THERAPEUTICS DIRECTED AGAINST CORONAVIRUS
20220226489 · 2022-07-21
Assignee
Inventors
Cpc classification
A61K38/177
HUMAN NECESSITIES
A61K47/64
HUMAN NECESSITIES
A61K47/6811
HUMAN NECESSITIES
A61K47/644
HUMAN NECESSITIES
International classification
A61K47/68
HUMAN NECESSITIES
A61K38/16
HUMAN NECESSITIES
A61K47/64
HUMAN NECESSITIES
Abstract
This invention provides compositions and methods to treat, prevent, and diagnose viral infections. The methods provided herein involve administering one or more polypeptides of the invention to a subject in need thereof. The viral infections can be caused by a coronavirus such as, for example, SARS-CoV-1, SARS-CoV-2 or a variant thereof. It is contemplated that the polypeptide can be linked to an amino acid, wherein the compound extends the serum half-life of the amino acid.
Claims
1. A method for treating viral infections, the method comprising administration to a subject in need thereof an antiviral compound linked to a protein that extends the serum half-life of the antiviral compound.
2. The method of claim 1, wherein the protein is selected from the group comprising albumin, transferrin, and the Fc-portion of an antibody.
3. The method of claim 1, wherein the antiviral compound is one or more polypeptides selected from the group comprising SEQ ID NO:1, SEQ ID NO:2, and SEQ ID NO:3.
4. A method for treating viral infections, the method comprising administration to a subject in need thereof one or more polypeptides selected from the group comprising SEQ ID NO:1, SEQ ID NO:2, and SEQ ID NO:3.
5. The method of claim 4, wherein the viral infection is caused by a coronavirus.
6. The method of claim 5, wherein the coronavirus is SARS-CoV-1, SARS-CoV-2 or a variant thereof.
7. The method of claim 4, wherein the polypeptides further comprises a compound linked to the amino acid, wherein the compound extends the serum half-life of the amino acid.
8. The method of claim 7, wherein the compound is albumin, transferrin, or the Fc-portion of an antibody.
9. A method for preventing viral infections, the method comprising administration to a subject in need thereof one or more polypeptides selected from the group comprising SEQ ID NO:1, SEQ ID NO:2, and SEQ ID NO:3.
10. The method of claim 9, wherein the viral infection is caused by a coronavirus.
11. The method of claim 10, wherein the coronavirus is SARS-CoV-1, SARS-CoV-2 or a variant thereof.
12. The method of claim 9, wherein the polypeptides further comprise a compound linked to the amino acid, wherein the compound extends the serum half-life of the amino acid.
13. The method of claim 12, wherein the compound is albumin, transferrin, or the Fc-portion of an antibody.
Description
DRAWINGS
[0012] These and other features, aspects, and advantages of the present invention will become better understood with regard to the following description, appended claims, and accompanying drawings where:
[0013]
[0014]
[0015]
[0016]
DESCRIPTION
[0017] Provided herein are compositions and methods for treating, preventing and diagnosing viral infections, in particular for treating, preventing, and diagnosing coronavirus infections.
[0018] As used herein, the following terms and variations thereof have the meanings given below, unless a different meaning is clearly intended by the context in which such term is used.
[0019] The terms “a,” “an,” and “the” as used herein are to be construed to cover both the singular and the plural unless their usage in context indicates otherwise.
[0020] The term “antigenic determinant” refers to the epitope on the antigen recognized by the antigen-binding molecule (such as an sdAb or polypeptide of the invention) and more in particular by the antigen-binding site of the antigen-binding molecule. The terms “antigenic determinant” and “epitope” may also be used interchangeably. An amino acid sequence that can bind to, that has affinity for and/or that has specificity for a specific antigenic determinant, epitope, antigen or protein is said to be “against” or “directed against” the antigenic determinant, epitope, antigen or protein.
[0021] As used herein, the term “antiviral polypeptide” means any polypeptide that can prevent, reduce, or treat viral infections.
[0022] As used herein, the term “comprise” and variations of the term, such as “comprising” and “comprises,” are not intended to exclude other additives, components, integers or steps.
[0023] It is contemplated that the polypeptides and proteins described herein can contain so-called “conservative” amino acid substitutions, which can generally be described as amino acid substitutions in which an amino acid residue is replaced with another amino acid residue of similar chemical structure and which has little or essentially no influence on the function, activity or other biological properties of the polypeptide. Conservative amino acid substitutions are well known in the art. Conservative substitutions are substitutions in which one amino acid within the following groups (a)-(e) is substituted by another amino acid within the same group: (a) small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro and Gly; (b) polar, negatively charged residues and their (uncharged) amides: Asp, Asn, Glu and Gln; (c) polar, positively charged residues: His, Arg and Lys; (d) large aliphatic, nonpolar residues: Met, Leu, Ile, Val and Cys; and (e) aromatic residues: Phe, Tyr and Trp. Other conservative substitutions include: Ala into Gly or into Ser; Arg into Lys; Asn into Gln or into His; Asp into Glu; Cys into Ser; Gln into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gln; Ile into Leu or into Val; Leu into Ile or into Val; Lys into Arg, into Gln or into Glu; Met into Leu, into Tyr or into Ile; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr; Tyr into Trp; and/or Phe into Val, into Ile or into Leu.
[0024] As used herein, an “isolated” nucleic acid or amino acid has been separated from at least one other component with which it is usually associated, such as its source or medium, another nucleic acid, another protein/polypeptide, another biological component or macromolecule or contaminant, impurity or minor component.
[0025] The term “mammal” is defined as an individual belonging to the class Mammalia and includes, without limitation, humans, domestic and farm animals, and zoo, sports, and pet animals, such as cows, horses, sheep, dogs and cats.
[0026] As used herein, “pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field. Preferred examples of such carriers or diluents include, but are not limited to, water, saline, Ringer's solutions, dextrose solution, PBS (phosphate-buffered saline), and 5% human serum albumin. Liposomes, cationic lipids and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with a therapeutic agent as defined above, use thereof in the composition of the present invention is contemplated.
[0027] A “quantitative immunoassay” refers to any means of measuring an amount of antigen present in a sample by using an antibody. Methods for performing quantitative immunoassays include, but are not limited to, enzyme-linked immunosorbent assay (ELISA), specific analyte labeling and recapture assay (SALRA), liquid chromatography, mass spectrometry, fluorescence-activated cell sorting, and the like.
[0028] The term “solution” refers to a composition comprising a solvent and a solute, and includes true solutions and suspensions. Examples of solutions include a solid, liquid or gas dissolved in a liquid and particulates or micelles suspended in a liquid.
[0029] The term “specificity” refers to the number of different types of antigens or antigenic determinants to which a particular antigen-binding molecule or antigen-binding protein molecule can bind. The specificity of an antigen-binding protein can be determined based on affinity and/or avidity. The affinity, represented by the equilibrium constant for the dissociation of an antigen with an antigen-binding protein (KD), is a measure for the binding strength between an antigenic determinant and an antigen-binding site on the antigen-binding protein: the lesser the value of the KD, the stronger the binding strength between an antigenic determinant and the antigen-binding molecule (alternatively, the affinity can also be expressed as the affinity constant (KA), which is 1/KD). As will be clear to one of skill in the art, affinity can be determined depending on the specific antigen of interest. Avidity is the measure of the strength of binding between an antigen-binding molecule and the antigen. Avidity is related to both the affinity between an antigenic determinant and its antigen binding site on the antigen-binding molecule and the number of pertinent binding sites present on the antigen-binding molecule. Specific binding of an antigen-binding protein to an antigen or antigenic determinant can be determined by any known manner, such as, for example, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays.
[0030] As used herein, the term “recombinant” or “recombinant protein” refers to the use of genetic engineering methods (for example, cloning, and amplification) used to produce the proteins and polypeptides of the invention.
[0031] The term “S protein” or “S1” refers to the spike glycoprotein encoded by SARS-CoV. “Protein” is used interchangeably with “polypeptide.” As used herein, SBT-500 (SEQ ID NO:1) refers to a recombinant RBD of the S1 protein (encoded by the SARS-CoV-2 (2019-nCoV) Spike Protein (RBD) (YP_009724390.1) (Arg319-Phe541) expressed with a polyhistidine tag at the C-terminus) (Sino Biological US Inc., Wayne, Pa.). The sequence is as follows:
TABLE-US-00001 SEQ ID NO: 1 RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLY NSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTE IYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPA TVCGPKKSNLVKNKCVNFAHHHHHHHHHH
[0032] SBT-501 (SEQ ID NO:2) refers to the entire recombinant S1 protein (encoded by SARS-Cov-2 spike protein S1 Subunit (YP_009724390.1) DNA sequence (Val16-Arg685) expressed with a polyhistidine tag at the C-terminus) (Sino Biological US Inc., Wayne, Pa.). The sequence is as follows:
TABLE-US-00002 SEQ ID NO: 2 VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFH AIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSL LIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTF EYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQG FSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYL QPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQ PTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSA SFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNY KLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQ AGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVC GPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAV RDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHAD QLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQT NSPRRARAHHHHHHHHHH
[0033] SBT-502 (SEQ ID NO:3) refers to a recombinant ACE2 protein. (encoded by the human ACE2 (NP_068576.1) (Met1-Ser740) expressed with a polyhistidine tag at the C-terminus) (Sino Biological US Inc., Wayne, Pa.). The sequence is as follows:
TABLE-US-00003 SEQ ID NO: 3 MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYN TNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ NGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMA NSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWR GDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSY ISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQR IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFR ILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIM SLSAATPKHLKSIGLLSPDFQEDNETEINFLLQALTIVGTLPFTYMLEKWR WMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYS FIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGK SEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPY ADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMIL FGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAF RLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIR DRKKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF
[0034] As used herein, the term “substantially identical” or “substantially homologous” refers to a first amino acid or nucleotide sequence that contains a sufficient number of identical or equivalent (e.g., with a similar side chain, e.g., conserved amino acid substitutions) amino acid residues or nucleotides to a second amino acid or nucleotide sequence such that the first and second amino acid or nucleotide sequences have similar activities.
[0035] Calculations of “homology” or “identity” between two sequences are performed as follows. The sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). For substantial identity, the length of a reference sequence aligned for comparison purposes is at least 80%, but can be higher, e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% of the length of the reference sequence. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, accounting for the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent homology between two sequences are accomplished using a mathematical algorithm.
[0036] The compositions of the invention may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on the polypeptide functions. Whether or not a particular substitution will be tolerated, i.e., will not adversely affect desired biological properties, such as binding activity, can be determined. A “conservative amino acid substitution” is one in which an amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, Valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
[0037] A “non-essential” amino acid residue is a residue that can be altered from the wild-type sequence of a polypeptide without substantially altering a biological activity, whereas an “essential” amino acid residue results in such a change.
[0038] The term “synthetic” refers to production by in vitro chemical or enzymatic synthesis.
[0039] The term “target” as used herein refers to any component, antigen, or moiety that is recognized by the protein or polypeptide of the invention. The term “intracellular target” refers to any component, antigen, or moiety present inside a cell. A “transmembrane target” is a component, antigen, or moiety that is located within the cell membrane. An “extracellular target” refers to a component, antigen, or moiety that is located outside of the cell.
[0040] A “therapeutic composition” as used herein means a substance that is intended to have a therapeutic effect such as pharmaceutical compositions, genetic materials, biologics, and other substances. Genetic materials include substances intended to have a direct or indirect genetic therapeutic effect such as genetic vectors, genetic regulator elements, genetic structural elements, DNA, RNA and the like. Biologics include substances that are living matter or derived from living matter intended to have a therapeutic effect.
[0041] As used herein, the phrases “therapeutically effective amount” and “prophylactically effective amount” refer to an amount that provides a therapeutic benefit in the treatment, prevention, or management of a disease or an overt symptom of the disease. The therapeutically effective amount may treat a disease or condition, a symptom of disease, or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disease, the symptoms of disease, or the predisposition toward disease. The specific amount that is therapeutically effective can be readily determined by an ordinary medical practitioner, and may vary depending on factors known in the art, such as, e.g., the type of disease, the patient's history and age, the stage of disease, and the administration of other therapeutic agents.
[0042] It is contemplated in the present invention that an isolated viral receptor-binding ligand can be used alone or in combination with the viral receptor-binding ligand's target RBD as a therapeutic to prevent or reduce viral infection in an individual.
[0043] The present invention relates to viral proteins and polypeptides directed against cellular receptors. The invention also includes nucleic acids encoding the proteins and polypeptides, and compositions comprising the proteins and peptides of the invention. The invention includes the use of the compositions for prophylactic, therapeutic or diagnostic purposes. It is also contemplated that variants of viral proteins can be used in the present invention.
[0044] In addition, the viral proteins and polypeptides of the invention can be constructed as fusion proteins containing a compound, such as a protein, that can be used to extend the serum half-life of the protein for therapeutic applications, such as, for example, albumin, transferrin, and/or Fc-portion of antibodies. The fusion protein can optionally contain a linker portion.
[0045] The methods and compositions detailed in the present invention can be used to treat diseases described herein, and can be used with any dosage and/or formulation described herein or otherwise known, as well as with any route of administration described herein or otherwise known to one of skill in the art.
EXAMPLES
EXAMPLE 1: Inhibition of SARS-CoV-2 and ACE2 Binding
[0046] The ability of recombinant proteins to inhibit SARS-CoV-2 S1 protein binding to ACE2 was determined using an enzyme-linked immunosorbent assay (ELISA) in triplicate. The nomenclature used in the experiments is as follows: SBT-500 (SEQ ID NO:1) is the recombinant RBD of the S1 protein (encoded by the SARS-CoV-2 (2019-nCoV) Spike Protein (RBD) (YP_009724390.1) (Arg319-Phe541) expressed with a polyhistidine tag at the C-terminus); SBT-501 (SEQ ID NO:2) refers to the entire recombinant S1 protein (encoded by SARS-CoV-2 spike protein S1 Subunit (YP_009724390.1) DNA sequence (Val16-Arg685) expressed with a polyhistidine tag at the C-terminus); and SBT-502 (SEQ ID NO:3) refers to a recombinant ACE2 protein (encoded by the human ACE2 (NP_068576.1) (Met1-Ser740) expressed with a polyhistidine tag at the C-terminus).
[0047] First, the recombinant protein reagents were reconstituted. 10 μl of 600 μg/mL stock SARS-CoV-2 S1 Protein (Fc Tag) (Acro Biosystems, Newark, Del.) solution was diluted with 4 ml Tris Buffered Saline (TBS) (50 mM Tris-HCl, pH 7.6, 150 mM NaCl) to make 1.5 μg/mL S1 protein coat solution. 50 μl of the diluted S1 protein coat solution was added to the wells of a plate containing Nunc® strips (Thermo Fisher Scientific, Waltham, Mass.). A well containing no S1 protein coating solution was used as a negative control. The strips were incubated at 4° C. for 16 hours or overnight.
[0048] The S1 protein coating solution was then removed, and the wells were washed three times with 300 μL of TBS. After the final wash, the plate was inverted and blotted with paper towels.
[0049] The wells were blocked with 300 μL of blocking buffer (TBS with 0.5% casein (w/v)) at room temperature for 1.5 hours. The blocking buffer was removed by decanting. The plate was then inverted and blotted with paper towels.
[0050] 100 μg/mL of biotinylated human ACE2 stock solution (Acro Biosystems) was diluted to 0.12 μg/mL with blocking buffer to make a biotinylated human ACE2 working solution. The final concentration of the biotinylated human ACE2 working solution used in the assay was 0.06 μg/mL.
[0051] Serial dilutions of SBT-500, SBT-501, SBT-502, and Anti-SARS-CoV-2 Neutralizing Ab (Human IgG) (positive control) (Acro Biosystems) were made in blocking buffer. The dilutions were as follows: [0052] SBT-500: 20, 6, 2, 0.6, 0.2, 0.06 μg/ml. [0053] SBT-501: 120, 60, 20, 6, 2, 0.6 μg/ml. [0054] SBT-502: 60, 30, 15, 7.5, 3.75 μg/ml. [0055] Anti-SARS-CoV-2 Ab: 60, 20, 6, 2, 0.6, 0.2 μg/ml.
[0056] 30 μl biotinylated human ACE2 working solution was mixed with 30 μl of the various concentrations of SBT-500, SBT-501, SBT-502 and the Anti-SARS-CoV-2 Ab, which made the final concentrations of the recombinant proteins used in the assay half of the values listed above. 30 μl diluted ACE2 was mixed with 30 μl blocking buffer and used as a negative control. The diluted recombinant proteins were incubated at room temperature for 10 minutes.
[0057] 50 μl of the diluted recombinant proteins were added to the blocked wells using the schema detailed in Table 1. The wells were then covered and incubated at room temperature for 40 minutes with shaking.
TABLE-US-00004 TABLE 1 Antibody concentration SBT-500 SBT-501 SBT-502 Anti-SARS CoV-2 (μg/mL) (μg/mL) (μg/mL) Ab (μg/mL) Strip # Well 1 2 3 4 5 6 7 8 9 10 A 10 10 10 60 60 60 30 30 30 30 B 3 3 3 30 30 30 15 15 15 10 C 1 1 1 10 10 10 7.5 7.5 7.5 3 D 0.3 0.3 * * 3 3 3.75 3.75 3.75 1 E 0.1 0.1 0.1 1 1 1 1.875 1.875 1.875 0.3 F 0.03 0.03 0.03 0.3 0.3 0.3 0 0 0 0.1 G 0 0 0 0 0 0 — — — 0 H — — — — — — — — — 0** *No data **Uncoated well
[0058] The solution was then removed from the wells, and the wells were washed three times as follows: 300 μL of TBST (TBS with 0.05% (v/v) Tween-20 (pH 7.4)) was added to each well, the plate was tapped gently for 1 minute, and remaining buffer was removed by decanting. The plate was then inverted and blotted against paper towels. The wells were then washed twice with TBS.
[0059] A 0.1 μg/mL Streptavidin-HRP working solution was made by dilution of a Streptavidin-HRP stock solution (50 μg/mL) with blocking buffer. 50 μL of the Streptavidin-HRP working solution was added to each well. The plate was then covered and incubated at room temperature for 30 minutes with shaking. After 30 minutes, the wells were washed as described above.
[0060] Following the wash, 50 μL Pierce® TMB Substrate (Thermo Fisher Scientific) was added to each well and incubated at room temperature for 15 minutes with shaking.
[0061] 50 μL of a 2M HCl stop solution was then added to each well. The plate was shaken briefly to mix. The absorbance of the wells at 450 nm was measured using a UV/Vis microplate spectrophotometer, and is shown in Table 2.
TABLE-US-00005 TABLE 2 Absorbance of ELISA Anti-SARS SBT-500 SBT-501 SBT-502 CoV-2 Ab Strip # Well 1 2 3 4 5 6 7 8 9 10 A 0.047 0.050 0.048 0.044 0.043 0.045 0.081 0.082 0.079 0.043 B 0.070 0.065 0.063 0.049 0.046 0.048 0.096 0.099 0.097 0.053 C 0.111 0.107 0.101 0.064 0.063 0.065 0.118 0.137 0.125 0.067 D 0.259 0.249 * * 0.120 0.130 0.176 0.165 0.150 0.094 E 0.408 0.432 0.354 0.266 0.257 0.271 0.245 0.269 0.216 0.250 F 0.593 0.543 0.580 0.365 0.318 0.381 0.446 0.546 0.542 0.225 G 0.767 0.797 0.594 0.544 0.567 0.585 — — — 0.538 H — — — — — — — — — 0.042 *No data
TABLE-US-00006 TABLE 3 Average absorbance values anti-SARS- SBT-500 SBT-501 SBT-502 CoV-2 ug/ml OD450 SD ug/ml OD450 SD ug/ml OD450 SD ug/ml OD450 10 0.049 0.001312 60 0.044 0.000777 30 0.081 0.001728 30 0.043 3 0.066 0.003892 30 0.048 0.001802 15 0.097 0.001462 10 0.053 1 0.106 0.004993 10 0.064 0.001279 7.5 0.127 0.009225 3 0.067 0.3 0.254* 0.006616 3 0.125* 0.006923 3.75 0.164 0.01298 1 0.094 0.1 0.398 0.04 1 0.265 0.007235 1.875 0.243 0.026838 0.3 0.250 0.03 0.572 0.026078 0.3 0.355 0.032403 0 0.511 0.056166 0.1 0.225 0 0.719 0.109466 0 0.565 0.020498 0 0.538 *Average of 2 values
[0062]
EXAMPLE 2: In Vitro Inhibition of SARS-CoV-2 and ACE2 Binding
[0063] The ability of SBT-500 and SBT-501 alone or in combination to inhibit SARS-CoV-2 infection in vitro was determined.
[0064] The ACE2-HEK293 cell line (BPS Bioscience, Inc., San Diego, Calif.) is a recombinant, clonally stable HEK293 cell line that constitutively expresses full length human ACE2. ACE2-HEK293 cells were maintained and assayed in DMEM (Corning Inc.) containing 10% Fetal Bovine Serum (ATCC Manassas, Va.), 0.5 μg/ml Puromycin (Selleckchem, Houston, Tex.), and 1% Penicillin/Streptomycin (Gibco, Thermo Fisher Scientific).
[0065] A pseudovirus, namely a SARS-CoV-2 Spike (D614G) lentivirus (BPS Bioscience Inc.), that expresses the SARS-Cov-2 Spike protein was used in the assays. The SARS-CoV-2 Spike (D614G) lentivirus contains the SARS-CoV-2 Spike (Genbank Accession #QHD43416.1; with D614G mutation) as the envelope glycoproteins. The pseudovirions also contains a firefly luciferase gene driven by a CMV promoter, which allows spike-mediated cell entry to be measured via luciferase activity.
[0066] The SARS-CoV-2 pseudovirus Spike protein recognizes and attaches to the ACE2 receptor of the ACE2-HEK293 cell. Once the SARS-CoV-2 pseudovirus enters the ACE2-HEK293 cell, the luciferase activity is measured. Compounds can be tested for the ability to inhibit binding of the SARS-CoV-2 pseudovirus to the ACE2 receptor. If a compound blocks binding of the SARS-CoV-2 pseudovirus to the ACE2 receptor on the ACE2-HEK293 cells, then the luciferase activity is decreased.
[0067] For the following experiments, a human monoclonal antibody, anti-SARS-CoV-2 Neutralizing Ab (Acro Biosystems) that binds the Spike protein and significantly inhibits the ability of the SARS-CoV-2 pseudovirus to bind to the ACE2 receptor was used as a positive control.
[0068] ACE2-HEK293 cells were seeded at a density of 5,000-10,000 cells per well into 60 wells of a white clear-bottomed 96-well plate (Corning, Inc., Corning, N.Y.) and incubated overnight at 37° C. with 5% CO.sub.2. The experiments were run in triplicate. 5 μl of various concentrations of SBT-500, SBT-501, a combination of SBT-500 and SBT-501, and anti-SARS-CoV-2 Ab (used as a positive control), were mixed with 5 μl growth medium or SARS-CoV-2 pseudovirus and then added to the appropriate wells. Growth medium alone was used as a negative control. The plates were then incubated for 50-58 hours, and were assayed for luminescence, as measured in relative light units (RLU), using the One-Step™ Luciferase Assay System (BPS Bioscience) following the manufacturer's protocol. The results are shown in Table 4 and
TABLE-US-00007 TABLE 4 Luciferase activity as measured in relative light units Average Relative Light Units (RLU) Standard Deviation Compound No virus w/ virus No virus w/ virus SBT-500 (83 ug/ml) 20 1512 4 294 SBT-500 (42 ug/ml) 22 2354 2 151 SBT-501 (83 ug/ml) 19 1580 3 198 SBT-501 (42 ug/ml) 24 5200 15 438 SBT-500 + SBT-501 (42 ug/ml each) 26 1389 6 174 anti-SARS-CoV-2 Ab (42 ug/ml) 30 337 14 106 None 31 7262 21 874
[0069] The results of the inhibition of the SARS-CoV-2 pseudovirus to bind to the ACE2 receptor with SBT-500 and SBT-501 alone or in combination are shown in Table 5 and
TABLE-US-00008 TABLE 5 Inhibition of SARS-CoV-2 pseudovirus binding to ACE2-HEK293 cells Average RLU/ Standard Standard Compound Control RLU Deviation % Inhibition Deviation SBT-500 (83 ug/ml) 0.21 0.047562 79 5 SBT-500 (42 ug/ml) 0.32 0.04421 68 4 SBT-501 (83 ug/ml) 0.22 0.037852 78 4 SBT-501 (42 ug/ml) 0.72 0.105248 28 11 SBT-500 + SBT-501 0.19 0.033278 81 3 (42 ug/ml each) Anti-SARS-CoV-2 Ab 0.05 0.015594 95 2 (42 ug/ml)
[0070] The results show that SBT-500 and SBT-501 can inhibit SARS-CoV-2 entry into cells containing the ACE2 receptor in a dose-dependent manner. The combination of SBT-500 and SBT-501 also inhibits SARS-CoV-2 entry into cells containing the ACE2 receptor. The combination therapy approaches the percent inhibition of the positive control (˜95%) versus 80% for SBT-500+SBT-501. Thus, SBT-500, SBT-501, SBT-502 can be used alone or in combination to prevent or reduce infection with SARS-CoV-1 and/or SARS-CoV-2, as well as preventing or reduction infection with SARS-CoV-1 and SARS-CoV-2 variants.
EXAMPLE 3: SBT-500 and SBT-501 Inhibits Binding of the Spike Protein from the SARS-1 virus, SARS-CoV-2 Virus, UK-Variant and the South African Variant
[0071] ELISA assays were done as described above in Example 2 to assess the percent inhibition of ACE2 binding to various Spike proteins. In this experiment, fusion proteins were made containing albumin linked to SBT-500 and SBT-501 at the C-terminus. As can be seen in
[0072] Although the present invention has been described in considerable detail with reference to certain preferred embodiments, other embodiments are possible. The steps disclosed for the present methods, for example, are not intended to be limiting nor are they intended to indicate that each step is necessarily essential to the method, but instead are exemplary steps only. Therefore, the scope of the appended claims should not be limited to the description of preferred embodiments contained in this disclosure. All references cited herein are incorporated by reference in their entirety.