE-US-00001 non-targeting control sgRNA: (SEQ ID NO: 10) ATGACACTTACGGTACTCGT; sgRegnase-1: (SEQ ID NO: 1) AAGGCAGTGGTTTCTTACGA; sgRegnase-1 #2: (SEQ ID NO: 2) GGAGTGGAAACGCTTCATCG; sgBatf: (SEQ ID NO: 3) AGAGATCAAACAGCTCACCG; sgBatf #2: (SEQ ID NO: 4) AGGACTCATCTGATGATGTG; sgPtpn2: (SEQ ID NO: 5) AAGAAGTTACATCTTAACAC; sgPtpn2 #2: (SEQ ID NO: 6) CACTCTATGAGGATAGTCAT; sgSocs1: (SEQ ID NO: 7) TGATGCGCCGGTAATCGGAG; sgSocs1 #2: (SEQ ID NO: 8) TGGTGCGCGACAGTCGCCAA; sgAgps: (SEQ ID NO: 9) GTACCAATGAGTGCAAAGCG; sgRc3h1: (SEQ ID NO: 42) GGTAGAGGGTTACTACCCGG.
[0285] In vivo screening: Lentivirus was produced by co-transfecting HEK293T cells with the lentiviral metabolic library plasmids, psPAX2 (Addgene plasmid # 12260) and pCAG4-Eco. At 48 h after transfection, virus was harvested and froze at −80° C. Four hundred to five hundred million na-ve Cas9-expressing OT-I cells were isolated from 8-14 Cas9-OT-I mice and transduced at a MOI of 0.3 to achieve ˜20% transduction efficiency. After viral transduction, cells were cultured with human IL-2 (20 IU/ml; PeproTech), mouse IL-7 (25 ng/ml; PeproTech) and IL-15 (12.5 ng/ml; PeproTech) for 4 days. Transduced cells expressing Ametrine were sorted using a Reflection sorter (i-Cyt), and an aliquot of 5×10.sup.6 transduced OT-I cells was saved as “input” (˜500× cell coverage per sgRNA). Transduced OT-I cells (5×10.sup.6 cells per recipient) were i. v. transferred into mice at day 14 after B16-Ova melanoma engraftment. Sixty recipients were randomly divided into 3 groups as biological replicates in each sub-library screening. At 7 days after adoptive transfer, transferred Ametrine.sup.+OT-I cells were recovered from the tumor pooled from 20 recipients per sample using a Reflection sorter (i-Cyt). On average, 5×10.sup.5 OT-I cells per sample (˜50× cell coverage per sgRNA) were recovered for further analysis.
[0286] Sequencing library preparation: Genomic DNA was extracted by using the DNeasy Blood & Tissue Kits (Qiagen 69506). Primary PCR was performed by using the KOD Hot Start DNA Polymerase (Millipore 71086) and the following pair of Nextera NGS primers (Nextera NGS-F: TCGTCGGCAGCGTCAGATGTGTATAAGAGACAGttgtggaaaggacgaaacaccg (SEQ ID NO: 11); Nextera NGS-R: GTCTCGTGGGCTCGGAGATGTGTATAAGAGAC AGccactttttcaagttgataacgg (SEQ ID NO: 12). Primary PCR products were purified using the AMPure XP beads (Beckman A63881). A second PCR was performed to add adaptors and indexes to each sample. Hi-Seq 50-bp single-end sequencing (Illumina) was performed.
[0287] Data processing: For data analysis, FastQ files obtained after sequencing were demultiplexed using the HiSeq Analysis software (Illumina). Single-end reads were trimmed and quality-filtered using the CLC Genomics Workbench v11 (Qiagen) and matched against sgRNA sequences from the sgRNA metabolic library. Read counts for sgRNAs were normalized against total read counts across all samples. For each sgRNA, the fold change (log.sub.2 ratio) for enrichment was calculated between each of the biological replicates and the input experiment. Gene ranking was based on the average enrichment among replicates in representation of 6 individual corresponding sgRNAs (combing two sub-libraries) in sgRNA metabolic sub-libraries, respectively. The gene level false discovery rate adjusted P-value was calculated among multiple sgRNAs of each gene, using a paired two-tailed t-test between log.sub.2 transformed average normalized read counts of tumor samples and those of input sample, and a value of less than 0.05 was considered to be statistically significant.
[0288] For tumor-infiltrating lymphocyte (TIL) isolation, B16-Ova melanoma was excised, minced and digested with 0.5 mg/ml Collagenase IV (Roche)+200 IU/ml DNase I (Sigma) for 1 h at 37° C., and then passed through 70 μm filters to remove undigested tumor. TILs were then isolated by density-gradient centrifugation over Percoll (Life Technologies).
[0289] For flow cytometry analysis, cells were stained in PBS (Gibco) containing 2% (wt/vol) BSA (Sigma). Surface proteins were stained for 30 min on ice. Intracellular staining was performed with Foxp3/Transcription Factor Staining Buffer Set according to manufacturer's instructions (eBioscience). Intracellular staining for cytokines was performed with fixation/permeabilization kit (BD Biosciences). Caspase-3 staining was performed using instructions and reagents from the “Active Caspase-3 Apoptosis Kit” (BD Biosciences). BrdU staining was performed using instructions and reagents from the “APC BrdU Flow Kit” (BD Biosciences). 7-AAD (Sigma) or Fixable viability dye (eBioscience) was used for dead cell exclusion. The following antibodies were used: anti-CD27 (LG.7F9), anti-IFN-γ (XMG1.2), anti-TNFα (MAb11), anti-IL-2 (JES6-5H4), anti-CD69 (H1.2F3), anti-CD25 (PC61.5), anti-CD62L (DREG-56), anti-CXCR3 (CXCR3-173), anti-KLRG1 (2F1), anti-ICOS (7E.17G9), anti-Lag3 (C9B7W), anti-PD-1 (J43), anti-CTLA4 (1B8), anti-TOX (TXRX10) (all from eBioscience); anti-GzmB (QA16A02), anti-CD43a (1B11), anti-CD49a (HMα1), anti-CD44 (IM7), anti-Ki-67 (16A8), anti-CD127 (A7R34) (all from Biolegend); anti-BrdU (3D4), anti-active caspase-3 (C92-605), anti-pH2A.X-S139 (N1-431), anti-Slamf6 (13G3) (all from BD Biosciences); anti-BATF (D7C5), anti-Bim (C34C5), anti-TCF-1 (C63D9) (all from Cell Signaling Technology); anti-CD8α (53-6.7) (from SONY); anti-CD62L (MEL-14) (from TONBO Bioscience) and anti-Tim3 (215008) (from R&D). To monitor cell division, lymphocytes were labeled with CellTrace Violet (CTV; Life Technologies). For staining mitochondria, lymphocytes were incubated for 30 min at 37° C. with 10 nM Mito Tracker Deep Red (Life Technologies) or 20 nM TMRM (tetramethylrhodamine, methyl ester; ImmunoChemistry Technologies) after staining surface markers. Flow cytometry data were analyzed using Flowjo 9.9.4 (Tree Star).
[0290] For biological experiment (non-omics) analyses, data were analyzed using Prism 6 software (GraphPad) by two-tailed paired Student's t-test or two-tailed unpaired Student's t-test, or one-way ANOVA with Newman-Keuls's test. Two-way ANOVA was performed for comparing tumor growth curves. Log-rank (Mantel-Cox) test was performed for comparing mouse survival curves. P<0.05 was considered significant. Data are presented as mean±s.d. or mean±s.e.m.
Example 2
Validation of Regnase-1 effects
[0291] To validate the screening results, an in vivo dual transfer system was developed to compare the relative accumulation of OT-I cells transduced with sgRNA lentiviral vectors expressing distinct fluorescent proteins in the same tumor-bearing host (
[0292] For the protein immunoblot analysis, cells were lysed in RIPA buffer (ThermoFisher 89900), resolved in 4-12% Criterion™ XT Bis-Tris Protein Gel (Bio-Rad 3450124) and transferred to PVDF membrane (Bio-Rad 1620177). Membranes were blocked using 5% BSA for 1 h and then incubated for overnight with anti-MCPIP1 antibody (604421) (R&D), anti-BATF (D7C5) (Cell Signaling Technology), anti-PTPN2 (E-11) (Santa Cruz Biotechnology), anti-SOCS1 (E-9) (Santa Cruz Biotechnology), anti-Hsp90 (MAB3286) (R&D) and anti-β-actin (8H10D10) (Cell Signaling Technology). Membranes were washed 6 times with TBST and then incubated with 1:5,000 diluted HRP conjugated anti-mouse IgG (W4021) (from Promega) for 1 h. Following another 6 times of washes with TBST, the membranes were imaged using the ODYSSEY Fc Analyzer (LI-COR).
[0293] For imaging, B16-Ova melanomas were fixed in PBS containing 2% PFA, 0.3% Triton-100 and 1% DMSO for 24 h prior to cryoprotection in 30% sucrose. Cryosections were blocked with 1% BSA and 0.05% Tween-20 in TBS (20 mM Tris, pH 8.0, 100 mM NaCl) for 1 h at room temperature prior to overnight incubation in blocking buffer containing the following antibodies; anti-mCherry (Biorbyt orb11618), anti-GFP (Rockland Immuno 600-401-215), anti-TCF-7 (C63D9) (Cell Signaling Technology 2203), and anti-Tom20 (2F8.1) (Millipore MABT166). Slides were washed in TBS before application of AF488, Cy3 or AF647 secondary antibodies (Jackson Immuno) for 1 h at room temperature prior to mounting with Prolong Diamond hardset media containing DAPI (Thermofisher). Widefield fluorescence microscopy was performed using a motorized Nikon TiE inverted microscope equipped with a 20×Plan Apo 0.75NA objective, standard DAPI, FITC and TRITC filter sets, and an EMCCD camera (Andor). The entire tissue section was stitched based on the DAPI fluorescent signal and the subsequent large images were analyzed using NIS Elements software (Nikon Instruments). Images were segmented per channel, and further refined using a spot identification algorithm to identify single cells and positional information within the tumor. The number of cells per square area was determined following manual delineation of the tumor border. Analysis of transcription factor localization was performed using a Marianis spinning disk confocal microscope (Intelligent Imaging Innovations) equipped with a 100×1.4 NA objective and Prime 95B sCMOS camera, and analyzed using Slidebook software (Intelligent Imaging Innovations).
Example 3
Evaluation of Regnase-1-Deficient CD8.SUP.+ T Cells in Tumor Models
[0294] Given the improved longevity and drastically increased cellularity of Regnase-1-null CD8.sup.+ T cells within tumors, the efficacy of Regnase-1-null CD8.sup.+ T cells in ACT was assessed in three tumor models. First, the therapeutic efficacy of Regnase-1-null OT-I cells was determined against B16-Ova melanoma, an aggressive tumor that is difficult to treat.sup.29. While wild-type OT-I cells had modest therapeutic effects against melanoma, as expected.sup.17, Regnase-1-null OT-I cells showed much stronger antitumor effects, evidenced by markedly inhibited tumor growth and increased survival of melanoma-bearing mice (
[0295] For adoptive T cell transfer for tumor therapy, B16-Ova cells (2×10.sup.5; provided by Dr. Dario Vignali at University of Pittsburgh) or B16-F10 cells (2×10.sup.5; ATCC) were injected subcutaneously into female C57BL/6 mice (7-10 weeks age; from The Jackson Laboratory). At day 12, mice bearing tumors of similar size were randomly divided into 3 groups (5-8 mice per group), and sgRNA-transduced OT-I cells (5×10.sup.6) (for the treatment of B16-Ova melanomas) or pmel-1 (5×10.sup.6) (for the treatment of B16-F10 melanomas) were injected intravenously. Tumors were measured every three days with digital calipers and tumor volumes were calculated by the formula: Length×Width×[(Length×Width) {circumflex over ( )} 0.5]×π/6.sup.32. Death was defined as the point at which a progressively growing tumor reached 15 mm in the longest dimension. For the treatment of huCD19-Ph.sup.+B-ALL, mice engrafted with huCD19-Ph.sup.+B-ALL (1×10.sup.6; provided by Dr. Terrence Geiger at St. Jude Children's Research Hospital) were treated at day 7 with sgRNA-transduced CDS.sup.+ CAR-T cells (5×10.sup.6). Mice were imaged using the Xenogen imaging system (Caliper Life Science).
Example 4
Gene Expression Profiling in Regnase-1-Deficient CD8.SUP.+ T cells
[0296] To systemically identify the differences in immune processes and functional states between Regnase-1-null and wild-type OT-I cells, RNA-Sequencing (RNA-Seq) and bioinformatic analyses of cells isolated from the in vivo dual transfer system were performed to address cell-intrinsic effects. The association of the enhanced long-term persistence of Regnase-1-null TILs with stem-like properties by performing gene set enrichment analysis (GSEA) was determined using gene signatures representative of memory-like CDS.sup.+ T cells (CXCR5.sup.+vs CXCR5.sup.− exhausted cells) in chronic infection.sup.7,8, as well as hematopoietic stem cells (HSCs).sup.33. As compared to wild-type controls, tumor-infiltrating Regnase-1-null OT-I cells had highly enriched gene signatures associated with stem-like CDS.sup.+ T cells and HSC progenitors (
[0297] For gene expression profiling, gene set enrichment analysis (GSEA) and weighted gene co-expression network analysis (WGCNA), control sgRNA- and sgRegnase-1-transduced OT-I cells (n=4-5 biological replicates each group) were isolated from the tumors or PLN of the hosts of the in vivo dual color transfer assay, and analyzed with RNA-Seq. For RNA-Seq, RNA was quantified using the Quant-iT RiboGreen assay (Life Technologies) and quality checked by 2100 Bioanalyzer RNA 6000 Nano assay (Agilent) or LabChip RNA Pico Sensitivity assay (PerkinElmer) prior to library generation. Libraries were prepared from total RNA with the TruSeq Stranded Total RNA Library Prep Kit according to the manufacturer's instructions (Illumina, PN 20020595). Libraries were analyzed for insert size distribution on a 2100 BioAnalyzer High Sensitivity kit (Agilent Technologies) or Caliper LabChip GX DNA High Sensitivity Reagent Kit (PerkinElmer.) Libraries were quantified using the Quant-iT PicoGreen dsDNA assay (Life Technologies) or low pass sequencing with a MiSeq nano kit (Illumina). Paired end 100 cycle sequencing was run on the HiSeq 4000 (Illumina). The raw reads were trimmed for adapter sequences using Trimmomatic v.0.36 using parameters ILLUMINACLIP : adapter. fa: 2 :30: 10 LEADING:10 TRAILING:10 SLIDINGWINDOW : 4 : 18 MINLEN:32, followed by mapping to mm9 reference genome downloaded from gencode release M1 (www.gencodegenes.org/mouse/releases.html) using star v.2.5.2b. with default parameters. Reads were summarized at gene level using python script htseq-count. Differential expression analysis was performed using R package DEseq2 v. 1.18.1. Donor-derived T cells isolated from the tumor-bearing mice that received the individual transfer of sgRNA-transduced OT-I cells (n=3-4 biological replicates each group) were analyzed using microarrays (Affymetrix Mouse Clariom S Assay), which were collected in the following three batches: (a) Control sgRNA-, sgRegnase-1-, and sgBatf/Regnase-1-transduced TIL OT-I cells (n=4 replicates each group); (b) Control sgRNA- and sgBatf-transduced TIL OT-I cells (n=3 replicates each group); and (c) Control sgRNA-, sgRegnase-1-, sgPtpn2-, sgPtpn2I Regnase-1-, sgSocs1-, and sgSocs//Regnase-1-transduced TIL OT-I cells (n=4 replicates each group). For microarray, the expression signals were summarized robust multi-array average algorithm Affymetrix Expression Console v1.1, followed by differential expression analysis performed using R package limma v.3.34.9. All the plots were generated using R package ggplot2 v.2.2.1. Differentially expressed transcripts were identified by ANOVA (Partek Genomics Suite version 6.5), and the Benjamini-Hochberg method was used to estimate the false discovery rate (FDR) as described'. Differentially expressed (DE) genes were defined by |log2 FC|>0.5; P<0.05. To analyze microarray samples from the two different batches (a) and (b) as described above, the batch effect was corrected using removeBatchEffect function implemented in R package limma v.3.34.9. GSEA was performed as described.sup.62 using the “Hallmark” database. For GSEA using manually curated gene signatures from public datasets, microarray dataset (GSE84105).sup.7 was used for generating “CXCR5.sup.+exhausted CD8 (Ahmed)” and “CXCR5.sup.− exhausted CD8 (Ahmed)” gene signatures (<5% FDR); as total upregulated and downregulated genes were more than 200, genes were ranked by their log.sub.2 fold change of expression in CXCR5.sup.+ vs CXCR5.sup.− comparison and used top 200 upregulated genes as “CXCR5.sup.+exhausted CD8 (Ahmed)” and top 200 downregulated genes as “CXCR5.sup.− exhausted CD8 (Ahmed)”. RNA-Seq data (GSE76279).sup.48 was processed using DEseq2 R package v 1.16.1 to generate “CXCR5.sup.+exhausted CD8 (Yu)” and “CXCR5.sup.− exhausted CD8 (Yu)” using the similar strategy as the other signatures above. Similarly, gene signatures of different subsets of hematopoietic stem cells (HSCs) were generated.sup.33. Weighted gene co-expression network analysis (WGCNA) was performed as described.sup.12,49. Briefly, the analysis was performed using WGCNA R package v. 1.66. Total mRNA co-expression clusters were defined using DE genes defined as described above. Pearson correlation matrix was calculated for each experiment followed by an adjacency matrix calculation by raising the correlation matrix to a power of 10 to meet the scale-free topology criterion.sup.49. Co-expression clusters were defined by hybrid dynamic tree cutting method with minimum height for merging module set at 0.2, as described.sup.85. A consensus trend for each co-expression cluster was defined based on the first principal component, and cluster membership was defined as Pearson correlation between individual genes and the consensus trend of the co-expression cluster. Genes were assigned to the most correlated co-expression cluster with cutoff of r≥0.7, as described.sup.85. RNA-Seq and microarray data have been deposited into the GEO series database (www. ncbi .nlm.nih.gov/geo/query/acc.cgi?acc=GSE126072, token for access: ofafckgkxlelxux).
[0298] For ATAC-Seq library preparation, tumor-infiltrating sgRNA-transduced OT-I cells were collected in the following two batches: (a) Control sgRNA- and sgRegnase-1-transduced OT-I cells (n=4 biological replicates each group) were isolated from tumor-bearing mice using the in vivo dual color transfer assay; (b) Control sgRNA-, sgRegnase-1-, sgBatf- and sgBatf/Regnase-1-transduced TIL OT-I cells (n=2-4 replicates each group) were isolated from the tumor-bearing mice that received the individual transfer of sgRNA-transduced OT-I cells. Sorted T cells were incubated in 50 μl ATAC-Seq lysis buffer (10 mM Tris-HCl, pH 7.4, 10 mM NaCl, 3 mM MgCl.sub.2, 0.1% IGEPAL CA-630) on ice for 10 min. Resulting nuclei were pelleted at 500 g for 10 min at 4° C. Supernatant was carefully removed with a pipette and discarded. The pellet was resuspended in 50 μl transposase reaction mix (25 .sub.11.1 2× TD buffer, 22.5 μl nuclease-free water, 2.5 μl Transposase) and incubated for 30 min at 37° C. After the reaction, the DNA was cleaned up using the Qiagen MinElute kit. The barcoding reaction was run using the NEBNext HiFi kit based on manufacturer's instructions and amplified for 5 cycles according to Buenrostro et al..sup.46 using the same primers. Ideal cycle numbers were determined from 5 μl (of 50 μl) from the previous reaction mix using KAPA SYBRFast (Kapa Biosystems) and 20 cycle amplification on an Applied Biosystems 7900HT. Optimal cycles were determined from the linear part of the amplification curve and the remaining 45 μl of PCR reaction was amplified in the same reaction mix using the optimal cycle number.
[0299] ATAC-Seq analysis was performed as described previously.sup.50. Briefly, 2×100 bp paired-end reads obtained from all samples were trimming for Nextera adapter by cutadapt (version 1.9, paired-end mode, default parameter with “-m 6-O 20”) and aligned to mouse genome mm9 (NCBIM37 from Sanger) by BWA (version 0.7.12-r1039, default parameter).sup.51, duplicated reads were then marked with Picard (version 2.6.0-SNAPSHOT) and only non-duplicated proper paired reads have been kept by samtools (parameter “-q 1-F 1804” version 1.2).sup.52. After adjustment of Tn5 shift (reads were offset were offset by +4 bp for the sense strand and -5 bp for the antisense strand) reads were separated into nucleosome free, mononucleosome, dinucleosome, trinucleosome as described.sup.46 by fragment size and generated bigwig files by using the center 80 bp of fragments and scale to 30×10.sup.6 nucleosome free reads. Reasonable nucleosome free peaks and pattern of mono-, di-, tri-nucleosome on IGV (version 2.4.13).sup.53 were observed and all 8 samples have about 10×10.sup.6 nucleosome free reads so the data qualities were concluded as good. Next each 2 replicates were merged to enhance peak calling on nucleosome free reads by MACS2 (version 2.1.1.20160309 default parameters with “-extsize 200-nomodel”).sup.54. To assure the replicability, nucleosome free regions for each genotype were first finalized as only retained a peak if it called with higher cutoff (macs2-q 0.05) in one merged sample and at least called with lower cutoff (macs2-q 0.5) in the other merged sample. There reproducible peaks were further merged between WT and KO and then nucleosome free reads from each of the 8 samples were counted by bedtools (v2.24.0).sup.55. To find the differential accessible regions, raw nucleosome free reads counts were first normalized using trimmed mean of M-values normalization method and applied Empirical Bayes Statistics test after linear fitting from voom package (R 3.23, edgeR 3.12.1, limma 3.26.9).sup.56. FDR-correct P-value 0.05 and fold change >2 were used as cutoff for more accessible regions in KO (KO Larger) or less accessible regions in KO (KO Smaller). For motif analysis, regions <0.05 fold change and P-value >0.5 were further selected as control region. At last, FIMO from MEME suite (version 4.11.3, “-thresh le-4-motif-pseudo 0.0001”).sup.57 have been used for scanning motif (TRANSFAC database, only included Vertebrata and not 3D structure-based) matches in the nucleosome free regions and Fisher's Exact tests have been used to test whether a motif is significant enriched for differential accessible regions compared to the control regions. ATAC-Seq data have been deposited into the GEO series database (www. ncbi .n1 m .nih. gov/geo/query/acc. cgi? acc=GSE126072, token for access: ofafckgkxlelxux).
[0300] Transcription factor binding site footprinting was performed as described previously.sup.50. Briefly, bigwig files have been first generated by all tags of adjusted reads and normalized by autosomes reads number to 2×10.sup.8 reads (e.g. sample with 1×10.sup.8 autosome reads would be scaled to double the bigwig profile). Then average bigwig files have been generated by mean of replicates at each bp for each sample and motif matches within nucleosome free region have been used for footprinting taking the average profile across all motif matches at each bp from −100 bp from motif match centers to +100 bp. Finally, the footprinting profiles have been smoothed with 10 bp bins and plot by deeptools (v2.5.7).sup.58.
[0301] To identify the enrichment of BATF binding motifs, nucleosome-free differentially accessible regions were defined at |log2 FC|>0.5; P<0.05, and the peaks were further annotated as more or less accessible regions in Regnase-1-null OT-I cells compared to wild-type controls. For each group, differentially accessible peaks were overlapped with BATF ChIP-Seq peaks (downloaded from GSE54191.sup.56) to identify the common regions between ATAC-Seq peaks and BATF ChIP-Seq peaks using bedtools (version 2.25.0). Finally, FIMO.sup.591 from MEME suite (version 4.9.0) was used to scan the overlapping regions with TRANSFAC motifs associated with BATF to identify the number of motifs enriched in the differentially accessible regions in Regnase-1-null (shown as ‘# Match (Regnase-1-null)’ in
[0302] For real-time PCR, RNA was isolated using the RNeasy Micro Kit (Qiagen 74004) following the manufacturer's instructions. RNA was converted to cDNA using the High Capacity cDNA Reverse Transcription Kit (ThermoFisher 4368813) according to manufacturer's instructions. Real time PCR was performed on the QuantStudio 7 Flex System (Applied Biosystems) using the PowerSYBR Green PCR Master Mix (ThermoFisher 4367659) and the following primers: Bcl2l1-F: GACAAGGAGATGCAGGTATTGG (SEQ ID NO: 13), Bcl2l1-R: TCCCGTAGAGATCCACAAAAGT (SEQ ID NO: 14); Ifng-F: ACAGCAAGGCGAAAAAGGATG (SEQ ID NO: 15), Ifng-R: TGGTGGACCACTCGGA TGA (SEQ ID NO: 16); Irf4-F: TCCGACAGTGGTTGATCGAC (SEQ ID NO: 17), Irf4-R: CCTCACGATTGTAGTCCTGCTT (SEQ ID NO: 18); Gzma-F: TGCTGCCCACTGTAAC GTG (SEQ ID NO: 19), Gzma-R: GGTAGGTGAAGGATAGCCACAT (SEQ ID NO: 20); Gzmb-F: CCACTCTCGACCCTACATGG (SEQ ID NO: 21), Gzmb-R: GGCCCCC AAAGTGACATTTATT (SEQ ID NO: 22); Actin-F: CGCCACCAGTTCGCCATGGA (SEQ ID NO: 23), Actin-R: TACAGCCCGGGGAGCATCGT (SEQ ID NO: 24).
Example 5
Reprogramming Tumor-Specific CD8.SUP.+ T Cells by Regnase-1 Deletion
[0303] Since T cell differentiation state is an important determinant of in vivo persistence.sup.13,61, the enhanced accumulation of Regnase-1-null TILs prompted determination of their differentiation status by performing gene set enrichment analysis (GSEA) using previously defined gene modules associated with different functional states of CD8.sup.+ T cells in tumor immunity.sup.1,2. As compared to wild-type controls, tumor-infiltrating Regnase-1-null OT-I cells were enriched with naive or memory module (
[0304] Fosb.sup.36,38-40 (
[0305] Interestingly, transcriptional profiling revealed marked differences between tumor-infiltrating and peripheral (from lymph nodes) Regnase-1-null OT-I cells (
EXAMPLE 6
Proliferation and Survival Analyses of Regnase-1-Deficient CDs.SUP.+ T cells
[0306] The cellular homeostasis of Regnase-1-null OT-I cells was determined. GSEA using “Hallmark” gene sets revealed that cell cycling-associated hallmarks, including E2F targets, G2M checkpoint and mitotic spindle, were the top three downregulated pathways in tumor-infiltrating Regnase-1-null cells as compared to wild-type cells (
Example 7
T Cell in vivo Persistence Assays
[0307] It was hypothesized that tumor-infiltrating Regnase-1-null OT-I cells show enhanced in vivo persistence. To this end, WT and Regnase-1-null OT-I cells were isolated from TILs, mixed at 1:1, and transferred them into either inflammation-matched tumor-bearing hosts or na-ve mice (
EXAMPLE 8
Effector Molecular Expression in Tumor-Infiltrating Regnase-1-Deficient CD8.SUP.+ T cells
[0308] Naïve or memory cells and terminally differentiated effector cells are generally considered as exclusive cell fates.sup.64,67. For instance, Tet2-deficient CAR-T cells can adopt a memory cell phenotype with better persistence, but with impaired effector function.sup.4. Interestingly, despite the acquisition of naive/memory cell-associated gene programs of Regnase-1-null OT-I cells in tumors, they had higher expression of activation-associated markers, including CD69, CD49a, KLRG1, ICOS, Tim3, Lag3, PD-1 and CTLA4, while CD25 and CXCR3 expression was largely normal (
Example 9
scRNA-Seq and flow cytometry analyses of tumor-infiltrating Regnase-1-null OT-I Cells
[0309] To further determine the effects of Regnase-1 deletion on tumor-specific OT-I cells, single cell RNA-Sequencing (scRNA-Seq).sup.68 was used to unbiasedly profile transcriptional programs of TILs isolated from the in vivo dual transfer system at day 7 after adoptive transfer, and identified distinct distribution patterns between Regnase-1-null and wild-type cells (
[0310] For scRNA-Seq library preparation, control sgRNA- and sgRegnase-1-transduced OT-I cells were sorted on an iCyt Reflection cell sorter from TILs pooled from the in vivo dual transfer hosts (6-8 mice per sample) at day 7 after adoptive transfer into tumor-bearing mice. The cells were counted and examined for viability using a Luna Dual Florescence Cell Counter (Logos Biosystems). All samples were spun down at 2,000 rpm for 5 min. The supernatant was removed, and cells were re-suspended in 100 μl of 1 ×PBS (Thermo Fisher Scientific)+0.04% BSA (Amresco). The cells were then counted and examined for viability using a Luna Dual Florescence Cell Counter (Logos Biosystems). Cell counts were about 1×10.sup.6 cells per milliliter and viability was above 98%. Single-cell suspensions were loaded onto the Chromium Controller according to their respective cell counts to generate 6,000 single cell GEMs (gel beads in emulsion) per sample. Each sample was loaded into a separate channel. Libraries were prepared using the Chromium Single Cell 3′ v2 Library and Gel Bead Kit (10x Genomics). The cDNA content of each sample after cDNA amplification of 12 cycles was quantified and quality checked using a High-Sensitivity DNA chip with a 2100 Bioanalyzer (Agilent Technologies) to determine the number of PCR amplification cycles to yield sufficient library for sequencing. After library quantification and quality check by DNA 1000 chip (Agilent Technologies), samples were diluted to 3.5 nM for loading onto the HiSeq 4000 (Illumina) with a 2×75 paired-end kit using the following read length: 26 bp Readl, 8 bp i7 Index, and 98 bp Read2. An average of 400,000,000 reads per sample was obtained (approximately 80,000 reads per cell).
[0311] For Alignment, barcode assignment and unique molecular identifier (UMI) counting, the Cell Ranger 1.3 Single-Cell software suite (10× Genomics) was implemented to process the raw sequencing data from the Illumina HiSeq run. This pipeline performed demultiplexing, alignment (using the mouse genome mm10 from ENSEMBL GRCm38), and barcode processing to generate gene-cell matrices used for downstream analysis. Specifically, data from two control sgRNA and two sgRegnase-1-transduced TIL OT-I cell samples were combined into one data set for consistent filtering, and UMIs mapped to genes encoding ribosomal proteins were removed. Cells with low UMI counts (potentially dead cells with broken membranes) or high UMI counts (potentially two or more cells in a single droplet) were filtered. A small fraction of outlier cells (888) was further removed because of their low transcriptome diversity (meaning that fewer genes were detected than in other cells with a comparable number of captured UMIs). A total of 13,879 cells (control sgRNA-transduced, 6,811; sgRegnase-1-transduced, 7,068) were captured, with an average of 11,040 messenger RNA molecules (UMIs, median: 9,391; range: 2,928-44,330). The expression level of each gene was normalized to 100,000 UMIs per cell and log-transformed them by adding 0.5 to the expression matrix.
[0312] For data visualization, underlying cell variations derived from control sgRNA- and sgRegnase-1-transduced TIL OT-I cell single-cell gene expression were visualized in a two-dimensional projection by t-distributed stochastic neighbour embedding (tSNE). Expression of individual genes or pathway scores was color-coded (from low to high, blue-red) for each cell on tSNE plots. To visualize Tcf7-expressing cells, Tcf7.sup.hi cells were defined as cells with the highest third quantile of Tcf7 expression (with log.sub.2 gene expression intensity =2.910317 as threshold) among all cells.
Example 10
Identification of Immune Regulators and OXPHOS Metabolic Pathway using Genome-Scale CRISPR-Cas9 Screening
[0313] To probe the molecular pathways underlying Regnase-1-mediated protective immunity in tumor-specific CD8.sup.+ T cells, a secondary in vivo genome-scale CRISPR-Cas9 mutagenesis screening was performed using Regnase-1-deficient OT-I cells in the melanoma B16-Ova model (
[0314] For the genome-scale sgRNA Brie library CRISPR-Cas9 mutagenesis screening, the following methods were used.
[0315] In vivo screening: Lentivirus was produced by co-transfecting HEK293T cells with lentiviral genome-scale Brie library plasmids with the puromycin resistant gene.sup.77, psPAX2 and pCAG4-Eco. At 48 h after transfection, virus was harvested and froze at −80° C. Two hundred million Cas9-expressing OT-I cells were isolated from 12 Cas9-OT-I mice and co-transduced with Brie sgRNA library and sgRegnase-1-Ametrine. After viral transduction, cells were cultured with human IL-2 (20 IU/ml; PeproTech), mouse IL-7 (25 ng/ml; PeproTech) and IL-15 (12.5 ng/ml; PeproTech) for 2 days. Brie sgRNA library-transduced cells were then selected by culture with 4 μg/ml puromycin in the presence of the abovementioned cytokines for another 3 days. Following puromycin selection, Ametrine.sup.+ cells were sorted using a Reflection sorter (i-Cyt) to select for cells co-transduced with sgRenase-1 and Brie library sgRNAs, and an aliquot of 10×10.sup.6 transduced OT-I cells was saved as input (-120× cells coverage per sgRNA). The majority of the co-transduced OT-I cells (5×10.sup.6 cells per recipient) were then i.v. transferred into mice at day 14 after B16-Ova melanoma engraftment. Twenty recipients were randomly divided into 2 groups as biological replicates. At 7 days after adoptive transfer, transferred Ametrine.sup.+OT-I cells were recovered from the tumor pooled from 10 recipients per sample using a Reflection sorter (i-Cyt). On average, 3×10.sup.6 OT-I cells per sample (˜40× cell coverage per sgRNA) were recovered. DNA extraction and sequencing library preparation were as described in Example 1.
[0316] Data processing: For data analysis, FastQ files obtained after sequencing were demultiplexed using the Hi Seq Analysis software (Illumina). sgRegnase-1 (GGAGTGGAAACGCTTCATCG; (SEQ ID NO: 2)) reads were removed, and single-end reads were trimmed and quality-filtered using the CLC Genomics Workbench vii (Qiagen) and matched against sgRNA sequences from the genome-scale sgRNA Brie library. Read counts for sgRNAs were normalized against total read counts across all samples. For each sgRNA, the fold change (log2 ratio) for enrichment was calculated between each of the biological replicates and the input experiment. Gene ranking was based on the average enrichment among replicates in representation of 4 individual corresponding sgRNAs in the genome-scale sgRNA Brie library. The gene level false discovery rate (FDR) adjusted P-value was calculated among multiple sgRNAs of each gene, using a paired two-tailed t-test between log.sub.2 transformed average normalized read counts of tumor samples and those of input sample, and a value of less than 0.05 was considered to be statistically significant. Identified candidate genes with log2 ratio (TIL/input) >1 are presented in Table 1.
TABLE-US-00002 TABLE 1 Brie library CRISPR-Cas9 mutagenesis screening results ID Symbol log.sub.2R_B_avg log.sub.2R_C_avg log.sub.2R_avg Rank_avg Flag_avg FDR 19255 Ptpn2 3.03103694 3.02918452 3.03011073 1 1 0.03074379 12703 Socs1 2.52286933 1.91519814 2.21903373 2 1 0.03771928 228061 Agps 2.3661194 2.06106624 2.21359282 3 1 0.03416105 64602 Ireb2 1.61204469 2.33695115 1.97449792 4 1 0.06996736 53611 Vti1a 1.86939233 1.78635701 1.82787467 5 1 0.09730926 217864 Rcor1 1.85655273 1.74145244 1.79900259 6 1 0.0894387 73481 1700074P13Rik 1.83755799 1.62905795 1.73330797 7 1 0.06609545 72129 Pex13 1.95120807 1.45465932 1.7029337 8 1 0.09887023 381305 Rc3h1 1.40911805 1.92142968 1.66527387 9 1 0.09909689 74245 Ctbs 1.88845492 1.42972741 1.65909116 10 1 0.05287707 106869 Tnfaip8 1.71532245 1.54472754 1.630025 11 0 0.09843569 73660 Cabp4 1.45873412 1.76204659 1.61039035 12 0 0.10567293 114604 Prdm15 1.33459848 1.82703175 1.58081512 13 0 0.0838152 171508 Creld1 1.62395687 1.5350195 1.57948818 14 0 0.09368323 74315 Rnf145 1.49877812 1.59969823 1.54923818 15 0 0.07332863 14590 Ggh 1.65670065 1.39743515 1.5270679 16 0 0.13589762 19051 Ppp1r17 1.62840681 1.39779346 1.51310013 17 0 0.12254913 17224 Mcpt1 1.37367256 1.630174 1.50192328 18 0 0.13821568 266690 Cyb5r4 1.3572997 1.59893185 1.47811577 19 0 0.13447517 71726 Smug1 1.5026502 1.41804068 1.46034544 20 0 0.12097533 629203 Sult2a3 1.53636928 1.32653562 1.43145245 21 0 0.10305758 21833 Thra 1.43072319 1.39081573 1.41076946 22 0 0.14204162 67921 Ube2f 1.49084237 1.30926107 1.40005172 23 0 0.14858738 258238 Olfr417 1.43977446 1.35008627 1.39493037 24 0 0.15012533 258977 Olfr1273-ps 1.23353661 1.52437603 1.37895632 25 0 0.17499336 17537 Meis3 1.44567538 1.30409252 1.37488395 26 0 0.1302195 17448 Mdh2 1.30097159 1.43134239 1.36615699 27 0 0.11483854 83553 Tktl1 1.4360966 1.28791599 1.3620063 28 0 0.12767619 12626 Cetn3 1.25505016 1.39902074 1.32703545 29 0 0.12830047 108857 Ankhd1 1.21177106 1.43606478 1.32391792 30 0 0.16797524 18214 Ddr2 1.29435522 1.31365101 1.30400311 31 0 0.13323973 74365 Lonrf3 1.34669339 1.25584666 1.30127002 32 0 0.16294965 234577 Cpne2 1.11993149 1.47584619 1.29788884 33 0 0.12901258 258159 Olfr1331 1.37014924 1.21901921 1.29458422 34 0 0.1226376 381101 Dnph1 1.38491612 1.17420704 1.27956158 35 0 0.20233129 56375 B4galt4 1.45453494 1.0816909 1.26811292 36 0 0.14483496 231098 Dnajc5g 1.26529554 1.25267673 1.25898613 37 0 0.14616519 20681 Sox8 1.23180433 1.27755354 1.25467894 38 0 0.17046512 68396 Nat8 1.3205451 1.18055343 1.25054927 39 0 0.16931487 12417 Cbx3 1.25464055 1.2456972 1.25016887 40 0 0.16362677 17681 Msc 1.14559315 1.33318201 1.23938758 41 0 0.15065439 66598 3110001I22Rik 1.20860211 1.25541445 1.23200828 42 0 0.19770332 329421 Myo3b 1.00022792 1.4461835 1.22320571 43 0 0.11593875 232813 Shisa7 1.37239391 1.07397853 1.22318622 44 0 0.30035235 21951 Tnks 1.1330844 1.28120008 1.20714224 45 0 0.16526672 18416 Otc 1.26408708 1.13542511 1.19975609 46 0 0.14019333 218066 Olfr11 1.18323184 1.19603223 1.18963204 47 0 0.17348075 78600 Pde6h 0.98143242 1.39433648 1.18788445 48 0 0.13883771 72748 Hdhd3 1.33344267 1.02469287 1.17906777 49 0 0.22056486 15248 Hic1 1.01260398 1.32168842 1.1671462 50 0 0.11389018 16576 Kif7 1.33447886 0.99297093 1.1637249 51 0 0.1687016 50934 Slc7a8 1.21735282 1.08498001 1.15116641 52 0 0.24675046 74178 Stk40 1.18633507 1.11330582 1.14982045 53 0 0.12883616 224647 D17Wsu92e 1.18292766 1.09612926 1.13952846 54 0 0.12800516 17168 Nprl3 1.63596781 0.60503004 1.12049892 55 0 0.13610581 17684 Cited2 1.18782682 1.01929634 1.10356158 56 0 0.13543798 81018 Rnf114 0.97503528 1.20986689 1.09245108 57 0 0.18776651 216961 Coro6 1.10233206 1.07969782 1.09101494 58 0 0.16732777 12395 Runx1t1 0.9121264 1.26381302 1.08796971 59 0 0.1861355 73542 Tssk5 1.11901358 1.03928858 1.07915108 60 0 0.25320596 114713 Rasa2 0.95787278 1.18588326 1.07187802 61 0 0.18835655 14025 Bcl11a 1.10895794 1.01764532 1.06330163 62 0 0.14133973 100041488 Gm11937 0.78280966 1.33224531 1.05752749 63 0 0.21985822 23829 C1ql1 0.84856001 1.24144288 1.04500145 64 0 0.16564172 60534 Fancg 1.32275719 0.76613433 1.04444576 65 0 0.23150097 19246 Ptpn1 1.09330431 0.98820958 1.04075695 66 0 0.13792429 20822 Trove2 1.13677884 0.9292867 1.03303277 67 0 0.20221657 12349 Car2 0.95841521 1.10573626 1.03207573 68 0 0.1776024 433256 Acsl5 1.1767148 0.88159349 1.02915414 69 0 0.22402518 66641 Sike1 1.03689296 1.01735978 1.02712637 70 0 0.22946066 83456 Mov10l1 1.14324463 0.90902104 1.02613283 71 0 0.36017167 22157 Tulp1 0.9667526 1.08349213 1.02512236 72 0 0.2234767 12367 Casp3 1.33981505 0.70711521 1.02346513 73 0 0.20990722 67290 3110040N11Rik 1.26875939 0.77591139 1.02233539 74 0 0.18352335 258564 Olfr1015 1.09141848 0.95157856 1.02149852 75 0 0.23700427 72361 Ces2g 1.08807329 0.91577384 1.00192357 76 0 0.13846138
Example 11
Identification of a functional target of Regnase-1 in tumor immunity
[0317] Studies were carried out to probe the functional target whose deletion could suppress the excessive accumulation of Regnase-1-null OT-I cells in tumor immunity. Given the role of Regnase-1 in inhibiting gene expression.sup.15,16, two criteria were applied to narrow down the candidates: such candidates should be upregulated in the absence of Regnase-1 in the RNA-Seq analysis, and depleted in TILs in the genome-scale CRISPR-Cas9 screening. Overlaying the top depleted genes (by less than −3.5 log.sub.2 (TIL/input) fold change; adjusted P<0.05) of the genome-scale CRISPR-Cas9 screening with the top upregulated genes (by greater than 1.5 log.sub.2 fold change; P<0.05) in RNA-Seq analysis of Regnase-1-null OT-I cells revealed 2 common candidates, including the transcription factor Batf (
[0318] For the luciferase assay, the full-length 3′ UTR constructs of Batf (MmiT031430-MT06), Il2 (MmiT092987-MT06) and Il4 (MmiT092992-MT06) mRNAs were purchased from GeneCopoeia, each containing two luciferase genes: firefly luciferase gene for 3′ UTR of the targeted gene, and Renilla luciferase gene as an internal control. The cDNA of wild-type Regnase-1 (Dharmacon MMM1013-202800061) was cloned into the pMIG-II vector. The D141N mutant Regnase-1 was generated by site-directed mutagenesis using the KOD Hot Start DNA Polymerase (Millipore 71086). HEK293T cells were transfected with 3′ UTR construct of interest together with wild-type or D141N mutant Regnase-1 expression plasmid or empty control plasmid. At 48 h after transfection, cells were lysed and luciferase activities in the lysates were determined using the Luc-Pair Duo-Luciferase Assay Kit (GeneCopoeia LF002) according to manufacturer's instructions.
Example 12
Regnase-1-BATF Axis Shapes Mitochondrial Metabolism and Effector Responses
[0319] The results from Example 11 suggest that aberrant BATF expression is, at least in part, responsible for the excessive accumulation of Regnase-1-null OT-I cells. BATF co-deletion also elevated cell death (active caspase-3 staining) of Regnase-1-null OT-I cells, although not to the same extent as BATF deletion alone (
[0320] To examine upstream signals that drive aberrant BATF expression in Regnase-1-null OT-I cells, BATF expression was measured in response to TCR, IL-2 or IL-21 stimulation. Stimulation with aCD3 antibody and IL-2 (to a lesser extent) induced aberrant BATF expression in Regnase-1-null OT-I cells compared to wild-type cells (
[0321] For viral transduction to overexpress BATF, the coding sequence of Batf (Addgene # 34575) was subcloned into pMIG-II retroviral vector (Addgene # 52107), which was co-transfected into Plat-E cells with the helper plasmid pCL-Eco (Addgene # 12371) for the production of retrovirus.
[0322] BATF is a pioneer factor that controls chromatin accessibility, which allows subsequent binding by other transcription factors.sup.9,75. To directly determine the contribution of aberrant BATF expression to the altered chromatin accessibility in Regnase-1-null cells, ATAC-Seq analysis was performed by comparing wild-type, Regnase-1-null, BATF-null, and BATF/Regnase-1-null cells isolated from TILs. 7,480 genes were identified with significantly increased chromatin accessibility in Regnase-1-null cells as compared to wild-type cells (
[0323] To further dissect BATF-dependent and independent pathways associated with Regnase-1 function, transcriptome analysis was performed by comparing wild-type, Regnase-1-null, BATF-null, and BATF/Regnase-1-null cells isolated from TILs. Principal component analysis (PCA) of global expression profiles revealed that compared with Regnase-1-null cells, BATF/Regnase-1-null OT-I cells showed considerably less variance from wild-type cells (
[0324] Next the functional pathways underlying Regnase-1-mediated protective immunity were determined in tumor-specific CDS.sup.+ T cells. Of note, functional enrichment of the top-ranking depleted genes of the secondary in vivo genome-scale CRISPR-Cas9 mutagenesis screening revealed that oxidative phosphorylation (OXPHOS) hallmark was the top-ranked pathway (
[0325] To understand the molecular basis for Regnase-1 and BATF-mediated regulation of mitochondrial fitness, first the ATAC-Seq data of wild-type, Regnase-1-null, BATF-null, and BATF/Regnase-1-null OT-I cells from TILs were mined for altered chromatin accessibility of mitochondrial genes defined in the MitoCarta 2.0 database.sup.11,12. A total of 341 mitochondrial genes showed significantly upregulated chromatin accessibility in the absence of Regnase-1 (
Example 13
Identification of Additional Targets for Adoptive Cell Transfer (ACT)
[0326] To further explore the therapeutic potential of Regnase-1-null CD8.sup.+ T cells, the top enriched genes were examined in TILs in the genome-scale CRISPR-Cas9 mutagenesis screening. It was reasoned that if a candidate gene could further improve the accumulation of Regnase-1-null OT-I cells, its sgRNAs should be enriched in TILs. The top candidate genes were chosen for further analysis, including Ptpn2, Socs1 and Agps (
[0327] It was found that expression of PTPN2 and SOCS1 was, unlike BATF, not affected by Regnase-1 deletion (
[0328] Given the increased accumulation of tumor-infiltrating PTPN2/Regnase-1-null and SOCS1/Regnase-1-null CD8.sup.+ T cells as compared to Regnase-1-null cells (
[0329] Altogether, the CRISPR-Cas9 mutagenesis screening identifies additional potential targets to combine with Regnase-1 deletion for combinatorial cancer immunotherapy.
[0330] As shown in the Examples described above, by integrating focused and genome-scale CRISPR screening, bioinformatic analyses and extensive experimental validation, it is revealed that tumor-specific CD8.sup.+ T cells can be reprogrammed in the TME to acquire extensive accumulation and increased naive/memory cell-associated features (more quiescence, better survival and naive/memory cell-associated gene signatures) for long-term persistence, while retaining robust effector function (
[0331] The results highlight that Regnase-1 restrains mitochondrial metabolism and effector responses through a key gene target BATF, which is identified through a secondary in vivo genome-scale CRISPR-Cas9 screening in immune cells. The Examples presented above reveal Regnase-1 as a major negative regulator of BATF and a previously unappreciated role of BATF as a limiting factor for programming effective antitumor responses, in part through shaping mitochondrial metabolism, thereby contributing to the understanding of the context-dependent roles of the pioneer factor BATF in adaptive immunity.sup.9,76,85. The genome-scale CRISPR-Cas9 screening also reveals PTPN2, SOCS1 and Roquin-1 (encoded by Rc3h1) as potential targets to be deleted alone or to combine with Regnase-1 deletion to boost antitumor immunity.
Example 14
Regnase-1 Deficient Human CAR-T Cells have Improved Survival and Function
[0332] Generation of Regenase-1 knockout human CAR-T cells
[0333] First, the gRNAs to knock out Regenase-1 in human CD4 and CD8 CAR-T cells were designed in silico based on selected off-target profiles shown in Table 2.
[0334] In Table 2, “long_0” refers to the number of sites in genome that are an exact match to the full-length (“long”) 23nt gRNA target sequence listed in the table, including the target site; “long_1” refers to the number of sites in genome that contain up to 1 mismatch in the 23nt gRNA target sequence listed in the table, including the target site; “long_2” refers to the number of sites in genome that contain up to 2 mismatches in the 23nt gRNA target sequence listed in the table, including the target site; and “short_0” refers to the number of sites in genome that match to the 15nt fragment (“short”) at the 3′ end of the gRNA target sequence listed in the table, including the target site.
TABLE-US-00003 TABLE 2 Details of gRNAs designed for Regnase-1 knockout Name gRNA long_0 long_1 long_2 short_0 SNP gRNA-1 TTCACACCATCACGACGCGTNGG 1 1 1 1 NA (SEQ ID NO: 29) gRNA-2 TGGGGGCAGCTTGGCCGCTCNGG 1 1 1 3 NA (SEQ ID NO: 30) gRNA-3 TATGCCCCCTGATGACCCACNGG 1 1 1 21 NA (SEQ ID NO: 31) gRNA-4 AAGGAGGTCTTCTCCTGCCGNGG 1 1 1 8 NA (SEQ ID NO: 32) gRNA-5 GTGATGGGCACGTCGGGCCGNGG 1 1 1 1 NA (SEQ ID NO: 33) gRNA-6 CAGCTCCCTCTAGTCCCGCGNGG (SEQ ID NO: 34) control GCUUGUGGAUGUUGCGGAAGNGG gRNA (SEQ ID NO: 35)
[0335] The sequences for gRNAs 1-5 were designed by CAGE while the sequence for gRNA-6 was selected from portals.broadinstitute. org/gpp/public/analysi s-tools/sgrna-design.
[0336] Knockout of Regenase-1 gene in human CAR-T cells by CRISPR-Cas9
[0337] The following protocol was used to knock out the Regenase-1 gene in human CD8 T cells.
[0338] On Day 0, human na-ve CD4 or CD8 T cells were isolated by sorting CCR7.sup.+ CD45RA.sup.+ CD45RO.sup.−CD4.sup.+ T cells or CCR7.sup.+ CD45RA.sup.+ CD45RO.sup.−CD8.sup.+ T cells. The isolated CD4 and CD8 T cells were activated by plating on CD3/CD28 coated plates.
[0339] On Day 1, CD19-CAR transduction using a lentiviral vector was used to introduce CD19-CAR into the activated CD4 or CD8 T cells.
[0340] On Day 2, one of the six candidate gene gRNAs or control non-targeting gRNA in complex with Cas9 protein were electroporated into the T cells collected from the culture plates according to the following protocol.
[0341] Purified Cas9 protein and guide RNA oligonucleotides were combined to form a ribonucleoprotein (RNP) complex. Specifically, the selected single guide RNA (sgRNA) was re-suspended at 100μM (1.5 nmol in 15μl water) in approximately 13-14 μL aliquots, and the Cas9 protein was prepared at a concentration of 40 μM (40 pmol/μL) in approximately 10 μL aliquots.
[0342] The RNP was prepared by mixing the gRNA and Cas9 protein following these conditions in PCR tubes: 1.8 μL (100 pmol/μ1, 180 pmol) gRNA is mixed with 1 μL (40 pmol/μL, 40 pmol) Cas9 protein, for a total volume of 2.8 pl. After briefly mixing, the RNP was incubated at room temperature for 10 minutes before being placed at 4° C. until ready for use.
[0343] The T cells were resuspended in complete RPMI medium and counted. The T cells were centrifuged for 5 min at 1300rpm, aspirated, washed with PBS once, and resuspended at 25M/m1 in Lonza electroporation buffer P3 from the Lonza Amaxa™ P3 primary cell 96-well Nucleofector™Kit (Cat. No. V4SP-3096). The T cells were resuspended at a ratio of 20 μl Lonza electroporation buffer P3 per 0.5 million cells. The T cells were briefly mixed by pipetting with 2.8 μl RNP mixture. The RNP and cells mixture was transferred to an electroporation cuvette. Immediately after electroporation, 80μl of pre-warmed media (without cytokine) was added to each cuvette. The cells were allowed to rest for 15 mins at 37° C. in the incubator while remaining in the cuvettes. After 15 mins, cells were moved to 24-well tissue culture plate by adding the cell suspension directly to one well containing 500 μL complete RPMI medium with IL-7 and IL-15.
[0344] For optimal editing, 0.5 million T cells were electroporated per well using a Lonza 4D 96-well electroporation system (Lonza 4D Nucleofector™ Core Unit) with pulse code EO115. Electroporation was completed until green crossing was observed on the samples. Alternate cell concentrations from 200,000 up to 2 million cells per well resulted in lower transformation efficiencies.
[0345] On Day 6, the T cell status was checked and the ability of the T cells to be co-cultured with Raji cells, including killing of the Raji cells, was measured for 24 hrs and 48 hrs.
[0346] On Day 10, samples of the T cells were taken for Western blotting and deep sequencing, or used for in vivo study.
[0347] Characterization of the CD4 and CD8 Regnase-1-null CAR-T cells
[0348] The deep sequencing results are shown in
[0349] As shown in
[0350] The human Regnase-1-null CAR-T cells were tested to see if they could be multi-activated with bulk T cells. The CAR-T cells were stimulated with irradiated Raji cells at a ratio of 2:1 every 7 days. T cell phenotypes were measured 24 hours after each stimulation.
[0351] The proliferative and apoptotic properties of the human CD4 and CD8 Regnase-1-null CAR-T cells were determined ex vivo. The proliferative capabilities were measured by cell-trace violet (CTV). Before a third round of activation, the CD4 and CD8 Regnase-1-null CAR-T cells were labeled with CTV. Seventy-two hours after activation, the T cell proliferation was measured. Cell apoptosis was measured 72 hours after a third round of stimulation with irradiated Raji tumor cells.
[0352] The ability of the Regnase-1-null CAR-T cells to generate different types of memory T cells was studied. The differentiation status of CD4 and CD8 Regenase-1-null CAR-T cells was determined after each of three rounds of stimulation with irradiated Raji tumor cells. The differentiated T cells were sorted based on CCR7 and CD45R0 expression into the following four groups: (1) naive (CD45RO.sup.−CCR7.sup.+), (2) central memory (CD45RO.sup.+CCR7.sup.+), (3) effector memory (CD45RO.sup.+CCR7.sup.−), and (4) effector (CD45RO.sup.−CCR7.sup.−).
[0353] The effect of the Regnase-1 knockout on cytokine production was then measured. The levels of selected cytokines were measured 24 hours after the third stimulation with irradiated Raji tumor cells.
[0354] The effect of the Regnase-1 knockout on the CD25 activation status of the Regnase-1-null CD8 CAR-T cells was then measured. The CD25 activation status of the cells was measured 24 hours after each of three rounds of stimulation with irradiated Raji tumor cells.
[0355] The effect of the Regnase-1 knockout on the mitochondrial activity of the Regnase-1-null CD8 CAR-T cells was then measured. The mitochondrial activity of the cells was measured 24 hours after the third stimulation with irradiated Raji tumor cells.
[0356] The effect of the Regnase-1 knockout on the activity of certain cell proliferation and mitochondrial-activity related genes was measured in Regnase-1-null CD8 CAR-T cells.
[0357] The effect of the Regnase-1 knockout on the ability of mice to survive tumor transfer with Raji cells was measured in vivo. The Raji cells were engrafted for two weeks in NSG mice and the tumors were observed by Xenogen imaging. Bulk Regnase-1-null CD8 CAR-T cells and wildtype CD8 CAR-T cells were then transferred into the mice at 1 million cells per mouse (approximately 50% CAR+). At the two-week mark, nine mice received the Regnase-1-null CD8 CAR-T cells, five mice received the wildtype CD8 CAR-T cells, and seven mice did not receive any treatment. The tumors were observed and quantified by Xenogen imaging every seven days after the T-cell treatment.
[0358] The effect of the Regnase-1 knockout on the cytotoxicity and survival of CAR-T cells was measured. For the ex vivo cytotoxicity assay, Regnase-1-null cells and wildtype CAR-T cells were incubated with Raji cells at different effector and target ratios. Twenty-four hours later, the number of live tumor cells was measured. For the ex vivo survival assay, na-ve CD8 T cells were used. The CAR-T cells were stimulated with irradiated Raji cells at a ratio of 2:1 every seven days. The T cell phenotypes were measured 24 hours after each stimulation.
[0359] The effect of the Regnase-1 knockout on the expression of certain cell hyper-activity markers was measured in Regnase-1-null CD4 and CD8 CAR-T cells. The expression of exhaustion markers PD-1, LAG3, and TIM-3 was measured 24 hours after a third stimulation with irradiated Raji tumor cells.
REFERENCES
[0360] 1 Lim, W. A. & June, C. H. The Principles of Engineering Immune Cells to Treat Cancer. Cell 168, 724-740, doi:10.1016/j.ce11.2017.01.016 (2017). [0361] 2 Sadelain, M., Riviere, I. & Riddell, S. Therapeutic T cell engineering. Nature 545, 423-431, doi:10.1038/nature22395 (2017). [0362] 3 Gattinoni, L. et al. Acquisition of full effector function in vitro paradoxically impairs the in vivo antitumor efficacy of adoptively transferred CD8+T cells. J Clin Invest 115, 1616-1626, doi:10.1172/JCI24480 (2005). [0363] 4 Fraietta, J. A. et al. Disruption of TET2 promotes the therapeutic efficacy of CD19-targeted T cells. Nature 558, 307-312, doi:10.1038/s41586-018-0178-z (2018). [0364] 5 Schreiber, R. D., Old, L. J. & Smyth, M. J. Cancer immunoediting: integrating immunity's roles in cancer suppression and promotion. Science 331, 1565-1570, doi:10.1126/science.1203486 (2011). [0365] 6 Wei, J. et al. Targeting REGNASE-1 programs long-lived effector T cells for cancer therapy. Nature 576, 471-476, doi:10.1038/s41586-019-1821-z (2019). [0366] 7 Im, S. J. et al. Defining CD8+T cells that provide the proliferative burst after PD-1 therapy. Nature 537, 417-421, doi:10.1038/nature19330 (2016). [0367] 8 Leong, Y. A. et al. CXCRS(+) follicular cytotoxic T cells control viral infection in B cell follicles. Nat Immunol 17, 1187-1196, doi:10.1038/ni.3543 (2016). [0368] 9 Kurachi, M. et al. The transcription factor BATF operates as an essential differentiation checkpoint in early effector CD8+T cells. Nat Immunol 15, 373-383, doi:10.1038/ni.2834 (2014). [0369] 10 Singer, M. et al. A Distinct Gene Module for Dysfunction Uncoupled from Activation in Tumor-Infiltrating T Cells. Cell 166, 1500-1511 e1509, doi:10.1016/j.ce11.2016.08.052 (2016). [0370] 11 Calvo, S. E., Clauser, K. R. & Mootha, V. K. MitoCarta2.0: an updated inventory of mammalian mitochondrial proteins. Nucleic Acids Res 44, D1251-1257, doi:10.1093/nar/gkv1003 (2016). [0371] 12 Tan, H. et al. Integrative Proteomics and Phosphoproteomics Profiling Reveals Dynamic Signaling Networks and Bioenergetics Pathways Underlying T Cell Activation. Immunity 46, 488-503, doi:10.1016/j.immuni.2017.02.010 (2017). [0372] 13 Kishton, R. J., Sukumar, M. & Restifo, N. P. Metabolic Regulation of T Cell Longevity and Function in Tumor Immunotherapy. Cell Metab 26, 94-109, doi:10.1016/j.cmet.2017.06.016 (2017). [0373] 14 Buck, M. D., Sowell, R. T., Kaech, S. M. & Pearce, E. L. Metabolic Instruction of Immunity. Cell 169, 570-586, doi:10.1016/j.ce11.2017.04.004 (2017). [0374] 15 Matsushita, K. et al. Zc3h12a is an RNase essential for controlling immune responses by regulating mRNA decay. Nature 458, 1185-1190, doi:10.1038/nature07924 (2009). [0375] 16 Uehata, T. et al. Maltl-induced cleavage of regnase-1 in CD4(+) helper T cells regulates immune activation. Cell 153, 1036-1049, doi:10.1016/j.ce11.2013.04.034 (2013). [0376] 17 Zhou, P. et al. In vivo discovery of immunotherapy targets in the tumour microenvironment. Nature 506, 52-57, doi:10.1038/nature12988 (2014). [0377] 18 Platt, R. J. et al. CRISPR-Cas9 knockin mice for genome editing and cancer modeling. Cell 159, 440-455, doi:10.1016/j.ce11.2014.09.014 (2014). [0378] 19 Hogquist, K. A. et al. T cell receptor antagonist peptides induce positive selection. Cell 76, 17-27 (1994). [0379] 20 Bellone, M. et al. Relevance of the tumor antigen in the validation of three vaccination strategies for melanoma. J Immunol 165, 2651-2656 (2000). [0380] 21 Birsoy, K. et al. An Essential Role of the Mitochondrial Electron Transport Chain in Cell Proliferation Is to Enable Aspartate Synthesis. Cell 162, 540-551, doi:10.1016/j.ce11.2015.07.016 (2015). [0381] 22 Muri, J. et al. The thioredoxin-1 system is essential for fueling DNA synthesis during T-cell metabolic reprogramming and proliferation. Nat Commun 9, 1851, doi:10.1038/s41467-018-04274-w (2018). [0382] 23 Peng, M. et al. Aerobic glycolysis promotes T helper 1 cell differentiation through an epigenetic mechanism. Science 354, 481-484, doi:10.1126/science.aaf6284 (2016). [0383] 24 Vanoaica, L. et al. Conditional deletion of ferritin h in mice reduces B and T lymphocyte populations. PLoS One 9, e89270, doi:10.1371/journal.pone.0089270 (2014). [0384] 25 Kerdiles, Y. M. et al. Foxol links homing and survival of naive T cells by regulating L-selectin, CCR7 and interleukin 7 receptor. Nat Immunol 10, 176-184, doi:10.1038/ni.1689 (2009). [0385] 26 Ouyang, W., Beckett, 0., Flavell, R. A. & Li, M. 0. An essential role of the Forkhead-box transcription factor Foxol in control of T cell homeostasis and tolerance. Immunity 30, 358-371, doi:10.1016/j.immuni.2009.02.003 (2009). [0386] 27 Chen, R. et al. In vivo RNA interference screens identify regulators of antiviral CD4(+) and CD8(+) T cell differentiation. Immunity 41, 325-338, doi:10.1016/j.immuni.2014.08.002 (2014). [0387] 28 Sanson, K. R. et al. Optimized libraries for CRISPR-Cas9 genetic screens with multiple modalities. Nat Commun 9, 5416, doi:10.1038/s41467-018-07901-8 (2018). [0388] 29 Fidler, I. J. Biological behavior of malignant melanoma cells correlated to their survival in vivo. Cancer Res 35, 218-224 (1975). [0389] 30 Overwijk, W. W. et al. Tumor regression and autoimmunity after reversal of a functionally tolerant state of self-reactive CD8+T cells. J Exp Med 198, 569-580, doi:10.1084/jem.20030590 (2003). [0390] 31 Churchman, M. L. et al. Synergism of FAK and tyrosine kinase inhibition in Ph(+) B-ALL. JCI Insight 1, doi:10.1172/jci.insight.86082 (2016). [0391] 32 Wei, J. et al. Autophagy enforces functional integrity of regulatory T cells by coupling environmental cues and metabolic homeostasis. Nat Immunol 17, 277-285, doi:10.1038/ni.3365 (2016). [0392] 33 Ivanova, N. B. et al. A stem cell molecular signature. Science 298, 601-604, doi:10.1126/science.1073823 (2002). [0393] 34 Ochsenbein, A. F. et al. CD27 expression promotes long-term survival of functional effector-memory CD8+cytotoxic T lymphocytes in HIV-infected patients. J Exp Med 200, 1407-1417, doi:10.1084/jem.20040717 (2004). [0394] 35 Harrington, L. E., Galvan, M., Baum, L. G., Altman, J. D. & Ahmed, R. Differentiating between memory and effector CD8 T cells by altered expression of cell surface 0-glycans. J Exp Med 191, 1241-1246 (2000). [0395] 36 Hurton, L. V. et al. Tethered IL-15 augments antitumor activity and promotes a stem-cell memory subset in tumor-specific T cells. Proc Natl Acad Sci USA 113, E7788-E7797, doi:10.1073/pnas.1610544113 (2016). [0396] 37 Yang, C. Y. et al. The transcriptional regulators Id2 and Id3 control the formation of distinct memory CD8+T cell subsets. Nat Immunol 12, 1221-1229, doi:10.1038/ni.2158 (2011). [0397] 38 Zhou, X. et al. Differentiation and persistence of memory CD8(+) T cells depend on T cell factor 1. Immunity 33, 229-240, doi:10.1016/j.immuni.2010.08.002 (2010). [0398] 39 Roychoudhuri, R. et al. BACH2 regulates CD8(+) T cell differentiation by controlling access of AP-1 factors to enhancers. Nat Immunol 17, 851-860, doi:10.1038/ni.3441 (2016). [0399] 40 Ichii, H., Sakamoto, A., Kuroda, Y. & Tokuhisa, T. Bc16 acts as an amplifier for the generation and proliferative capacity of central memory CD8+T cells. J Immunol 173, 883-891 (2004). [0400] 41 Wherry, E. J. et al. Molecular signature of CD8+T cell exhaustion during chronic viral infection. Immunity 27, 670-684, doi:10.1016/j.immuni.2007.09.006 (2007). [0401] 42 Waugh, K. A. et al. Molecular Profile of Tumor-Specific CD8+T Cell Hypofunction in a Transplantable Murine Cancer Model. J Immunol 197, 1477-1488, doi:10.4049/jimmuno1.1600589 (2016). [0402] 43 Man, K. et al. Transcription Factor IRF4 Promotes CD8(+) T Cell Exhaustion and Limits the Development of Memory-like T Cells during Chronic Infection. Immunity 47, 1129-1141 e1125, doi:10.1016/j.immuni.2017.11.021 (2017). [0403] 44 Wherry, E. J. & Kurachi, M. Molecular and cellular insights into T cell exhaustion. Nat Rev Immunol 15, 486-499, doi:10.1038/nri3862 (2015). [0404] 45 Sade-Feldman, M. et al. Defining T Cell States Associated with Response to Checkpoint Immunotherapy in Melanoma. Cell 175, 998-1013 e1020, doi:10.1016/j.ce11.2018.10.038 (2018). [0405] 46 Buenrostro, J. D., Giresi, P. G., Zaba, L. C., Chang, H. Y. & Greenleaf, W. J. Transposition of native chromatin for fast and sensitive epigenomic profiling of open chromatin, DNA-binding proteins and nucleosome position. Nat Methods 10, 1213-1218, doi:10.1038/nmeth.2688 (2013). [0406] 47 Zeng, H. et al. mTORC1 couples immune signals and metabolic programming to establish T(reg)-cell function. Nature 499, 485-490, doi:10.1038/nature12297 (2013). [0407] 48 He, R. et al. Follicular CXCRS- expressing CD8(+) T cells curtail chronic viral infection. Nature 537, 412-428, doi:10.1038/nature19317 (2016). [0408] 49 Zhang, B. & Horvath, S. A general framework for weighted gene co-expression network analysis. Stat Appl Genet Mol Biol 4, Article17, doi:10.2202/1544-6115.1128 (2005). [0409] 50 Karmaus, P. W. F. et al. Metabolic heterogeneity underlies reciprocal fates of TH17 cell stemness and plasticity. Nature 565, 101-105, doi:10.1038/s41586-018-0806-7 (2019). [0410] 51 Li, H. & Durbin, R. Fast and accurate short read alignment with Burrows-Wheeler transform. Bioinformatics 25, 1754-1760, doi:10.1093/bioinformatics/btp324 (2009). [0411] 52 Li, H. et al. The Sequence Alignment/Map format and SAMtools. Bioinformatics 25, 2078-2079, doi:10.1093/bioinformatics/btp352 (2009). [0412] 53 Robinson, J. T. et al. Integrative genomics viewer. Nat Biotechnol 29, 24-26, doi:10.1038/nbt.1754 (2011). [0413] 54 Zhang, Y. et al. Model-based analysis of ChIP-Seq (MACS). Genome Biol 9, R137, doi:10.1186/gb-2008-9-9-r137 (2008). [0414] 55 Quinlan, A. R. & Hall, I. M. BEDTools: a flexible suite of utilities for comparing genomic features. Bioinformatics 26, 841-842, doi:10.1093/bioinformatics/btq033 (2010). [0415] 56 Law, C. W., Chen, Y., Shi, W. & Smyth, G. K. voom: Precision weights unlock linear model analysis tools for RNA-seq read counts. Genome Biol 15, R29, doi:10.1186/gb-2014-15-2-r29 (2014). [0416] 57 Bailey, T. L. et al. MEME SUITE: tools for motif discovery and searching. Nucleic Acids Res 37, W202-208, doi:10.1093/nar/gkp335 (2009). [0417] 58 Ramirez, F., Dundar, F., Diehl, S., Gruning, B. A. & Manke, T. deepTools: a flexible platform for exploring deep-sequencing data. Nucleic Acids Res 42, W187-191, doi:10.1093/nar/gku365 (2014). [0418] 59 Cuellar-Partida, G. et al. Epigenetic priors for identifying active transcription factor binding sites. Bioinformatics 28, 56-62, doi:10.1093/bioinformatics/btr614 (2012). [0419] 60 Krishnamoorthy, V. et al. The IRF4 Gene Regulatory Module Functions as a Read-Write Integrator to Dynamically Coordinate T Helper Cell Fate. Immunity 47, 481-497 e487, doi:10.1016/j.immuni.2017.09.001 (2017). [0420] 61 Sukumar, M. et al. Mitochondrial Membrane Potential Identifies Cells with Enhanced Stemness for Cellular Therapy. Cell Metab 23, 63-76, doi:10.1016/j.cmet.2015.11.002 (2016). [0421] 62 Moroz, A. et al. IL-21 enhances and sustains CD8+T cell responses to achieve durable tumor immunity: comparative evaluation of IL-2, IL-15, and IL-21. J Immunol 173, 900-909, doi:10.4049/jimmuno1.173.2.900 (2004). [0422] 63 Wang, W. et al. Effector T Cells Abrogate Stroma-Mediated Chemoresistance in Ovarian Cancer. Cell 165, 1092-1105, doi:10.1016/j.ce11.2016.04.009 (2016). [0423] 64 Sarkar, S. et al. Functional and genomic profiling of effector CD8 T cell subsets with distinct memory fates. J Exp Med 205, 625-640, doi:10.1084/jem.20071641 (2008). [0424] 65 Nakamura-Ishizu, A., Takizawa, H. & Suda, T. The analysis, roles and regulation of quiescence in hematopoietic stem cells. Development 141, 4656-4666, doi:10.1242/dev.106575 (2014). [0425] 66 Sprent, J. & Surh, C. D. Normal T cell homeostasis: the conversion of naive cells into memory-phenotype cells. Nat Immunol 12, 478-484 (2011). [0426] 67 Chang, J. T., Wherry, E. J. & Goldrath, A. W. Molecular regulation of effector and memory T cell differentiation. Nat Immunol 15, 1104-1115, doi:10.1038/ni.3031 (2014). [0427] 68 Macosko, E. Z. et al. Highly Parallel Genome-wide Expression Profiling of Individual Cells Using Nanoliter Droplets. Cell 161, 1202-1214, doi:10.1016/j.ce11.2015.05.002 (2015). [0428] 69 Khan, O. et al. TOX transcriptionally and epigenetically programs CD8(+) T cell exhaustion. Nature 571, 211-218, doi:10.1038/s41586-019-1325-x (2019). [0429] 70 Yao, C. et al. Single-cell RNA-seq reveals TOX as a key regulator of CD8(+) T cell persistence in chronic infection. Nat Immunol 20, 890-901, doi:10.1038/s41590-019-0403-4 (2019). [0430] 71 Alfei, F. et al. TOX reinforces the phenotype and longevity of exhausted T cells in chronic viral infection. Nature 571, 265-269, doi:10.1038/s41586-019-1326-9 (2019). [0431] 72 Scott, A. C. et al. TOX is a critical regulator of tumour-specific T cell differentiation. Nature 571, 270-274, doi:10.1038/s41586-019-1324-y (2019). [0432] 73 Miller, B. C. et al. Subsets of exhausted CD8(+) T cells differentially mediate tumor control and respond to checkpoint blockade. Nat Immunol 20, 326-336, doi:10.1038/s41590-019-0312-6 (2019). [0433] 74 Utzschneider, D. T. et al. T Cell Factor 1-Expressing Memory-like CD8(+) T Cells Sustain the Immune Response to Chronic Viral Infections. Immunity 45, 415-427, doi:10.1016/j.immuni.2016.07.021 (2016). [0434] 75 Ciofani, M. et al. A validated regulatory network for Th17 cell specification. Cell 151, 289-303, doi:10.1016/j.ce11.2012.09.016 (2012). [0435] 76 LaFleur, M. W. et al. A CRISPR-Cas9 delivery system for in vivo screening of genes in the immune system. Nat Commun 10, 1668, doi:10.1038/s41467-019-09656-2 (2019). [0436] 77 Doench, J. G. et al. Optimized sgRNA design to maximize activity and minimize off-target effects of CRISPR-Cas9. Nat Biotechnol 34, 184-191, doi:10.1038/nbt.3437 (2016). [0437] 78 Sinclair, L. V. et al. Control of amino-acid transport by antigen receptors coordinates the metabolic reprogramming essential for T cell differentiation. Nat Immunol 14, 500-508, doi:10.1038/ni.2556 (2013). [0438] 79 Atherly, L. O., Brehm, M. A., Welsh, R. M. & Berg, L. J. Tec kinases Itk and Rlk are required for CD8+T cell responses to virus infection independent of their role in CD4+T cell help. J Immunol 176, 1571-1581 (2006). [0439] 80 Blagih, J. et al. The energy sensor AMPK regulates T cell metabolic adaptation and effector responses in vivo. Immunity 42, 41-54, doi:10.1016/j.immuni.2014.12.030 (2015). [0440] 81 D′Souza, W. N., Chang, C. F., Fischer, A. M., Li, M. & Hedrick, S. M. The Erk2 MAPK regulates CD8 T cell proliferation and survival. J Immunol 181, 7617-7629 (2008). [0441] 82 Sullivan, B. M., Juedes, A., Szabo, S. J., von Herrath, M. & Glimcher, L. H. Antigen-driven effector CD8 T cell function regulated by T-bet. Proc Natl Acad Sci USA 100, 15818-15823, doi:10.1073/pnas.2636938100 (2003). [0442] 83 Geiger, R. et al. L-Arginine Modulates T Cell Metabolism and Enhances Survival and Anti-tumor Activity. Cell 167, 829-842 e813, doi:10.1016/j.ce11.2016.09.031 (2016). [0443] 84 Kawalekar, O. U. et al. Distinct Signaling of Coreceptors Regulates Specific Metabolism Pathways and Impacts Memory Development in CAR T Cells. Immunity 44, 380-390, doi:10.1016/j.immuni.2016.01.021 (2016). [0444] 85 Quigley, M. et al. Transcriptional analysis of HIV-specific CD8+ T cells shows that PD-1 inhibits T cell function by upregulating BATF. Nat Med 16, 1147-1151, doi:10.1038/nm.2232 (2010). [0445] 86 Xin, G. et al. A Critical Role of IL-21-Induced BATF in Sustaining CD8-T-Cell-Mediated Chronic Viral Control. Cell Rep 13, 1118-1124, doi:10.1016/j.celrep.2015.09.069 (2015). [0446] 87 Shifrut, E. et al. Genome-wide CRISPR Screens in Primary Human T Cells Reveal Key Regulators of Immune Function. Cell 175, 1958-1971 e1915, doi:10.1016/j.ce11.2018.10.024 (2018). [0447] 88 Manguso, R. T. et al. In vivo CRISPR screening identifies Ptpn2 as a cancer immunotherapy target. Nature 547, 413-418, doi:10.1038/nature23270 (2017).
TABLE-US-00004 LIST OF SEQUENCES sgRegnase-1 #1 nucleic acid sequence SEQ ID NO: 1 AAGGCAGTGGTTTCTTACGA sgRegnase-1 #2 nucleic acid sequence SEQ ID NO: 2 GGAGTGGAAACGCTTCATCG sgBatf #1 nucleic acid sequence SEQ ID NO: 3 AGAGATCAAACAGCTCACCG sgBatf #2 nucleic acid sequence SEQ ID NO: 4 AGGACTCATCTGATGATGTG sgPtpn2 #1 nucleic acid sequence SEQ ID NO: 5 AAGAAGTTACATCTTAACAC sgPtpn2 #2 nucleic acid sequence SEQ ID NO: 6 CACTCTATGAGGATAGTCAT sgSocs1 #1 nucleic acid sequence SEQ ID NO: 7 TGATGCGCCGGTAATCGGAG sgSocs1 #2 nucleic acid sequence SEQ ID NO: 8 TGGTGCGCGACAGTCGCCAA sgAgps nucleic acid sequence SEQ ID NO: 9 GTACCAATGAGTGCAAAGCG non-targeting control sgRNA nucleic acid sequence SEQ ID NO: 10 ATGACACTTACGGTACTCGT Nextera NGS-F nucleic acid sequence SEQ ID NO: 11 TCGTCGGCAGCGTCAGATGTGTATAAGAGACAGttgtggaaaggacgaaa caccg Nextera NGS-R nucleic acid sequence SEQ ID NO: 12 GTCTCGTGGGCTCGGAGATGTGTATAAGAGACAGccactttttcaagttg ataacgg Bcl211-F nucleic acid sequence SEQ ID NO: 13 GACAAGGAGATGCAGGTATTGG Bcl211-R nucleic acid sequence SEQ ID NO: 14 TCCCGTAGAGATCCACAAAAGT Ifng-F nucleic acid sequence SEQ ID NO: 15 ACAGCAAGGCGAAAAAGGATG Ifng-R nucleic acid sequence SEQ ID NO: 16 TGGTGGACCACTCGGATGA Irf4-F nucleic acid sequence SEQ ID NO: 17 TCCGACAGTGGTTGATCGAC Irf4-R nucleic acid sequence SEQ ID NO: 18 CCTCACGATTGTAGTCCTGCTT Gzma-F nucleic acid sequence SEQ ID NO: 19 TGCTGCCCACTGTAACGTG Gzma-R nucleic acid sequence SEQ ID NO: 20 GGTAGGTGAAGGATAGCCACAT Gzmb-F nucleic acid sequence SEQ ID NO: 21 CCACTCTCGACCCTACATGG Gzmb-R nucleic acid sequence SEQ ID NO: 22 GGCCCCCAAAGTGACATTTATT Actin-F nucleic acid sequence SEQ ID NO: 23 CGCCACCAGTTCGCCATGGA Actin-R nucleic acid sequence SEQ ID NO: 24 TACAGCCCGGGGAGCATCGT human BATF amino acid sequence SEQ ID NO: 25 MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQK ADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAAST PSPPEVVYSAHAFHQPHVSSPRFQP mouse BATF amino acid sequence SEQ ID NO: 26 MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQK ADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGT PSPPEVVYSAHAFHQPHISSPRFQP human BATF nucleotide sequence SEQ ID NO: 27 AAAGCGAGCGACATGTCCCTTTGGGGAGCAGTCCCTCTGCACCCCAGAGT GAGGAGGACGCAGGGGTCAGAGGTGGCTACAGGGCAGGCAGAGGAGGCAC CTGTAGGGGGTGGTGGGCTGGTGGCCCAGGAGAAGTCAGGAAGGGAGCCC AGCTGGTGACAAGAGAGCCCAGAGGTGCCTGGGGCTGAGTGTGAGAGCCC GGAAGATTTCAGCCATGCCTCACAGCTCCGACAGCAGTGACTCCAGCTTC AGCCGCTCTCCTCCCCCTGGCAAACAGGACTCATCTGATGATGTGAGAAG AGTTCAGAGGAGGGAGAAAAATCGTATTGCCGCCCAGAAGAGCCGACAGA GGCAGACACAGAAGGCCGACACCCTGCACCTGGAGAGCGAAGACCTGGAG AAACAGAACGCGGCTCTACGCAAGGAGATCAAGCAGCTCACAGAGGAACT GAAGTACTTCACGTCGGTGCTGAACAGCCACGAGCCCCTGTGCTCGGTGC TGGCCGCCAGCACGCCCTCGCCCCCCGAGGTGGTGTACAGCGCCCACGCA TTCCACCAACCTCATGTCAGCTCCCCGCGCTTCCAGCCCTGAGCTTCCGA TGCGGGGAGAGCAGAGCCTCGGGAGGGGCACACAGACTGTGGCAGAGCTG CGCCCATCCCGCAGAGGCCCCTGTCCACCTGGAGACCCGGAGACAGAGGC CTGGACAAGGAGTGAACACGGGAACTGTCACGACTGGAAGGGCGTGAGGC CTCCCAGCAGTGCCGCAGCGTTTCGAGGGGCGTGTGCTGGACCCCACCAC TGTGGGTTGCAGGCCCAATGCAGAAGAGTATTAAGAAAGATGCTCAAGTC CCATGGCACAGAGCAAGGCGGGCAGGGAACGGTTATTTTTCTAAATAAAT GCTTTAAAAGAAA mouse BATF nucleotide sequence SEQ ID NO: 28 GCAGTCCCTCTGCACCCGAGAGAGAGGAGGACGCAGGGGTCTGTCAGAGG TTGCTGTTGGGCAAGCAGGGGAGGTACCTGTGGAAGGTGGTGTGCTGGTG GCCCCCTAGCAGTCAAGAAGGGGAGCCAGCTAGTGAGAAGATCGCCCAGA GGCATCTGGGACGGTGTGGGAGAGCCCGGAAGATTAGAACCATGCCTCAC AGCTCCGACAGCAGTGACTCCAGCTTCAGCCGCTCTCCTCCCCCTGGCAA ACAGGACTCATCTGATGATGTGAGGAAAGTTCAGAGGAGAGAGAAGAATC GCATCGCTGCCCAGAAGAGCCGACAGAGACAGACACAGAAAGCCGACACC CTTCACCTGGAGAGTGAGGACCTGGAGAAACAGAACGCAGCTCTCCGCAA AGAGATCAAACAGCTCACCGAGGAGCTCAAGTACTTCACATCAGTGCTGA GCAGCCACGAGCCCCTGTGCTCCGTGCTGGCCAGTGGCACCCCCTCGCCC CCCGAGGTGGTATACAGTGCCCATGCCTTCCACCAGCCTCACATCAGCTC GCCACGCTTCCAGCCCTGACCTTCTGGACAAGAAGGGCGATGCTACTCCC GTGATCCCTTGGAGGGGCATGTAAACTGAGGCCGGGCTGCCCTCATACCT CTACCCAGAGGCCCAGTGGCAGAGGCCTGGACAAGTATTGAACACAAGAA CTGTAGTGGTCAGAGGGACTTAAGGCCTCCCAGGGAAGTATAGTCAATGT ACTGGACTCTCCCAGGGAAGTCGAGCCAATGTACTGGACCCAAAAAATGA CAAGTCAACCCTGGACTGTCATGAATGATGCCCAAAATACACAGCACAGA GGGAGGAGGGCAGGGGGTGGATAGTTTTCTAAATAAATATTTTCTAAAAA ACCA gRNA-1, N is A, T, C, or G SEQ ID NO: 29 TTCACACCATCACGACGCGTNGG gRNA-2, N is A, T, C, or G SEQ ID NO: 30 TGGGGGCAGCTTGGCCGCTCNGG g-RNA-3, N is A, T, C, or G SEQ ID NO: 31 TATGCCCCCTGATGACCCACNGG gRNA-4, N is A, T, C, or G SEQ ID NO: 32 AAGGAGGTCTTCTCCTGCCGNGG gRNA-5, N is A, T, C, or G SEQ ID NO: 33 GTGATGGGCACGTCGGGCCGNGG g-RNA-6, N is A, T, C, or G SEQ ID NO: 34 CAGCTCCCTCTAGTCCCGCGNGG control gRNA, N is A, T, C, or G SEQ ID NO: 35 GCUUGUGGAUGUUGCGGAAGNGG gRNA-1 SEQ ID NO: 36 TTCACACCATCACGACGCGT gRNA-2 SEQ ID NO: 37 TGGGGGCAGCTTGGCCGCTC g-RNA-3 SEQ ID NO: 38 TATGCCCCCTGATGACCCAC gRNA-4 SEQ ID NO: 39 AAGGAGGTCTTCTCCTGCCG gRNA-5 SEQ ID NO: 40 GTGATGGGCACGTCGGGCCG g-RNA-6 SEQ ID NO: 41 CAGCTCCCTCTAGTCCCGCG sgRc3h1 nucleic acid sequence SEQ ID NO: 42 GGTAGAGGGTTACTACCCGG
[0448] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.
[0449] All patents, applications, publications, test methods, literature, and other materials cited herein are hereby incorporated by reference in their entirety as if physically present in this specification.