NOVEL PNEUMOCOCCAL VACCINE FORMULATIONS
20210393763 · 2021-12-23
Inventors
- Blaine Pfeifer (Buffalo, NY, US)
- Charles Jones (North Tonawanda, NY, US)
- Jonathan Lovell (Niagara Falls, CA)
Cpc classification
A61K2039/55555
HUMAN NECESSITIES
A61K9/1271
HUMAN NECESSITIES
International classification
A61K39/09
HUMAN NECESSITIES
A61K9/127
HUMAN NECESSITIES
Abstract
Immunogenic composition are provided comprising PnCo and/or GlpO polypeptides identified as being preferentially expressed during the virulent phase of an infection related to streptococcal bacteria. The compositions can be used for eliciting immune response against streptococcal infections, such as against infections caused by S. pneumoniae.
Claims
1. A composition comprising an immunologically effective amount of an isolated PncO polypeptide having a sequence of SEQ ID NO:1, or having at least 90% homology to SEQ ID NO:1, in a pharmaceutical carrier.
2. The composition of claim 1, where the only immunological component is PncO.
3. The composition of claim 1, further comprising isolated GlpO having a sequence of SEQ ID NO:2, or having at least 90% homology to SEQ ID NO:2.
4. The composition of claim 1, further comprising an adjuvant.
5. The composition of claim 1, wherein the polypeptide is incorporated in a delivery vehicle.
6. The composition of claim 5, wherein the delivery vehicle is a nanovesicle, nanoparticle, microvesicle, or hybrid delivery vehicle.
7. A nanovesicle having incorporated therein a PncO polypeptide having a sequence of SEQ ID NO:1 or having at least 90% homology to SEQ ID NO:1, and/or a GlpO polypeptide having a sequence of SEQ ID NO:2 or having at least 90% homology to SEQ ID NO:2.
8. The nanovesicles of claim 7, wherein the nanovesicle comprises porphyrin phospholipid conjugates having cobalt chelated thereto.
9. A method of eliciting an immune response in an individual against streptococcal infection comprising administering to the individual an effective amount of a composition of claim 1.
10. The method of claim 9, wherein the elicited immune response is protective against an infection caused by S. pneumoniae.
11. The method of claim 10, wherein the infection caused by S. pneumoniae is pneumonia.
12. The method of claim 9, wherein the polypeptide in the composition is incorporated into a nanovesicle, wherein the nanovesicle comprises porphyrin phospholipid conjugates having cobalt chelated thereto.
13. The method of claim 9, wherein the polypeptide in the composition is incorporated into a hybrid biological delivery vehicle.
14. The method of claim 9, wherein the composition comprises an adjuvant.
15. The method of claim 12, wherein the nanovesicle has an adjuvant incorporated therein.
16. The method of claim 13, wherein the hybrid delivery vehicle has an adjuvant incorporated therein.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
DETAILED DESCRIPTION OF THE DISCLOSURE
[0039] In this disclosure we provide a treatment approach directed at a disease progression state of a microbial population rather than the general population. Doing so offers the potential to optimize treatment and reduce unintended pathological consequences. Such an approach is provided herein in the context of pneumococcal disease, culminating in a “smart vaccine” that directs an immune response to virulent cell populations while minimizing disruption of avirulent commensal colonization.
[0040] The term “immune response” as used herein refers to the concerted action of the cells of the immune system including one or more of lymphocytes, antigen presenting cells, phagocytic cells, granulocytes, and others that results in selective damage to, destruction of, or elimination from the animal body of invading pathogens, cells or tissues infected with pathogens.
[0041] The term “immunogen” as used herein refers to a substance that is able to stimulate or induce a humoral antibody and/or cell-mediated immune response in a mammal. This term may be used interchangeably with “antigen” herein.
[0042] The term “isolated” as used herein with respect to polypeptides means polypeptides that are substantially separated from other macromolecules normally associated with the polypeptide in its natural state. An isolated polypeptide can be completely free of other macromolecules normally associated with the polypeptide in its natural state. For example, polypeptides may be at least 50, 60, 70, 80, 90, 95, or 99% pure. An isolated polypeptide, for example, can be purified from a cell that normally expresses the polypeptide, may be synthesized, or can be produced using recombinant DNA methodology.
[0043] The terms “polypeptide”, “peptide” and “protein” may be used interchangeably to mean a polymer comprising two or more amino acids joined to each other by peptide bonds or modified peptide bonds. Short chains are generally referred to as peptides (about 30 amino acids or less), medium chains as polypeptides (from 30 to 1,000 amino acids), and longer chains as proteins. Polypeptides may contain amino acids other than the 20 gene-encoded amino acids. Polypeptides include amino acid sequences modified either by natural processes, such as post-translational processing, or by chemical modification techniques that are well known in the art.
[0044] The present disclosure provides compositions comprising PncO or a fragment thereof that elicits an immune response protective against a streptococcus, such as, for example, Streptococcus pnuemoniae. The PncO may be any one of those produced by a Streptococcus species, including those from Streptococcus pneumoniae, Streptococcus gordonii, Streptococcus sanguinis, Streptococcus thermophilus, Streptococcus suis, Streptococcus agalactiae, Streptococcus pyogenes, Streptococcus mutans, Enterococcus faecalis, Enterococcus faecium, Rhodococcus sp.
[0045] The PncO need not be identical to the amino acid sequence of the PncO S. pneumoniae. Various modifications can be made to the protein sequence without altering its immunogenicity, and protective capacity of antibodies raised thereto. For example, conservative substitutions may be made within the group of following amino acids 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M). For example, the antigen may be from 90 to 99% identical to the sequence of PncO provided herein, wherein the antigen is able to generate protective antibodies against a streptococcus, such as, for example, Streptococcus pnuemoniae.
[0046] The sequence of PncO is available as GenBank Accession No. ABJ54598.1 for pncO (blpY) from Streptococcus pneumoniae D39. The sequence is provided below.
TABLE-US-00001 SEQ ID NO: 1 MKKYQLLFKI SAVFSYLFFV FGLSQLTLIV QNYWQFSSQI GNFVWIQNIL SLLFSGVMIW ILVKTGHGYL FRIPRKKWLW YSILTVLVVV LHISFNVQTA KHVQSTAEGW NVLIGYSGTN FAELGIYVTL FFLTPLMEEL IYRGLLQHAF FKHSRFGLDL LLPSILFALP HFLSLPSLLD IFVFATFGII FAGLTRYTKS IYPSYAVHVI NNIVATFPFL LTFLHRVLG -
[0047] The surface accessible regions in the PncO sequence are bolded above. This is also illustrated in
[0048] The immunogenic antigen may be from 80 to 99% identical to the sequence of PncO provided herein, wherein the antigen is able to generate protective antibodies against a streptococcus, such as, for example, Streptococcus pnuemoniae. In one embodiment, the PncO has at least 70% identity, preferably 80 or 85%, such as at least 90% or at least 95, 98 or 99% identity to the PncO of SEQ ID NO:1.
[0049] The sequence of GlpO is available as GenBank Accession No. EC 1.1.3.21 from Streptococcus pneumoniae D39. The sequence is provided below.
TABLE-US-00002 SEQ ID NO: 2 MEFSKKTRELSIKKMQERTLDLLIIGGGITGAGVALQAAASGLETGLIEMQ DFAEGTSSRSTKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDP MLLPVYDEDGATFSLFRLKVAMDLYDLLAGVSNTPTANKVLSKDQVLERQP NLKKEGLVGGGVYLDFRNNDARLVIENIKRANQDGALIANHVKAEGFLFDE SGKITGVVARDLLTDQVFEIKARLVINTTGPWSDKVRNLSNKGTQFSQMRP TKGVHLVVDSSKIKVSQPVYFDTGLGDGR1VIVFVLPRENKTYFGTTDTDY TGDLEHPKVTQEDVDYLLGIVNNRFPESNITIDDIESSWAGLRPLIAGNSA SDYNGGNNGTISDESFDNLIATVESYLSKEKTREDVESAVSKLESSTSEKE ILDPSAVSRGSSLDRDDNGLLTLAGGKITDYRK1VIAEGAMERVVDILKAE FDRSFKLINSKTYPVSGGELNPANVDSEIEAFAQLGVSRGLDSKEAHYLAN LYGSNAPKVFALAHSLEQAPGLSLADTLSLHYAMRNELALSPVDFLLRRTN HMLFMRDSLDSIVEPVLDEMGRFYDWTEEEKATYRADVEAALANNDLAELK N
[0050] The surface accessible regions in the GlpO sequence are bolded above. This is also illustrated in
[0051] The immunogenic antigen may be from 80 to 99% identical to the sequence of GlpO provided herein, wherein the antigen is able to generate protective antibodies against a streptococcus, such as, for example, Streptococcus pnuemoniae. In one embodiment, the GlpO immunogenic antigen has at least 70% identity, preferably 80 or 85%, such as at least 90% identity or at least 95, 98 or 99% identity to the GlpO sequence provided herein.
[0052] The immunogenic composition can have PncO as the only antigen, PncO and GlpO as the only antigens or it can have additional antigens. For example, the immunogenic composition can comprise PncO and other Streptococcus antigens, such as antigens from S. pnuemoniae, particularly those that are at least partially or fully surface exposed. For example, the compositions can have stkP and PspA.
[0053] The composition can comprise PncO and GlpO, and/or antigenic fragments thereof, which fragments are able to generate protective antibodies against a streptococcus, such as, for example, Streptococcus pnuemoniae. The antigenic fragments may be isolated fragments. The antigenic fragments are typically 15 to 30 amino acid (and all amino acid numbers therebetween) long and will ideally comprise an epitope from the surface exposed portions of the sequences. For example, the fragments may comprise amino acid sequences that contain the sequences of the surface exposed portions shown in
[0054] The formulation can include a carrier or excipient. The formulations can include an adjuvant to enhance the extent or nature of the immune reaction. Determination of the amount of the immunogenic antigen and/or the adjuvant can be in accordance with standard techniques in the pharmaceutical or veterinary arts.
[0055] Adjuvants that may be usefully employed in the preparation of vaccines include the following: oil adjuvants, for example, Freund's complete and incomplete adjuvants, mineral salts, alum, silica, kaolin, and carbon, polynucleotides and certain natural substances of microbial origin. An example of an adjuvant is a non-covalent complex of alpha-lactalbumin and fatty acid. Fatty acids useful for making the complex include unsaturated cis C14 to C20 fatty acids. (See WO 2014/008465). An example of an adjuvant is monophsophryl A.
[0056] With administration of immunogenic antigens, typically an adjuvant is used. For example, an adjuvant can be used as a 0.001 to 50 wt % solution in phosphate buffered saline, and the antigen is present in the order of micrograms to milligrams, such as about 0.0001 to about 5 wt %, such as about 0.0001 to about 1 wt %, such as about 0.0001 to about 0.05 wt %. The antigen can be present in an amount in the order of micrograms to milligrams, or, about 0.001 to about 20 wt %, such as about 0.01 to about 10 wt %, or about 0.05 to about 5 wt %.
[0057] The present disclosure provides pharmaceutical preparations which comprise, consist essentially of, or consist of PncO or immunogenic fragments thereof. The preparations can comprise other antigens such as, for example, GlpO. In one embodiment, the only antigens in the preparation are PncO and GlpO and/or immunogenic fragments thereof. For example, the composition may comprise PncO and/or GlpO as the only polypeptides in the composition.
[0058] The pharmaceutical preparations can comprise additives, such as diluent, adjuvant, excipient, or carrier. Such additives can be liquids, such as water and oils, saline, glucose or the like, and auxiliary, stabilizing, thickening, or lubricating agents, wetting or emulsifying agents, or pH buffering agents, gelling or viscosity enhancing additives, detergents and solubilizing agents (e.g., TWEEN® 20, TWEEN® 80 also referred to as polysorbate 20 or 80), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite), preservatives (e.g., Thimersol, benzyl alcohol), bulking substances (e.g., lactose, mannitol), flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired. See “Remington's Pharmaceutical Science”, 17th edition, 1985. Non-aqueous solvents or vehicles can be used such as propylene glycol, polyethylene glycol, vegetable oils, such as olive oil and corn oil, gelatin, and injectable organic esters such as ethyl oleate. The formulations may be lyophilized and redissolved or resuspended just before use. The formulation may be sterilized by, for example, filtration through a bacteria retaining filter, by incorporating sterilizing agents into the compositions, by irradiating the compositions, or by heating the compositions.
[0059] The present compositions can be provided as liquid preparations, suspensions, emulsions, tablets, pills, sustained-release formulations, emulsions, aerosols, sprays, or any other form suitable for introducing the compositions into a subject to generate an immune response protective against S. pneumoniae or other streptococcaciae. The compositions may be administered to a human or a non-human animal.
[0060] The antigenic compositions can be administered in delivery vehicles, which can include, but are not limited to, nanoparticles, nanovesicles (such as liposomes or other lipidic structures) and biological or hybrid delivery vehicles. Liposomes may comprise one or more types of phospholipids known in the art. Nanovesicles comprising porphyrin conjugates can be used. The nanovesicles comprising porphyrin conjugates may have cobalt chelated to the porphyrin moiety. For example, the nanovesicles can comprise porphyrin phospholipid conjugate, phospholipid that is not conjugated to phospholipid, optionally cholesterol, and optionally PEG-phospholipid. The phospholipids can be any phospholipids, saturated or unsaturated, such as DOPC, DMPC and DSPC. Nanovesicle carrier capable of surface-orienting peptide-based antigens are useful for enhanced immune responses. The nanovesicles may have an in-built adjuvant component. A biological based delivery vehicle can also be used. For example, a hybrid vector delivery vehicle described in WO2016019126 can be used. The hybrid vehicle can have incorporated therein an adjuvant.
[0061] The adjuvant can be administered as a separate component in the immunogenic compositions or it can be incorporated into the delivery vehicle.
[0062] The antigenic compositions may be used with a hybrid vector delivery vehicle. For example, a hybrid vector designed to assist the intracellular delivery of antigen cargo to antigen presenting cells can be used. The hybrid vector can be a biological based vector. For example, as a combination of biomaterial and biological components, each chosen due to individual use as delivery vehicles, the combined vector allows synergistic delivery mechanisms and disparate engineering tools to influence the process of antigen transport. Thus, steps associated with antigen presenting cells (APC) targeting, uptake, activation, and intracellular antigen release have been designed through a combination of the two components of the hybrid device. Highlighting the dual engineering capabilities of the hybrid vector are the polymer chemistry steps used to conjugate a mannose ligand to the poly(beta-amino ester) shell of the device which aids in APC targeting and vector uptake. Similarly, expression and localization of the LyE protein to the bacterial component of the hybrid vector safely extends the dose limits of the device.
[0063] A different aspect of the vector is also highlighted. Namely, the option for in situ antigen generation. Here, the biological core of the vector allows the molecular biology tools associated with a facile microbe like E. coli to be used in both antigen consolidation and internal expression prior to delivery. This capability makes the normal requirement of separate bioprocesses dedicated to antigen generation and purification unnecessary and allows a “one-pot” production and delivery device for vaccine applications.
[0064] The hybrid vector design also offers options associated with stable storage and widespread distribution; however, features related to production and access are targets of future research. In the present work, the results illustrate the first directed application of the vector, tested in the context of pneumococcal disease. The hybrid vector demonstrated improved immune response metrics using a model protein antigen (PspA) when compared to traditional vaccine formulations with alum and CFA. More importantly, once the molecular biology tools of the vector were utilized to consolidate newly-identified antigens, protection was provided across a range of clinically-relevant S. pneumoniae strains and disease models.
[0065] The antigens selected for consolidation to the hybrid vector are based upon those upregulated during virulent transition, thus, the objective is to target the disease-causing subset from a greater population of colonizing and asymptomatic S. pneumoniae cells. This capability was observed across different pneumococci strains, administration routes, and in vivo conditions, including disease onset triggered by influenza. Furthermore, the effectiveness of the antigens delivered with the hybrid vector resulted in protection extended to 10 additional S. pneumoniae strains. Though not all levels of protection were the same, complete protection was observed in 11 of 15 cases, emphasizing the broad coverage potential of the consolidated antigens tested in this study. Owing to the tools associated with the hybrid vector, even broader coverage can be expected upon the consolidation of additional virulence-associated antigens into the vector design. This feature, coupled with the conserved nature of the antigens identified and tested (Table 1 and
[0066] Balancing the capabilities offered by the hybrid design is the potential for toxicity given the bacterial nature of the vector's core and the cationic charge of the polymer coating. As demonstrated, the final vector provides attenuation through cellular engineering of the bacterial core and via the process of polymer coating. More importantly, the vector has not provoked any toxicity upon administration unless heightened dosages are utilized. Yet, even under enhanced dosage levels, it is possible to negate toxic effects due to the biological attenuation afforded by the LyE gene, providing another level of engineering design in applying the hybrid vector.
[0067] Consolidating virulent-specific antigens to the hybrid device also offers a smart vaccine with in-built antigen production or an in situ means of cargo generation. Combined, the vector offers engineering elements that range from process-level scalability and distribution to cellular-level immune response tunability with the potential to be directed at a number of challenging vaccine opportunities beyond pneumococcal disease.
[0068] The compositions can be administered to a population in general, or can be targeted to individuals who are at risk for developing Streptococcus infections such as S. pneumoniae. For example, it can be administered to any individual who is in close contact with an infected individual.
[0069] The compositions can be introduced into a subject using any suitable administration route, including but not limited to parenteral, subcutaneous, intraperitoneal, intramuscular, intravenous, mucosal, topical, intradermal, and oral administration.
[0070] Immunization can be done by way of a single dose or it can be done by multiple doses that are spaced apart. For example, an initial administration and subsequent booster doses can be used. The compositions can be administered alone, or can be co-administered or sequentially administered with other prophylactic (such as, for example, other immunogenic compositions) or therapeutic compositions (such as, for example, antibiotics).
[0071] In one aspect, this disclosure provides a method of preventing pneumonia in an individual comprising administering to the individual an effective amount of a composition described herein. This disclosure also provides a method of reducing the overall incidence of pneumonia in a population comprising administering to a plurality of individuals in the population an effective amount of compositions described herein, whereby administration of the immunogenic compositions prevents the occurrence of pneumonia in at least some of the individuals in the population such that overall incidence of pneumonia n the population is reduced.
[0072] The method of the present disclosure provides a strategy to induce an antibody-mediated immune response against a disease-causing subset of a commensal microbial population. Specifically, antigens associated with biofilm-released, virulent pneumococci have demonstrated unequivocal challenge protection and reduction in bacterial burden of a range of clinically-relevant S. pneumoniae strains under varying disease conditions. The results offer a response to a globally-relevant disease and growing concerns associated with current treatment options including risks posed by emerging serotype- and niche-replacement pathogens. Importantly, the same tools enabling the results of this work can be applied to continually identify and simultaneously deliver new antigens as a means to address the diversity and antigenic drift potential of S. pneumoniae and other pathogens that exhibit similar virulence progression.
[0073] In one aspect, the present disclosure provides a method of identifying immunogens, such as genes, RNA, proteins, immunogens, or polypeptides that can be used for vaccine compositions against pathogens colonizing the nasal cavity mucosa—generally as a biofilm. Such pathogens will include new serotypes of S. pneumoniae, other bacteria (including those commonly found in the nasopharynx and those that colonize in addition), or other microbial targets (including viruses or fungal organisms). The method comprises inducing release of the pathogens by applying external triggers, including viral induced release or heat triggered release etc. For example, heat triggered release can be achieved by exposure to temperatures higher than normal body temperatures. For example, the biofilm release can be achieved by exposure to temperatures from 37° C. to 39° C. for about 1 to 6 hours, or more. The released cells can be collected and characterized. Specific serotypes can be identified, cultured and surface exposed proteins can be identified that are unique to the serotype, for example. The same analysis can identify numerous molecular antigenic targets, as introduced above that could also be valuable vaccine ingredients. The newly identified proteins or portions thereof can be used to determine if immunizations with these proteins or portions thereof (such as surface exposed portions) can induce immunity against a broad spectrum of S. pneumoniae and/or other microbial targets.
EXAMPLE 1
[0074] The current work presents a strategy capable of providing directed protection against virulent, biofilm-released S. pneumoniae. Thus, the present strategy is based upon selectively targeting those pneumococci that are triggered for virulent biofilm escape in response to changes in the nasopharyngeal environment (
[0075] Through the combination of an in vitro biofilm model (
TABLE-US-00003 TABLE 1 Antigen cloning summary Antigen Restriction Gene Primers Source Sites Plasmid Name dexB F: TAAGCACATATGCAAGAAAAATGGT D39 NdeI/XhoI pET21c pCJ05 GGCATAATGCCGTAG (SEQ ID NO: 3) R: TAAGCACTCGAGTTCCACACAGAAA GCATCCCA (SEQ ID NO: 4) htrA F: D39 NcoI/XhoI pET20b pCJ06 TAAGCACCATGGGGAAACATCTAAA AACATTTTACAA (SEQ ID NO: 5) R: TAAGCACTCGAGAGATTCTAAATCAC CTGAAC (SEQ ID NO: 6) glpO F: D39 SacI/XhoI pET21c pCJ07 TAAGCAGAGCTCGAATTTTCAAAAA AAACACGTGAATTGTC (SEQ ID NO: 7) R: TAAGCACTCGAGATTTTTTAATTCTG CTAAATCGTTGTTAG (SEQ ID NO: 8) stkP F: D39 NdeI/NotI pET21c pCJ08 TAAGCACATATGATCCAAATCGGCA AGATTTT (SEQ ID NO: 9) R: TAAGCAGCGGCCGCAGGAGTAGCTG AAGTTGTTTTA (SEQ ID NO: 10) blpB F: D39 NcoI/XhoI pET20b pCJ09 TAAGCACCATGGGGAATCCTAATCTT TTTAGAAG (SEQ ID NO: 11) R: TAAGCACTCGAGATCAGAATGGGTT AAAATTTTA (SEQ ID NO: 12) pncO F: EF3030 NdeI/XhoI pET21c pCJ10 TAAGCACATATGAAAAAGTATCAAC TTCTATT (SEQ ID NO: 13) R: TAAGCACTCGAGCCCCAAGACCCTAT GTAGAAAA (SEQ ID NO: 14) prtA F: D39 SacI/XhoI pET21c pCJ12 TAAGCAGAGCTCAAAAAAAGCACAG TATTGTC (SEQ ID NO: 15) R: TAAGCACTCGAGATCTTGATTTTTTTT CTTCAAT (SEQ ID NO: 16)
[0076] The delivery of GlpO and PncO, both recombinantly produced with 6×histitine tags, was facilitated using a novel cobalt porphyrin-phospholipid (Co-PoP) liposomal carrier capable of surface-orienting peptide-based antigens for enhanced immune responses and featuring an in-built adjuvant component (monophosphoryl lipid A) that outperformed comparative formulations featuring traditional alum and complete Freund's adjuvant (
[0077] The directed nature of the new antigens was then tested in a series of experiments presented in
[0078] However, the antigenic drift potential of S. pneumoniae emphasizes the need for any new antigens to be general and effective across a wide range of challenge strains (Table 2). To this end, the new antigens were tested in mice infected with a range of S. pneumoniae strains chosen for their notable difficulty to protect against and the variability between strains with regard to serotype and genetic background. Complete protection was provided for both sepsis and pneumonia challenge models (
TABLE-US-00004 TABLE 2 S pneumoniae strains used in the current study. Italicized strains are not currently included in commercial vaccines. Capsule Included in This Study Type Virulence Current Protection Strain (Serotype) Pattern Vaccines % D39 2 1 Yes 100% D39-Heat Released 2 4 Yes 100% DBL2 2 2 Yes 100% A66.1 3 1 Yes 100% WU2 3 1 Yes 100% ATCC6303 3 2 Yes 100% 3JYP2670 3 2 Yes 50% TIGR4 4 2 Yes 100% DBL5 5 2 Yes 66% WCH16-Heat Released 6A 4 Yes 50% DBL6A 6B 2 Yes 66% ATCC-6312-Heat Released 12F 4 No 84% ATCC-10354-Heat Released 15B 4 No 100% EF3030 19F 3 Yes 100% EF3030-Heat Released 19F 4 Yes 100% ATCC-6324-Heat Released 24 4 No 100% ATCC-6327-Heat Released 27 4 No 100% Virulence Pattern Lung Classification Carriage Infection Sepsis Comments 1 − ++ +++ Bacteria carries poorly and transitions to the blood wherever placed 2 ± ++ ++ Bacteria causes strong infection wherever placed; occasionally will transition to the blood and cause death 3 ++ +++ ± Bacteria carries well and infects locally but unlikely to kill; rarely transitions to the blood and causes death 4 ++ +++ ++ Bacteria carries well and causes strong infection wherever placed and can transition to the blood
TABLE-US-00005 TABLE 3 PncO and GlpO antigen description and analysis. Strain Conservation Virulent Gene (% Homology) Expression (1og2) Average Surface Surface Size Relative to log2 Fold Surface Full Accessible Accessible Gene (bp) Function Planktonic Biofilm Change Accessible Protein Regions Epitopes pncO 690 Bacteriocin 8.5 4.8 6.6 Yes 95% 93% 97% ABC transporter transmembrane protein glpO 1,827 α- 9 5.9 7.4 Yes 99% 98% 98% glycerophosphate oxidase
[0079] In a final set of experiments presented in
Methods
[0080] This study was carried out in strict accordance with the recommendations in the Guide for the Care and Use of Laboratory Animals of the National Institutes of Health. The protocols were approved by the Institutional Animal Care and Use Committee at the University at Buffalo, Buffalo, N.Y. All bacterial inoculations and treatments were performed under conditions designed to minimize any potential suffering of the animals.
Reagents
[0081] Bacterial and cell culture media and reagents were purchased from Fisher Chemical and Sigma-Aldrich (St. Louis, Mo.). Chemically defined bacterial growth medium (CDM) was obtained from JRH Biosciences, Lexera, Kans. Sheep blood was purchased from Hemostat Laboratories (Dixon, Calif.). All remaining reagents were purchased from Sigma-Aldrich.
Antigen Preparation
[0082] All antigen genes were cloned from the genomic DNA of S. pneumoniae strains using primers summarized in Table 1. Each PCR product was then inserted into pET expression vectors as outlined in Table 1 using the flanking restriction sites indicated (designed within the primers). Constructs were verified by colony PCR and restriction digest analysis and were then chemically transformed into BL21(DE3) with resulting single-colony transformants cultured in 3 mL lysogeny broth (LB) at 37° C. with shaking prior to 15% glycerol stock storage at −80° C. Expression was initially confirmed by 3-5 mL LB cultures started from glycerol stocks and cultured at 37° C. with shaking until an OD.sub.600 of 0.4 was achieved. After which, cultures were induced with isopropyl β-D-1-thiogalactopyranoside (IPTG) (1 mM) for 1 hour. Upon collection via centrifugation, cells were washed twice with PBS and resuspended in 25 mM Tris-HCL prior to boiling with loading dye and expression analysis/confirmation via SDS-PAGE.
[0083] Glycerol stocks were then used to start overnight 3 mL LB cultures incubated at 37° C. with shaking and used to inoculate (1% v/v) 1 L of terrific broth, which was then grown to a concentration of 0.4-0.6 OD.sub.600 under the same culture conditions. IPTG induction (100 μM) occurred at this point prior to continued culture overnight at 22° C. After clarification by centrifugation, cells were resuspended in Buffer A (50 mM Na.sub.2PO.sub.4, 500 mM NaCl, and 10% glycerol) and lysed via French press. The resulting lysate was clarified by centrifugation and the resulting lysate supernatant clarified further via ultracentrifugation at 142,000×g (RFC) for 45 minutes. Lysate collected was confirmed by SDS-PAGE at this stage prior to column purification.
[0084] Antigen protein products were then purified by passing lysate supernatant through a fast protein liquid chromatography column (GE Healthcare HisTrap HP, 1×1 mL) using 2% Buffer B (50 mM Na.sub.2PO.sub.4, 500 mM NaCl, 10% glycerol, and 250 mM imidazole) and 98% Buffer A as the mobile phase. The protein was eluted with 100% Buffer B, and a UV absorbance of 280 nm was used to detect the fractions containing protein in the elution. Those fractions were pooled and protein content characterized by SDS-PAGE and quantified by Pierce™ Micro BCA™ Protein Assay assessment.
Vaccine Formulation and Immunization
[0085] Antigen cobalt porphyrin-phospholipid (Co-PoP) liposomal carrier vectors were generated as described previously (Shao et al., Nat Chem 7, 438-446, (2015)). Each injection dose contained 25 μg monophosphoryl lipid A (MPLA) in liposomes comprising DOPC:cholesterol:MPLA:Co-PoP at a molar ratio of 50:30:5:5. After dissolving liposomes in chloroform in a test tube, the solvent was evaporated and the film was further dried under vacuum overnight. Liposomes were then rehydrated with phosphate buffered saline (PBS) and sonicated. Binding ability of new antigens was evaluated by incubating 25 μg of protein with 20 μg of liposomes in 200 μL PBS within a well of a 96-well plate. Fluorescence in the FRET channel (ex: 430 nm, em: 525 nm) was measured periodically with a fluorescence microplate reader (Tecan Infinite II). Data were normalized to the FRET signal for protein without addition of liposomes. Dynamic light scattering was used to evaluate the particle diameter and zeta potential of liposomes containing three concentrations of PspA (0, 5, and 15 μg). Once binding was confirmed, antigen was incubated at 4° C. with Co-PoP liposomes overnight before animal injection.
[0086] Outbred 6-week-old female CD-1 mice (Harlan Laboratories, Indianapolis, Ind.) were used in immunization experiments. Mice were immunized by intraperitoneal injection (i.p.; 200 μL), subcutaneous injection (s.q.; 200 μL), and intranasal aspiration (40 μL). Final antigen (Table 1) doses ranged from 5 to 15 μg in either naked or liposomal format. When combined, PncO and GlpO (Table 3) were administered at 15 μg each. After 14 days, mice were boosted with the same formulations. At day 14 and day 28, serum samples were collected from the mice by retro-orbital bleeding. For passive immunizations, respective sera were diluted ten times and administered via i.p. injection (200 μL).
Bacterial Preparation and Biofilm Release
[0087] Bacterial strains used in this study are listed in Table 2 and were initially grown on Todd-Hewitt agar plates supplemented with 0.5% yeast extract and 5% sheep blood and incubated overnight at 37° C. Single colonies were used to inoculate 5 mL Todd-Hewitt broth containing 0.5% yeast extract and incubated at 37° C. to an OD.sub.600 of 0.6. At this point, bacteria were used for challenge studies after washing one time with and resuspending in PBS.
[0088] NCI-H292 epithelial cells were cultured in RPMI-1640 medium in T75 flasks at 37° C. and 5% CO.sub.2. After reaching 100% confluency, H292 cells were prefixed in 4% buffered paraformaldehyde at 34° C. for 48 hours followed by three washes with PBS. CDM-grown pneumococci were then seeded onto fixed H292 cells with change of media occurring every 12 hours. Formed biofilms were exposed to heat (38.5° C.) for 4 hours and released cells were then collected by centrifugation, washed and resuspended in PBS, and quantified by OD.sub.600 measurement. Biofilm associated cells were disrupted by gentle pipetting, collected by centrifugation, washed and resuspended in PBS, and quantified by OD.sub.600 measurement.
Scanning Electron Microscopy
[0089] Biofilms grown in vitro for 48 hours were fixed using 2.5% glutaraldehyde, 0.075% ruthenium red, and 0.075 M lysine acetate in 0.1 M sodium cacodylate buffer (pH 7.2) for 1 h at 22° C. This procedure has been shown to retain carbohydrate structures and improve preservation of biofilm morphology. Samples were washed three times without shaking for 15 min at 22° C. in 0.075% ruthenium red in 0.2 M sodium cacodylate buffer and were then dehydrated with a graded series of ethanol solutions (10, 30, 50, 75, 95, and 100%) at 22° C., with 15 min used for each step. Samples were exchanged into 100% hexamethyldisilazane and allowed to air dry before being mounted onto stubs, carbon coated, and analyzed using an SU70 scanning electron microscope at an acceleration voltage of 5.0 kV (available through the South Campus Instrumentation Center, University at Buffalo, Buffalo, N.Y.).
Challenge Models
[0090] To induce sepsis or pneumonia, mice were administered i.p. or i.n. (with isoflurane), respectively, with 1×10.sup.4 to 1×10.sup.6 CFU of pneumococci strains (Table 2). To induce colonization, mice were administered 1×10.sup.6 CFU bacteria i.n. without isoflurane. To mimic influenza-induced pneumonia, pneumococci colonization was followed by intranasal inoculation with 40 plaque forming units of IAV. IAV strain A/PR8/34 (H3N2) (ATCC VR-777) was used, and titers were determined by plaque assays. Mice were monitored every four hours for signs of morbidity (huddling, ruffled fur, lethargy, and abdominal surface temperature). Mice found to be moribund were euthanized via CO.sub.2 asphyxiation and cervical dislocation.
Tissue Bacterial Count
[0091] At predefined time points (24 and 48 h post-infection for intraperitoneal and intranasal challenges, respectively) or upon becoming moribund, mice were euthanized (as described above) and a combination of nasopharynx tissue, nasopharyngeal lavage fluid, lung, liver, spleen, and blood samples was collected and bacterial burden determined as described. Briefly, tissue and organ homogenate, lavage fluid, and blood were sonicated to ensure dissociation of bacterial aggregates and then serially diluted on tryptic soy and 5% blood agar plates prior to enumeration. Tissue burden data and associated challenge data are presented in
Antibody Analysis
[0092] To characterize antibody titers associated with delivery optimization (
Disease Incidence Analysis
[0093] The data presented in
Statistical Analysis
[0094] Column comparisons were analyzed for statistical significance using a two-tailed Student t test for unpaired data. Multivariance analysis was done using one-way analysis of variance (ANOVA) that was corrected using the Bartlett variance test and for multiple comparisons using the Bonferroni multiple-comparison test. For both tests, a P value of 0.05 was considered significant. Statistical analysis was performed using the GraphPad Prism software (version 6.0h.283; GraphPad Software Inc., La Jolla, Calif.). All data resulted from a minimum of three samples with animal experiments using a minimum of four (and in most cases twelve) subjects.
EXAMPLE 2
[0095] In this example, new antigens associated with pneumococcal disease virulence were utilized as a basis for testing the delivery and adjuvant capabilities of a hybrid biological-biomaterial vector. The hybrid design provides 1) dual passive and active targeting of antigen presenting cells (APCs), 2) natural and multi-component adjuvant properties, 3) dual intracellular delivery mechanisms, and 4) a simple formulation mechanism. In addition, the hybrid device enables device-specific, or in situ, antigen production via the biological component of the vector. This capability eliminates the need for dedicated antigen production and purification prior to vaccination efforts while leveraging the features of the overall delivery device. Here, we present the potent utilization of the vector towards pneumococcal disease highlighted by protective capabilities when tested against a range of clinically-relevant Streptococcus pneumoniae strains. More broadly, the results here point to similar levels of success with other diseases that would benefit from the production, delivery, and efficacy capabilities offered by the hybrid vector.
[0096] This work features a hybrid antigen delivery vector composed of biological and biomaterial components each designed to facilitate, enhance, and direct the immune response process. The biological portion of the vector is a bacterial cell (nonpathogenic Escherichia coli) that, as a result of the microbial framework, possesses natural adjuvant properties and also allows the delivery of either protein or genetic antigens. Coating of the bacterial core with a poly(beta-amino ester) (PBAE) covalently linked to mannose provides a combined delivery device with properties to assist antigen cargo cellular translocation. Namely, the size of the overall vector allows passive targeting of phagocytic APCs programmed to engulf such particles; in addition, the vector's composition and the surface characteristics endowed by the mannosylated PBAE will engage APC receptors and enhance uptake upon vector administration. The biomaterial and biological components can also be designed to facilitate endosomal escape and cytosolic trafficking post-phagocytosis. Finally, the bacterial core of the vector allows antigen cargo to be delivered as protein, nucleic acid, or both.
[0097] This last feature also provides an opportunity to directly generate and maintain the required antigen in lieu of a dedicated bioprocess to produce genetic or protein formats. Thus, the hybrid vector provides the added capability of “in situ” antigen production that can be coupled to the delivery features of the device. Combined, the vector offers a broad array of engineering opportunities meant to improve vaccine production (via rapid and scalable means of component generation, in situ antigen provision, and simple hybrid formulation) and potency (via the innate design and diverse engineering tools, i.e., polymer chemistry and molecular biology).
[0098] This premise is the basis for the following results. Within the framework of pneumococcal disease, new antigens were generated and delivered via the hybrid vector. Directed, broad, and potent results were obtained as assessed within disease challenge assays against a range of clinically-relevant S. pneumoniae strains. Beyond the protection data collected for this particular disease type, the vector format offers opportunities for other maladies (such as cancer or viral-based infectious disease) similarly expected to require an advanced delivery device capable of supporting a similarly advanced immune response.
Results
[0099] Hybrid Vector Assessment with Model and Novel Antigen Delivery
[0100] The data presented in this work marks the first application of the hybrid vector and the utility of the device is assessed in the context of pneumococcal disease, which afflicts millions worldwide annually especially resource-limited children and elderly. Initial experiments were dedicated to optimizing and characterizing the use of the hybrid vector when incorporating a model protein antigen for pneumococcal disease, PspA. The results demonstrate improved outcomes when compared to traditional vaccine formulations containing either alum or complete Freund's adjuvant (CFA;
[0101] Dosing levels of the hybrid vector containing PspA were also assessed and optimized across administration routes and in response to S. pneumoniae sepsis challenge using a D39 strain (
[0102] The hybrid vector was then used to screen several antigen candidates selected due to enhanced expression during S. pneumoniae virulence transition during the course of pneumococcal disease progression (Table 4). As such, the antigens would serve as the basis of a “smart vaccine” capable of directing a subsequent immune response to only a virulent sub-set of S. pneumoniae cells (
TABLE-US-00006 TABLE 4 DexB, GlpO, StkP, and PncO antigen description and analysis. Strain Conservation Virulent Gene (% Homology) Expression (log2) Average Surface Surface Size Relative to log2 Fold Surface Full Accessible Accessible Gene (bp) Function Planktonic Biofilm Change Accessible Protein Regions Epitopes dexB 1,608 Glucan 1,6-α- 1.5 1.5 1.5 No 98% N/A N/A glucosidase glpO 1,827 α-glycerophosphate 9 5.9 7.4 Yes 99% 98% 98% oxidase stkP 1,980 Serine/threonine 0.7 0.7 0.7 Yes 99% 99% 99.4% protein kinase pncO 690 Bacteriocin ABC 8.5 4.8 6.6 Yes 95% 93% 97% transporter transmembrane protein
TABLE-US-00007 TABLE 5 Consolidated plasmid (pLF) cloning summary Antigen Restriction Gene Primers Source Sites dexB F: pCJ05 BamHI/AscI GCGGGATCCCAAGAAAAAT GGTGGCATAATGCCGTAG (SEQ ID NO: 17) R: ATAGGCGCGCCTTATAGTA ATTCCACACAG (SEQ ID NO: 18) glpO F: pCJ07 SalI/NotI GCGGTCGACAAGGAGATAT AATGGAATTTTCAAAAAAA AC (SEQ ID NO: 19) R: GCGGCGGCCGCTTAATTTT TTAATTCTGC (SEQ ID NO: 20) stkP F: pCJ08 NdeI/MunI GCGCATATGATCCAAATCG GCAAGATTTTTG (SEQ ID NO: 21) R: GCGCAATTGTTAAGGAGTA GCTGAAGTTGTTT TAG (SEQ ID NO: 22) pspA F: pUAB055 FseI/XhoI ATAGGCCGGCCAAGGAGAT ATAATGGAAGAATCTCCCG TAGCCA (SEQ ID NO: 23) R: ATACTCGAGTTATTCTGGG GCTGGAGTTTCTGGA (SEQ ID NO: 24)
[0103] To demonstrate the potency and versatility of the hybrid vector two-plasmid system, challenge levels and strains of S. pneumoniae were varied within vaccine protection assays. Strain D39 challenge was tested up to 10.sup.10 cells (
[0104] Finally, to further assess the protective capabilities of the antigens delivered with the hybrid vector, vaccination was tested against an extended panel of S. pneumoniae strains representing diverse serotypes notably difficult to protect against with current vaccine formulations; complete protection and reduced bacterial burden were observed (
Directed Protection and Expanded Strain Coverage
[0105] The directed nature of the vaccination strategy was tested first by comparing vaccinated and non-vaccinated mice subjects with avirulent and virulent S. pneumoniae strains (
[0106] The consolidated aspect of the vaccine formulation also offers extended protection. Namely, the conserved nature of the individual antigens (Table 4), when presented in combination, provides the potential to cover a broad range of S. pneumoniae strains (Table 2). Extended protection was thus tested against a series of 10 additional S. pneumoniae strains with protection enhancement observed in all cases and complete protection provided in six cases (
Predicting Protection Potential
[0107] Though data presented support the broad protection potential of the consolidated antigens generated and delivered within the hybrid vector, the mutational potential of individual and combined antigens was predicted to further assess wide-spread and extended utilization of the vaccination strategy (
Materials and Methods
[0108] Experimental Design. A hybrid biological-biomaterial vector was tested in the delivery of virulent-specific antigens targeting pneumococcal disease progression. Success was assessed by mouse model immune response outcomes that included balanced antibody profiles, a directed targeting of virulent S. pneumoniae cells, reduced bacterial dissemination and tissue burden, and challenge protection. The hybrid vector allowed innate (or in situ) maintenance, consolidation, and production of the antigens in addition to other features that span vaccine production and enhanced delivery capability.
[0109] This study was carried out in strict accordance with the recommendations in the Guide for the Care and Use of Laboratory Animals of the National Institutes of Health. The protocols were approved by the Institutional Animal Care and Use Committee at the University at Buffalo, Buffalo, N.Y. All bacterial inoculations and treatments were performed under conditions designed to minimize any potential suffering of the animals.
[0110] Materials. Bacterial and cell culture media and reagents were purchased from Fisher Chemical and Sigma-Aldrich (St. Louis, Mo.). Chemically defined bacterial growth medium (CDM) was obtained from JRH Biosciences, Lexera, Kans. Sheep blood was purchased from Hemostat Laboratories (Dixon, Calif.). Monomers were purchased from Sigma-Aldrich (St. Louis, Mo.) and TCI (Portland, Oreg.). Acetone (HPLC), chloroform (HPLC), n-hexadecane (99%), DMF (HPLC), and DMSO (≥99.7%) were purchased from Fisher Chemical. Phosphate buffered saline (PBS) was purchased from Life Technologies (Grand Island, N.Y.). All remaining chemicals and reagents were purchased from Sigma-Aldrich.
[0111] Polymer Synthesis. The polymer used in this study, D4A4-Man, was synthesized in a four-step reaction (
[0112] Bacterial Strains and Plasmid Generation. Antigen genes were amplified from the genomic DNA of S. pneumoniae strains using primers summarized in Table S2. Each PCR product was cloned into pET expression plasmids using the flanking restriction sites indicated (designed within the primers). Constructs were verified by colony PCR and restriction digest analysis and were then chemically transformed into the BL21(DE3) E. coli cell line (Novagen). Resulting single-colony transformants were cultured in 3 mL lysogeny broth (LB) at 37° C. with shaking prior to 15% glycerol stock storage at −80° C. Plasmid selection antibiotics were used as needed during bacterial culture within LB medium. Expression was confirmed by 3-5 mL LB cultures started from glycerol stocks and grown at 37° C. with shaking until an OD.sub.600 of 0.4 was achieved. After which, cultures were induced with isopropyl β-D-1-thiogalactopyranoside (IPTG) (1 mM) for 1 hour. Upon collection via centrifugation, cells were washed twice with PBS and resuspended in 25 mM Tris-HCL prior to boiling with loading dye and expression analysis/confirmation via SDS-PAGE. Plasmid pUAB055 was used to express and clone the pspA gene.
[0113] To employ the two-plasmid system, pCJ10 was used in conjunction with a plasmid containing pspA, dexB, stkP, and glpO. The consolidated plasmid was assembled by sub-cloning each respective gene into a pACYCDuet-1 plasmid (
[0114] Hybrid Device Preparation. Bacterial and hybrid vectors were prepared from bacterial cultures inoculated at 2% (vol/vol) from overnight starter cultures. Following incubation at 37° C. with shaking until 0.4-0.5 OD.sub.600, samples were induced with 0.1 mM IPTG at 30° C. for 3 h. Bacterial vectors were then washed once and standardized to 0.5 OD.sub.600 in PBS; whereas, bacteria to be used in hybrid vector formation were washed once and standardized to 1.0 OD.sub.600 in 25 mM NaOAc (pH 5.15). Polymer was dissolved in chloroform, desiccated, and resuspended at 1 mg/mL in 25 mM NaOAc (pH 5.15) before being added in an equal volume to bacteria and mixed by vortexing on setting 5 (Analog Vortex Mixer; Fisher Scientific) for 10 s. Polymer/bacteria self-assembly was allowed to continue for 15 min, and devices were then diluted in PBS.
[0115] Hybrid Vaccine Immunization. Outbred 6-week-old female CD-1 mice (Harlan Laboratories, Indianapolis, Ind.) were used in immunization experiments. Mice were immunized by IP injection (200 μL), SQ injection (200 μL), and IN aspiration (40 μL) using isoflurane; unless indicated otherwise, 10.sup.7 hybrid vectors were used in vaccination experiments. Immunization of controls included sham (PBS; all samples were prepared in PBS as the background solution); PspA plus alum; and PspA plus complete Freund's adjuvant (CFA), which was replaced with Incomplete Freund's Adjuvant (IFA) during booster immunizations. After 14 days, mice were boosted with the same formulations except in the case of the CFA adjuvant as noted above. At days 14 and 21, samples were collected by retro-orbital bleeding and clarified by centrifugation to collect serum.
[0116] S. pneumoniae Bacterial Preparation and Biofilm Release. S. pneumoniae strains used in this study are listed in Table 6 and were initially grown on Todd-Hewitt agar plates supplemented with 0.5% yeast extract and 5% sheep blood and incubated overnight at 37° C. Single colonies were used to inoculate 5 mL Todd-Hewitt broth containing 0.5% yeast extract and incubated at 37° C. to an OD.sub.600 of 0.6. At this point, S. pneumoniae strains used for challenge studies were washed one time with and resuspending in PBS. NCI-H292 epithelial cells were cultured in RPMI-1640 medium in T75 flasks at 37° C. and 5% CO.sub.2. After reaching 100% confluency, H292 cells were prefixed in 4% buffered paraformaldehyde at 34° C. for 48 hours followed by three washes with PBS. CDM-grown pneumococci were then seeded onto fixed H292 cells with change of media occurring every 12 hours. Formed biofilms were exposed to heat (38.5° C.) for 4 hours and released cells were then collected by centrifugation, washed and resuspended in PBS, and quantified by OD.sub.600 measurement. Strains presented in Table 6 are a mix of mouse-passaged strains, which directly confer virulence upon culture and administration, and clinical isolates, which usually do not cause disease upon direct administration and require heat release from the in vitro biofilm model (detailed directly above) to render a virulent phenotype.
[0117] Challenge Models. To induce sepsis or pneumonia, mice were administered IP or IN (with isoflurane), respectively, with 1×10.sup.4 to 1×10.sup.10 CFU of pneumococci strains (Table 6). To induce colonization, mice were administered 1×10.sup.6 CFU bacteria IN without isoflurane. To mimic influenza-induced pneumonia, pneumococci colonization was followed by intranasal inoculation with 40 plaque forming units of IAV. A mouse-adapted IAV strain A/PR/8/34 (H1N1) (ATCC VR-95) was used, and titers were determined by plaque assays. Mice were monitored every four hours for signs of morbidity (huddling, ruffled fur, lethargy, and abdominal surface temperature). Mice found to be moribund were euthanized via CO.sub.2 asphyxiation and cervical dislocation.
[0118] Tissue Bacterial Count. At predefined time points (24 and 48 h post-infection for IP and IN challenges, respectively) or upon becoming moribund, mice were euthanized (as described above) and a combination of nasopharynx tissue, nasopharyngeal lavage fluid, lung, liver, spleen, and blood samples was collected and bacterial burden determined. Briefly, tissue and organ homogenate, lavage fluid, and blood were homogenized to ensure dissociation of bacterial aggregates and then serially diluted on tryptic soy and 5% blood agar plates prior to enumeration.
[0119] Histology Analysis. Following induction of isoflurane anesthesia, a midline abdominal incision was made and the abdominal aorta transected to exsanguinate and euthanize the animal. A midline incision was continued through the thoracic cavity and neck to allow injection of 5 mL normal saline into the right ventricle of the heart to flush the pulmonary vasculature of residual blood. A luer-lock hubbed 20 ga×½″ cannula was inserted into the trachea and secured in place with a suture. The lungs were fixed by insulflation with 10% neutral buffered formalin at 20 cmH.sub.2O for 24 h at room temperature. The lung lobes were removed, embedded in paraffin, and 5 μm tissue slices were prepared and stained with hematoxylin and eosin by standard histopathology techniques. Histology images were acquired with an Aperio ScanScope CS slide scanner (Leica Biosystems, Buffalo Grove, Ill.) using a 40×objective lens and subsequently analyzed using Aperio ImageScope software (v.12.3 Leica Biosystems).
[0120] Antibody Analysis. To characterize antibody titers associated with delivery optimization, an enzyme-linked immunosorbent assay (ELISA) was performed by coating a 96-well Costar high binding polystyrene plate with 10 μg/mL PspA in tris-buffered saline (TBS) at 4° C. overnight. The plate was blocked with 3% BSA in TBS-Tween 20 (TBS-T) for one hour at 22° C. Sera was diluted into TBS-T in ratios of 1:1,000, 1:5,000, 1:7,500 and 1:10,000 and added to the plate. The plates were then incubated at 37° C. with mild agitation for three hours. The secondary antibody (Anti-Mouse IgG, IgA, IgM (H+L), IgE, Highly X-Adsorbed-Biotin) was added to the wells in a 1:1,000 ratio and agitated for two hours. Streptavidin was added to each well in a 1:1,000 ratio and allowed to shake for 30 minutes. The signal was developed with p-nitrophenyl phosphate and the reaction was quenched using 0.75 M NaOH. The signal was detected using a plate reader spectrophotometer at an absorbance of 405 nm.
[0121] Statistical Analysis. Column comparisons were analyzed for statistical significance using a two-tailed Student t test for unpaired data. Multivariance analysis was done using one-way analysis of variance (ANOVA) that was corrected using the Bartlett variance test and for multiple comparisons using the Bonferroni multiple-comparison test. For both tests, a P value of 0.05 was considered significant. Statistical analysis was performed using the GraphPad Prism software (version 6.0h.283; GraphPad Software Inc., La Jolla, Calif.). All data resulted from animal experiments using six to twelve subjects per group except histology analysis, which utilized two mouse subjects per group.
EXAMPLE 3
[0122] This example provides additional data describing PncO and GlpO utilized in an expanded sepsis model. Results are shown in