SCREENING OF FIXED-POINT COUPLING SITES OF CYSTEINE-MODIFIED ANTIBODY-TOXIN CONJUGATE (TDC)

20210393794 · 2021-12-23

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed in the present invention is a cysteine-modified antibody-toxin conjugate. The cysteine-modified antibody-toxin conjugate is characterized in that: the antibody is an antibody in which cysteine is inserted on a fixed point, and insertion sites of the cysteine comprising one or more of the following sites: a 110th site, a IIIth site and a 142th site of a light chain in a Kappa/λL light chain constant region, and a 254th site, a 255th site, a 258th, a 259th site, a 354th site, a 355th site, a 357th site, a 378th site, a 379th site, a 386th site, a 387th site or a 410th site of a heavy chain of a heavy chain constant region of an IgG antibody.

    Claims

    1. A cysteine-modified antibody-toxin conjugate, comprising an antibody and a highly active cytotoxin, wherein the antibody comprises an inserted cysteine at one or more cysteine insertion site, wherein the cysteine insertion site comprises one or more of kappa/λ light chain constant region light chain positions 110, 111, 142, IgG antibody heavy chain constant region positions 254, 255, 258, 259, 354, 355, 357, 378, 379, 386, 387 or 410.

    2. The cysteine-modified antibody-toxin conjugate of claim 1, wherein the amino acid sequence of said cysteine insertion site comprises one or more of: TABLE-US-00008 LC-110ins: (SEQ ID NO: 45) EIKRTCVAAPS; LC-111ins: (SEQ ID NO: 46) IKRTVCAAPSV; LC-142ins: (SEQ ID NO: 47) NNFYPCREAKV; HC-254ins: (SEQ ID NO: 48) ISRTPCEVTCV; HC-255ins: (SEQ ID NO: 49) SRTPECVTCVV; HC-258ins: (SEQ ID NO: 50) PEVTCCVVVDV; HC-259ins: (SEQ ID NO: 51) EVTCVCVVDVS; HC-354ins: (SEQ ID NO: 52) PSRDECLTKNQ; HC-355ins: (SEQ ID NO: 53) SRDELCTKNQV; HC-357ins: (SEQ ID NO: 54) DELTKCNQVSL; HC-378ins: (SEQ ID NO: 55) IAVEWCESNGQ; HC-379ins: (SEQ ID NO: 56) AVEWECSNGQP; HC-386ins: (SEQ ID NO: 57) GQPENCNYKTT; HC-387ins: (SEQ ID NO: 58) QPENNCYKTTP; HC-410ins: (SEQ ID NO: 59) KLTVDCKSRWQ. 

    3. The cysteine-modified antibody-toxin conjugate of claim 1, wherein the highly active cytotoxin is conjugated to the inserted cysteine by being coupled through its sulfhydryl group via a linker wherein the linker and the antibody light chain have an amino acid sequence corresponds to: EIKRTCVAAPS (SEQ ID NO:45), IKRTVCAAPSV (SEQ ID NO:46) and NNFYPCREAKV (SEQ ID NO:47) and wherein the linker and the antibody heavy chain have an amino acid sequence corresponds to: ISRTPCEVTCV (SEQ ID NO:48), SRTPECVTCVV (SEQ ID NO:49), PEVTCCVVVDV (SEQ ID NO:50), EVTCVCVVDVS (SEQ ID NO:51), PSRDECLTKNQ (SEQ ID NO:52), SRDELCTKNQV (SEQ ID NO:53), DELTKCNQVSL (SEQ ID NO:54), IAVEWCESNGQ (SEQ ID NO:55), AVEWECSNGQP (SEQ ID NO:56), GQPENCNYKTT (SEQ ID NO:57), QPENNCYKTTP (SEQ ID NO:58) or KLTVDCKSRWQ (SEQ ID NO:59), and wherein C corresponds to the inserted cysteine in the light or heavy chain of the cysteine-modified antibody.

    4. The cysteine-modified antibody-toxin conjugate of claim 1, wherein said antibody light chain comprises kappa or lambda isotypes.

    5. The cysteine-modified antibody-toxin conjugate of claim 1, wherein said antibody heavy chain comprises IgG1, IgG2, IgG3 or IgG4 isotypes.

    6. The cysteine-modified antibody-toxin conjugate of claim 1, wherein said inserted cysteine comprises a sulfhydryl group before being coupled to a highly active cytotoxin.

    7. The cysteine-modified antibody-toxin conjugate of claim 6, wherein said sulfhydryl group is capable of chemical coupling.

    8. The cysteine-modified antibody-toxin conjugate of claim 3, wherein said highly active cytotoxin is selected from a group consisting of MMAE, MMAF, PBD, SN-38, Dox, Amanitin having the following molecular formulas, and their derivatives thereof: ##STR00015##

    9. The cysteine-modified antibody-toxin conjugate of claim 1, wherein said highly active cytotoxin to the antibody ratio ranges from 1.6 to 2.0 or from 3.2 to 4.0.

    10. The cysteine-modified antibody-toxin conjugate of claim 1, prepared by, reducing a cysteine-modified antibody comprising a shielded cysteine having a shielded sulfhydryl group and a shielding group, using a reducing agent to remove the shielding group from the shielded cysteine to provide a free shielding group and a reduced antibody comprising a de-shielded cysteine having a sulfhydryl group, removing the free shielding group and any excess reducing agent using a method comprising cation exchange chromatography or ultrafiltration, oxidizing the reduced antibody using an oxidizing agent to reattach the interchain disulfide bonds of the antibody, coupling the highly active cytotoxin with the sulfhydryl group on the inserted cysteine to provide the cysteine-modified antibody-toxin conjugate, and removing any uncoupled highly active cytotoxin using a method comprising cation exchange chromatography or ultrafiltration.

    Description

    EXAMPLES

    Example 1: Synthesis of mc

    [0004] ##STR00001##

    [0005] 3.9 g (0.03 mol) of 6-aminocaproic acid and 3.5 g (0.036 mol) of 1.2 eq maleic anhydride were added to 30 ml of glacial acetic acid. The reaction solution was stirred at 120° C. for 4 to 6 hours. After the reaction was complete, heating was stopped and the solution was allowed to cool to room temperature naturally. The solution was then concentrated under reduced pressure at 60° C. to remove most of the acetic acid. The brownish yellow viscous liquid thus obtained was poured into water, ethyl acetate extraction was performed at 20 ml×3 and the organic layers were combined. The organic layer was washed with water and saturated salt water in succession, dried with anhydrous sodium sulfate and filtered, and the filtrate was concentrated under reduced pressure to obtain a brownish yellow oily substance, after which 50 ml of water was added and stirring was performed, resulting in the precipitation of an off-white solid, which was filtered and dried at 50° C. under reduced pressure to obtain 5.08 g of target product, with a yield of 80%. mp: 89 to 92° C. m/z: 212.2 [M+H]+. 1HNMR (400Mz, DMSO): 13.21 (br, 1H, COOH), 6.75 (s, 2H, COCH═CHCO), 3.63 (t, 2H, J=7.2 Hz, NCH2CH2), 2.42(t, 2H, J=7.4 Hz, CH2COOH), 1.52-1.68 (m, 4H, NCH2CH2CH2CH2), 1.30-1.42 (m, 2H, NCH2CH2CH2CH2).

    Example 2: Synthesis of Mc-OSu

    [0006] ##STR00002##

    [0007] 4.7 g (22 mmol) MC and 25 g (22 mmol) HOSu were added to 50 ml of acetonitrile under nitrogen gas. 4.5 g (22 mmol) of DCC was separately dissolved in 25 ml of acetonitrile while keeping the internal temperature at approximately 0° C., and the solution was slowly added dropwise to the above reaction solution. The reaction solution was allowed to react at 0° C. for two hours and then brought to room temperature before the reaction was allowed to continue overnight. Following filtration, the resulting filter cake was washed with acetonitrile at 10 ml×3, and the filtrate was concentrated under reduced pressure until dry. The oil thus obtained was dried under reduced pressure at room temperature for six hours to obtain 6.4 g of a light brown solid, with a yield of 95%. (It was then fed directly to the next reaction without further purification) m/z: 309.2 [M+H]+. 1HNMR (400Mz, CDCl3): 1-2 (m, 6H, CCH2CH2CH2C), 2.68 (t, 2H, CH2CO), 2.95 (s, 4H, COCH2CH2CO), 3.68 (t, 2H, CH2N), 6.81 (s, 2H), CH═CH).

    Example 3: Synthesis of Fmoc-Val-OSu

    [0008] ##STR00003##

    [0009] 10 g of Fmoc-Val and 3.4 g of HOSu were added to 100 ml THF. 6 g of DCC was separately dissolved in 50 ml of acetonitrile while keeping the internal temperature at approximately 0° C., and the solution was slowly added dropwise to the above reaction solution. The reaction solution was stirred at room temperature for 24 hours. After filtration, the filter cake was washed with THF, and the filtrate was concentrated under reduced pressure to obtain a transparent oil. The oily substance was fed directly into the next reaction without further purification. m/z: 437.4 [M+H]+.

    Example 4: Synthesis of Fmoc-vc

    [0010] ##STR00004##

    [0011] 4.0 g (1.05 eq) of Cit and 60 ml of aqueous sodium bicarbonate solution (NaHCO3, 2 g, 1.05 eq) were added to 20 ml of THF. 22.35 mmol of Fmoc-Val-OSu was separately dissolved in 60 ml DME, and the resulting solution was added to the reaction solution. The reaction solution was stirred at room temperature for 24 hours. After the reaction was completed, 110 ml of 15% citric acid aqueous solution was added to the system, and extraction was performed twice with EA and the organic layers were combined and concentrated under reduced pressure to obtain a white solid. 100 ml of methyl tert-butyl ether was added to the white solid and stirring was performed, followed by filtration; the filter cake was subject to drying under reduced pressure at 40° C. for 4 h to obtain 4.83 g of product, with a yield of 65%. m/z: 497.6 (M+H)+. 1HNMR (400Mz, DMSO): 0.92 (6H, m), 1.35-1.65 (4H, m), 2.10 (1H, m), 3.01 (2H, q), 3.99 (1H, t), 4.01-4.45 (2H, m), 4.45 (2H, t), 5.46 (2H, br), 6.03 (1H, t), 7.20-8.02 (8H, m), 8.25 (1H, d).

    Example 5: Synthesis of Fmoc-vc-PABOH

    [0012] ##STR00005##

    [0013] 60 ml of DCM/MeOH=2/1 mixed solvent was added to a reaction flask, followed by addition of 2 g (4.2 mmol) Fmoc-vc and 1.04 g (2 eq) PABOH, after which the mixture was stirred to partial dissolution and 2.0 g (2 eq) EEDQ was added. The reaction system was allowed to continue reacting under stirring for 2.0 days in the dark at room temperature. After the reaction was completed, the reaction solution was concentrated under reduced pressure at 40° C. to obtain a white solid. The white solid was collected, 100 ml of methyl tert-butyl ether was added and stirring was performed, followed by filtration; the filter cake was washed with methyl tert-butyl ether, and the resulting white solid was dried under reduced pressure at 40° C., to obtain 2.2 g of product, with a yield of approximately 88%. m/z: 602.6 (M+H)+. 1HNMR (400Mz, DMSO): 0.95 (6H, m), 1.45-1.69 (4H, m), 2.10 (1H, m), 3.11 (2H, m), 3.99 (1H, m), 4.30 (2H, d), 4.05-4.66 (2H, m), 4.55 (2H, d), 5.21 (1H, t), 5.51 (2H, br), 6.11 (1H, t), 7.09-8.10 (12H, m), 8.21 (1H, d), 10.51 (1H, br).

    Example 6: Synthesis of vc-PABOH

    [0014] ##STR00006##

    [0015] 490 mg (0.815 mmol) of Fmoc-vc-PABOH was added to 10 ml of NMP and the mixture was stirred to dissolution, after which 2 ml of diethylamine was added. The reaction was then allowed to proceed under stirring at room temperature for 24 hours. After the reaction was complete, the solution was concentrated under reduced pressure at 40° C., 20 ml of DCM was added to the oily substance thus obtained and stirring was performed to obtain crystals which were filtered; the filter cake was then washed with DCM, and the solid thus obtained was dried under reduced pressure to obtain 277 mg of product, with a yield of 90%. m/z: 380.2 (M+H)+. 1HNMR (400Mz, DMSO): 0.89 (6H, m), 1.31-1.61 (4H, m), 1.82 (1H, m), 2.86 (1H, m), 2.89 (2H, d), 4.38 (2H, d), 4.44 (1H, m), 5.01 (1H, br), 5.35 (2H, br), 5.84 (1H, br), 7.14 (2H, d), 7.42 (2H, d), 8.08 (1H, br), 9.88 (1H, br).

    Example 7: Synthesis of mc-vc-PABOH

    [0016] ##STR00007##

    [0017] 205 mg (0.54 mmol) of vc-PABOH and 184 mg (1.1 eq) of MC-OSu were added to 10 ml of NMP, and once addition was complete the reaction was allowed to proceed under stirring at room temperature for 24 hours. After the reaction was completed, the reaction solution was concentrated under reduced pressure at 40° C., 20 ml of methyl tert-butyl ether was added to the oily substance thus obtained and stirring was performed to obtain crystals. The crystals were then filtered and the filter cake was washed with methyl tert-butyl ether to obtain 310 mg of product, with a yield of 100%. m/z: 573.3 (M+H)+. 1HNMR (400Mz, DMSO): 0.89 (6H, m), 1.15-1.99 (10H, m), 2.11 (1H, m), 2.31 (2H, t), 3.21 (2H, m), 3.53 (2H, t), 4.32 (1H,t), 4.51 (1H, m), 4.59 (2H, br), 5.24 (1H, br), 5.56 (2H, br), 6.20 (1H, br), 7.12 (2H, s), 7.23 (2H, d), 7.58 (2H, d), 7.94 (1H, d), 8.17 (1H, d), 10.21 (1H, br).

    Example 8: Synthesis of mc-vc-PAB-PNP

    [0018] ##STR00008##

    [0019] 168.6 mg (0.294 mmol) of mc-vc-PABOH was dissolved in 5 ml of anhydrous pyridine under nitrogen gas, and the reaction system was cooled to approximately 0° C. 179 mg (3 eq) of PNP was separately dissolved in 5 ml of DCM, and the resulting solution was slowly added into the reaction system. After maintaining the temperature at 0° C. for 10 min, the ice bath was removed, and the reaction solution was stirred at room temperature for three hours. After the reaction was completed, 70 ml of EA and 100 ml of 15% citric acid aqueous solution were added, and the organic layer was separated off. The organic layer was washed with citric acid, water, and saturated brine in succession then dried over anhydrous sodium sulfate and filtered, and the filtrate was concentrated under reduced pressure until dry to obtain a light-yellow oil, after which methyl tert-butyl ether was added to induce crystallization and 86 mg of an off-white solid, with a yield of 40%. m/z: 738 (M+H)+. 1HNMR (400Mz, CDCl3/CD3OD): 0.84 (6H, m), 1.11-1.84 (10H, m), 2.05 (1H, m), 2.15 (2H, t), 3.09 (2H, m), 3.32 (2H, t), 4.12(1H,m), 4.38 (1H, m), 5.15 (2H, s), 6.61 (2H, s), 6.84 (1H, d), 7.61 (1H, d), 7.21 (2H, d), 7.50 (2H, d), 7.61 (2H, d), 8.18 (2H, d), 9.59 (1H, br).

    Example 9: Synthesis of mc-vc-PAB-MMAE

    [0020] ##STR00009##

    [0021] 20 mg of mc-vc-PAB-PNP (1.5 eq) and 3 mg of HOBT were added to 2 ml of DMF. After briefly stirring the mixture at room temperature, 13 mg MMAE, 0.5 ml pyridine, and 25 ul DIEA were added. The reaction solution was stirred at room temperature for 2 days. After the reaction was complete, the reaction solution was directly purified using a preparative column, and the required components were collected, concentrated and lyophilized to obtain approximately 10 mg of product, with a yield of approximately 42%. m/z: 1317.1 (M+H)+.

    Example 10: Synthesis of mc-vc-PAB-MMAF

    [0022] ##STR00010##

    [0023] Using the same procedure as Example 9, approximately 12.5 mg of mc-vc-PAB-MMAF was obtained, with a yield of 45.2%; m/z: 1345.7 (M+H)+

    Example 11 Synthesis of mc-vc-PAB-PBD

    [0024] ##STR00011##

    [0025] Using the same procedure as Example 9, approximately 9.5 mg of mc-vc-PAB-PBD was obtained, with a yield of 32.5%; m/z: 1325.4 (M+H)+

    Example 12 Synthesis of mc-vc-PAB-DOX

    [0026] ##STR00012##

    [0027] Using the same procedure as Example 9, approximately 11.2 mg of mc-vc-PAB-DOX was obtained, with a yield of 38.9%; m/z: 1143.2 (M+H)+

    Example 13: Synthesis of mc-vc-PAB-SN-38

    [0028] ##STR00013##

    [0029] After dissolving 100 mg of commercially procured 10-0-Boc-SN-38 in 10 ml of dry dichloromethane, 25.6 mg (1 eq) DMAP was added, and a dichloromethane solution of triphosgene (62 mg triphosgene dissolved in 2 ml dichloromethane) was added dropwise at 0° C., after which the reaction was allowed to proceed at 0° C. for 12 h; the dichloromethane was then removed under reduced pressure and the resulting substance was dissolved with 10 ml dry DMF, after which 144 mg of mc-vc-PABOH was added and the resulting mixture was stirred for 24 hours at room temperature and liquid phase isolation was carried out to obtain 41 mg of mc-vc-PAB-SN-38, with a total two-step yield of 19.7%, m/z: 1063.2 (M+H)+

    Example 14: Expression and Purification of 2A1-HC-Cys254ins Antibody

    [0030] Freestyle™ 293-F (Invitrogen) suspension cells were used to express the 2A1-HC-Cys254ins antibody. One day prior to transfection, cells were seeded at a density of 6×10.sup.5 cells/mL in a 1 L shaker flask containing 300 mL of F17 complete medium (Freestyle™ F17 expression medium, Gibco) and incubated overnight at 37° C. and 5% CO.sub.2 on a 120 rpm cell culture shaker. The following day, transfection of the antibody expression plasmid was carried out using PEI, where the ratio of plasmid to PEI was 2:1. One day after transfection, TN1 feed medium was added at 2.5% (v/v), the culture was run for a further four days and the supernatant was collected by centrifugation.

    [0031] The resulting cell expression supernatant was collected and eluted with 0.1 M citric acid (pH 3.0) through a Protein A affinity chromatography column (Mabselect Sure LX, GE), and the captured antibodies were adjusted to pH 7.0 with 1 M Tris-HCl (pH 9.0) at 1/10 (v/v) and then passed through an SEC gel filtration chromatography column (Superdex 200, GE) to remove impurities such as polysomes and endotoxins, while the antibody buffer was replaced with PBS (pH 7.4) and UV280 nm target peak samples were collected and concentrated to 2 mg/ml using ultra-filtration centrifuge tubes (30KD, Pall).

    [0032] 2A1-HC-Cys254ins antibodies thus obtained showed a concentration of 2 mg/ml with a target antibody monomer ratio (POI%) greater than 90%, and were used in subsequent experiments.

    Example 15: Preparation of 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC Samples Via Coupling of 2A1-HC-Cys357ins Antibody and mc-vc-PAB-MMAE

    [0033] Cell-expressed 2A1-HC-Cys357ins antibodies (SEQ ID N0:34) were purified using Mabselect Sure and after elution at low pH, a Tris solution was immediately added to achieve neutralization, and the solution was exchanged to a Tris-HCl buffer of pH 7.5. The compound mc-vc-PAB-MMAE was a white powder and was dissolved in DMA for later use. The antibody needed to be first reduced to remove the barrier present on the mutant cysteine residue. 1M DTT aqueous solution was added at a 40× molecular ratio to the 2A1-HC-Cys357ins antibody solution and the resulting mixture was mixed well and allowed to react at 20° C. for two hours. Thereafter, the pH of the sample was adjusted to 5.0, and the DTT and barrier in the sample was removed via SP Sepharose FF cation exchange chromatography. Next, DHAA solution was added to the sample at a molecular ratio of 20× and the reaction was allowed to proceed for four hours at 25° C. in the dark to reconnect the disulfide bonds between the antibody chains. Thereafter, mc-vc-PAB-MMAE solution was added to induce coupling between mc-vc-PAB-MMAE and the antibody mutant cysteine, after which thorough mixing was performed and the reaction was allowed to proceed at 25° C. for two hours. After the reaction was complete, SP Sepharose FF cation exchange chromatography was used to remove the mc-vc-PAB-MMAE that was not coupled to an antibody molecule, and 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC samples were obtained.

    Example 16: HIC-HPLC Measurement of Toxin to Antibody Ratio (DAR)

    [0034] TDC samples were analyzed via high performance liquid chromatography hydrophobic chromatography, and DAR was calculated based on corresponding peak area. The specific method used was as follows:

    [0035] Column: Proteomix® HICBu-NP5 (5 μm, 4.6×35 mm);

    [0036] Mobile Phases: A: 2M ammonium sulfate, 0.025M, pH 7 phosphate buffer; B: 0.025M, pH 7 phosphate buffer; C: 100% isopropanol;

    [0037] Buffer A was equilibrated, Buffer B and Buffer C were used to perform a gradient elution and detection was carried out at 25° C. and 214 nm.

    [0038] Appended FIGS. 1A through 1D: HIC-HPLC detection of 2A1-HC-Cys357ins-mc-vc-PAB-MMAE, 2A1-HC-Cys378ins-mc-vc-PAB-MMAE, 2A1-HC-Cys387ins-mc-vc-PAB-MMAE and 2A1-HC-Cys410ins-mc-vc-PAB-MMAE TDC DAR, respectively.

    [0039] The data in FIG. 1 were used to calculate that the DARs of the fixed-point couplings ranged between 1.6 and 1.7, and the compound showed good uniformity.

    [0040] Appended Table 1: 2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys142ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys354ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC and 2A1-HC-Cys410ins-mc-vc-PAB-MMAE

    TABLE-US-00001 APPENDED TABLE 1 Table showing TDC coupling efficiency (DAR) Compound Name DAR Fixed-Point 2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC 1.82 Coupling 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC 1.78 (TDC) 2A1-LC-Cys142ins-mc-vc-PAB-MMAE TDC 1.68 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC 1.74 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC 1.77 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC 1.75 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC 1.80 2A1-HC-Cys354ins-mc-vc-PAB-MMAE TDC 1.75 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC 1.75 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC 1.83 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC 1.50 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC 1.86 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC 1.77 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC 1.83 2A1-HC-Cys410ins-mc-vc-PAB-MMAE TDC 1.86

    [0041] Appended Table 1 shows that the coupling efficiency of TDC compounds subject to fixed-point coupling via cysteine insertion mutation modification is relatively high (theoretical maximum value is 2.0), and DAR was ≥1.6.

    Example 17: SEC-HPLC Detection of TDC Antibody Backbone Stability and TDC Aggregation

    [0042] TDC antibody backbone samples were stored at 37° C., and aggregation was analyzed by SEC-HPLC on Days 0, 7, 14 and 21. The specific methodology was as follows:

    [0043] Column: TSKgel SuperSW mAb HR (7.8 mm×30 cm)

    [0044] Mobile Phase: 0.1M sodium sulfate, 0.1M pH 6.7 phosphate buffer.

    [0045] Detection was performed at 25° C. and 280 nm.

    TABLE-US-00002 APPENDED TABLE 2 POI % Compound Name 0 day 7 day 14 day 29 day Fixed-Point 2A1-HC-Cys357ins 99.4 98.7 98.1 96.5 Coupling 2A1-HC-Cys387ins 99.1 98.6 97.6 95.7 (TDC) 2A1-HC-Cys410ins 98.8 98.1 97.2 95.1 2A1-HC-Cys378ins 99.4 99.3 99.1 98.7

    [0046] Appended FIGS. 2A through 2D: 2A1-HC-Cys378ins SEC results on Days 0, 7, 14, and 21. The data show that the sample was high stable when stored at 37° C. for three weeks.

    [0047] Appended Table 2: SEC-HPLC detection of aggregation of TDC antibody backbones 2A1-HC-Cys357ins, 2A1-HC-Cys387ins, 2A1-HC-Cys378ins, and 2A1-HC-Cys410ins; the samples were stored at 37° C. for three weeks with fundamentally no change in monomeric POI content;

    [0048] 2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys142ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys354ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC and 2A1-HC-Cys410ins-mc-vc-PAB-MMAE

    TABLE-US-00003 APPENDED TABLE 3 TDC target monomer content Compound Name POI % Fixed-Point 2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC 93.6% Coupling 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC 91.7% (TDC) 2A1-LC-Cys112ins-mc-vc-PAB-MMAE TDC 92.4% 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC 93.3% 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC 91.2% 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC 94.2% 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC 93.4% 2A1-HC-Cvs354ins-mc-vc-PAB-MMAE TDC 94.7% 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC 96.72% 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC 91.47% 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC 75.06% 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC 93.42% 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC 97.49% 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC 96.61% 2A1-HC-Cys410ins-mc-vc-PAB-MMAE TDC 97.74%

    [0049] Appended Table 3 shows that the target monomer content of TDC compounds subject to cysteine fixed-point coupling was greater than 90%.

    Example 18: Affinity of Antibody Backbone After Cysteine Insertion Mutation Modification and Parent Antibody 2A1 for EGFRvIII

    [0050] ELISA was used to compare the relative affinities of 2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys142ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys354ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys410ins-mc-vc-PAB-MMAE TDC, and 2A1 for EGFRvIII. The specific process used was as follows:

    [0051] Recombinant EGFRvIII-His*6 antigen was used to coat plates; fish skin gelatin was used as a seal; dilution of each insertion mutant antibody was performed separately, up to a maximum concentration 10 ug/ml and a 4-fold gradient dilution was performed for a total of 11 concentrations; HRP-labeled secondary antibodies were used for incubation; TMB was used for development and absorption detection was performed at 450 nm. Assay results were plotted as A450 paired concentrations, and as shown in FIG. 3 and Table 3, the antibodies subject to cysteine insertion mutation maintained similar affinity for 2A1, with EC50 values very close to each other, indicating that light- or heavy-chain insertion mutations on 2A1 do not affect affinity for the antigen EGFRvIII.

    TABLE-US-00004 APPENDED TABLE 4 Determination of mutant antibody affinity Antibody Mutation R.sup.2 EC50 (nM) Antibody 2A1-LC-Cys110ins 0.9948 0.04039 2A1-LC-Cys111ins 0.9957 0.04667 2A1-LC-Cys142ins 0.9951 0.04976 2A1-HC-Cys254ins 0.9956 0.04556 2A1-HC-Cys255ins 0.9932 0.03904 2A1-HC-Cys258ins 0.9955 0.04231 2A1-HC-Cys259ins 0.9946 0.04308 2A1-HC-Cys354ins 0.9951 0.04053 2A1-HC-Cys355ins 0.9954 0.04152 2A1-HC-Cys357ins 0.9974 0.04031 2A1-HC-Cys378ins 0.9964 0.04039 2A1-HC-Cys379ins 0.9952 0.04089 2A1-HC-Cys386ins 0.9918 0.04346 2A1-HC-Cys387ins 0.9974 0.04516 2A1-HC-Cys410ins 0.9978 0.04204

    [0052] Appended FIG. 3 and Appended Table 4: 2A1-LC-Cys110ins (SEQ ID NO:16), 2A1-LC-Cys111ins (SEQ ID NO:18), 2A1-LC-Cys142ins (SEQ ID NO:20), 2A1-HC-Cys254ins (SEQ ID NO:22), 2A1-HC-Cys255ins (SEQ ID NO:24), 2A1-HC-Cys258ins (SEQ ID NO:26), 2A1-HC-Cys259ins (SEQ ID NO:28), 2A1-HC-Cys354ins (SEQ ID NO:30), 2A1-HC-Cys355ins (SEQ ID NO:32), 2A1-HC-Cys357ins (SEQ ID

    [0053] NO:34), 2A1-HC-Cys378ins (SEQ ID NO:36), 2A1-HC-Cys379ins (SEQ ID NO:38), 2A1-HC-Cys386ins (SEQ ID NO:40), 2A1-HC-Cys387ins (SEQ ID NO:42) and 2A1-HC-Cys410ins (SEQ ID NO:44) antibodies maintained 2A1 affinity for the antigen EGFRvIII.

    Example 19: Cytotoxicity Testing

    [0054] TDC cytotoxic activity was determined via the following experimental procedure: TDC was added to EGFR-overexpressing or EGFRVIII-expressing human tumor cell culture medium, and cell viability was determined after 72 hours of cell culture. Cell-based in vitro experiments were used to determine cell viability, cytotoxicity and programmed cell death induced by TDC constituted by the present invention.

    [0055] In vitro efficacy of antibody-toxin conjugates was determined via a cell proliferation assay. A CellTiter.sup.96® AqueousOne Solution Cell Proliferation Assay was purchased commercially from Promega Corp. (Madison, Wis.). CellTiter.sup.96® Aqueous One Solution Cell Proliferation Assay (a) is a colorimetric method used to detect the number of living cells in cell proliferation and cytotoxicity experiments. The above reagent contains the novel tetrazole compound [3-(4,5-dimethylthiazol-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium, inner salt; MTS) as well as an electronic coupling agent (phenazine ethosulfate; PES). PES exhibits enhanced chemical stability, which allows it to be mixed with MTS to form a stable solution. This convenient “single solution” model is an improvement on the first generation of the CellTiter custom-character Aqueous Assay, in which the electronic coupling agent PMS was supplied separately from the MTS solution. MTS (Owen's reagent) is reduced by cellular organisms into a colored formazan product, which can be directly dissolved in culture medium (FIG. 1). This conversion is likely facilitated by NADPH or NADH produced by dehydrogenase present in metabolically active cells. For the assay, a small amount of CellTiter custom-character Aqueous One Solution Reagent is added directly to the medium present in the wells of the culture plate, after which incubation is performed for 1 to 4 hours, followed by reading of the absorbance value at 490 nm using a microplate reader.

    ##STR00014##

    [0056] The amount of formazan product detected at 490 nm is proportional to the number of viable cells in culture. Because the formazan product of MTS is soluble in tissue culture medium, CellTitercustom-characterAqueous One Solution Assay requires fewer steps than the MTT or INT methods. A431 (EGFR-overexpressing cells) and U87-EGFRVIII (an EGFRVIII mutant stable cell line) were used in the present invention as an investigative system for performing in vitro efficacy assays. In 96-well plates, cells were plated at 6000 cells/well and 24 hours later, antibody spiking was carried out. The dosing concentrations for A431 and U87-EGFRvIII ranged from 200 nM to 10 pM with a four-fold dilution performed, and the concentration of U87-EGFRVIII ranged from 500 nM to 30 pM. Cell viability was assayed via MTS 72 hours after treatment.

    [0057] Appended FIGS. 4A and 4B: IC50 test results for 2A1-HC-Cys357ins-mc-vc-PAB-MMAE, 2A1-HC-Cys378ins-mc-vc-PAB-MMAE, 2A1-HC-Cys387ins-mc-vc-PAB-MMAE and 2A1-HC-Cys410ins-mc-vc-PAB-MMAE on the EGFRwt-overexpressing human skin squamous cell carcinoma cell line A431 and the EFGRvIII-overexpressing human glioma cell line U87-EGFRvIII.

    TABLE-US-00005 APPENDED TABLE 5 IC.sub.50 test results showing TDC cytotoxicity for EGFRwt-overexpressing cell line A431 and the EFGRvIII-overexpressing cell line U87-EGFRvIII MTS Compound A431 U87MG-EGFRvIII Antibody 2A1-LC-Cys110ins >10 μM >10 μM 2A1-LC-Cys111ins >10 μM >10 μM 2A1-LC-Cys142ins >10 μM >10 μM 2A1-HC-Cys254ins >10 μM >10 μM 2A1-HC-Cys255ins >10 μM >10 μM 2A1-HC-Cys258ins >10 μM >10 μM 2A1-HC-Cys259ins >10 μM >10 μM 2A1-HC-Cys354ins >10 μM >10 μM 2A1-HC-Cys355ins >10 μM >10 μM 2A1-HC-Cys357ins >10 μM >10 μM 2A1-HC-Cys378ins >10 μM >10 μM 2A1-HC-Cys379ins >10 μM >10 μM 2A1-HC-Cys386ins >10 μM >10 μM 2A1-HC-Cys387ins >10 μM >10 μM 2A1-HC-Cys410ins >10 μM >10 μM Fixed-Point 2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC 88.45 nM 225.11 nM Coupling 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC 120.22 nM 337.14 nM (TDC) 2A1-LC-Cys142ins-mc-vc-PAB-MMAE TDC 118.26 nM 321.48 nM 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC 146.62 nM 335.52 nM 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC 107.33 nM 275.71 nM 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC 121.47 nM 301.32 nM 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC 114.24 nM 358.14 nM 2A1-HC-Cys354ins-mc-vc-PAB-MMAE TDC 118.39 nM 370.21 nM 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC 114.95 nM 292.15 nM 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC 104.85 nM 119.2 nM 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC 67.57 nM 223.3 nM 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC 98.47 nM 189.15 nM 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC 94.12 nM 202.48 nM 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC 48.62 nM 104.8 nM 2A1-HC-Cys410ins-mc-vc-PAB-MMAE TDC 56.69 nM 117.9 nM

    [0058] The results shown in Table 5 shown that 2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys142ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys354ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC and 2A1-HC-Cys410ins-mc-vc-PAB-MMAE exhibit significant cytotoxic activity against EGFRwt-overexpressing cell line A431 and the EFGRvIII-overexpressing cell line U87-EGFRvIII.

    [0059] The present invention is not limited to the scope of the embodiments disclosed in the examples; said examples are used to exemplify several aspects of the invention, and any embodiments that are functionally equivalent shall fall within the scope of the present invention. Indeed, in addition to the examples shown and described herein, additional variants of the invention should also be apparent to a person skilled in the art and fall within the scope of the claims appended hereto.

    Example 20. Plasma Stability Testing

    [0060] A fixed amount of TDC sample was added to human plasma for which human IgG had already been removed, with each TDC tube prepared in triplicate; next, incubation in a 37° C. water bath was performed for 0 hours, 24 hours and 72 hours, after which the TDC sample was removed and 100 ul of Protein A (MabSelect SuRe™ LX Lot: #10221479GE, washed with PBS) was added to each tube; adsorption was then allowed to proceed under agitation on a vertical mixer for two hours, followed by washing and elution to obtain incubated TDC. HIC-HPLC and RP-HPLC testing was performed on TDC samples incubated for a fixed amount of time to determine the plasma stability of the samples.

    [0061] Appended FIGS. 5A through 5D: 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys410ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC HIC-HPLC plasma stability test results. The results shown in the figures demonstrate that the three molecules exhibit good plasma stability.

    TABLE-US-00006 APPENDED TABLE 6 TDC plasma stability test results TDC Plasma Incubation Time and Change in DAR Compound 0 h 24 h 96 h Fixed-Point 2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC 1.76 1.78 1.77 Coupling 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC 1.80 1.75 1.73 (TDC) 2A1-LC-Cys142ins-mc-vc-PAB-MMAE TDC 1.75 1.73 1.72 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC 1.75 1.72 1.70 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC 1.76 1.73 1.69 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC 1.72 1.68 1.62 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC 1.73 1.70 1.65 2A1-HC-Cys354ins-mc-vc-PAB-MMAE TDC 1.75 1.64 1.58 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC 1.74 1.68 1.63 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC 1.804 1.79 1.74 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC 1.60 1.46 1.34 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC 1.79 1.72 1.64 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC 1.73 1.70 1.65 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC 1.80 1.51 1.48 2A1-HC-Cys410ins-mc-vc-PAB-MMAE TDC 1.71 N/A 1.39

    Example 21: Drug Efficacy Testing in Tumor-Bearing Mice

    [0062] As part of the present invention, we established a subcutaneous transplantation tumor model of the human pancreatic cancer cell line BxPC3 in nude mice to evaluate the in vivo efficacy of TDC conjugates such as 2A1-HC-Cys357ins-mc-vc-PAB-MMAE. 5×10.sup.6 A431 cells were injected subcutaneously into the backs of 4 to 6-week-old BALB/c nude mice and when the average tumor size grew to approximately 150 to 200 mm.sup.3, the mice were randomly grouped into groups of six mice each. On Day 1, 2A1-HC-Cys357ins-mc-vc-PAB-MMAE (2A1-HC-Cys357ins TDC), 2A1-HC-Cys410ins-mc-vc-PAB-MMAE (2A1-HC-Cys410ins TDC), 2A1-HC-Cys387ins-mc-vc-PAB-MMAE (2A1-HC-Cys387ins TDC) and 2A1-HC-Cys378ins-mc-vc-PAB-MMAE (2A1-HC-Cys378ins TDC) were administered via a single tail vein injection at a dose of 5 mg/kg (FIG. 6) and data were gathered in the form of mean tumor volume±SE at the time of measurement.

    [0063] Appended FIG. 6: 2A1-HC-Cys357ins-mc-vc-PAB-MMAE (2A1-HC-Cys357ins TDC), 2A1-HC-Cys410ins-mc-vc-PAB-MMAE (2A1-HC-Cys410ins TDC), 2A1-HC-Cys387ins-mc-vc-PAB-MMAE (2A1-HC-Cys387ins TDC) and 2A1-HC-Cys378ins-mc-vc-PAB-MMAE (2A1-HC-Cys378ins TDC) were administered via a single tail vein injection at a dose of 5 mg/kg, producing a significant anti-tumor effect.

    TABLE-US-00007 SEQUENCE LISTING SEQ ID Description 1 2A1 heavy chain variable region (VH) DNA sequence 2 2A1 heavy chain variable region (VH) amino acid sequence 3 2A1 heavy chain variable region CDR1 4 2A1 heavy chain variable region CDR2 5 2A1 heavy chain variable region CDR3 6 2A1 light chain variable region (VL) DNA sequence 7 2A1 light chain variable region (VL) amino acid sequence 8 2A1 light chain variable region CDR1 9 2A1 light chain variable region CDR2 10 2A1 light chain variable region CDR3 11 2A1 heavy chain constant region (CH) DNA sequence 12 2A1 light chain constant region (CL) amino acid sequence 13 2A1 light chain constant region (CL) DNA sequence 14 2A1 light chain constant region (CL) amino acid sequence 15 2A1-LC-Cys110ins light chain constant region (CL) DNA sequence 16 2A1-LC-Cys110ins light chain constant region (CL) amino acid sequence 17 2A1-LC-Cys111ins light chain constant region (CL) DNA sequence 18 2A1-LC-Cys111ins light chain constant region (CL) amino acid sequence 19 2A1-LC-Cys142ins light chain constant region (CL) DNA sequence 20 2A1-LC-Cys142ins light chain constant region (CL) amino acid sequence 21 2A1-HC-Cys254ins heavy chain constant region (CH) DNA sequence 22 2A1-HC-Cys254ins heavy chain constant region (CH) amino acid sequence 23 2A1-HC-Cys255ins heavy chain constant region (CH) DNA sequence 24 2A1-HC-Cys255ins heavy chain constant region (CH) amino acid sequence 25 2A1-HC-Cys258ins heavy chain constant region (CH) DNA sequence 26 2A1-HC-Cys258ins heavy chain constant region (CH) amino acid sequence 27 2A1-HC-Cys259ins heavy chain constant region (CH) DNA sequence 28 2A1-HC-Cys259ins heavy chain constant region (CH) amino acid sequence 29 2A1-HC-Cys354ins heavy chain constant region (CH) DNA sequence 30 2A1-HC-Cys354ins heavy chain constant region (CH) amino acid sequence 31 2A1-HC-Cys355ins heavy chain constant region (CH) DNA sequence 32 2A1-HC-Cys355ins heavy chain constant region (CH) amino acid sequence 33 2A1-HC-Cys357ins heavy chain constant region (CH) DNA sequence 34 2A1-HC-Cys357ins heavy chain constant region (CH) amino acid sequence 35 2A1-HC-Cys378ins heavy chain constant region (CH) DNA sequence 36 2A1-HC-Cys378ins heavy chain constant region (CH) amino acid sequence 37 2A1-HC-Cys379ins heavy chain constant region (CH) DNA sequence 38 2A1-HC-Cys379ins heavy chain constant region (CH) amino acid sequence 39 2A1-HC-Cys386ins heavy chain constant region (CH) DNA sequence 40 2A1-HC-Cys386ins heavy chain constant region (CH) amino acid sequence 41 2A1-HC-Cys387ins heavy chain constant region (CH) DNA sequence 42 2A1-HC-Cys387ins heavy chain constant region (CH) amino acid sequence 43 2A1-HC-Cys410ins heavy chain constant region (CH) DNA sequence 44 2A1-HC-Cys410ins heavy chain constant region (CH) amino acid sequence 45 2A1-LC-110ins Characteristic peptide 46 2A1-LC-111insCharacteristic peptide 47 2A1-LC-142insCharacteristic peptide 48 2A1-HC-254insCharacteristic peptide 49 2A1-HC-255insCharacteristic peptide 50 2A1-HC-258insCharacteristic peptide 51 2A1-HC-259insCharacteristic peptide 52 2A1-HC-354insCharacteristic peptide 53 2A1-HC-355insCharacteristic peptide 54 2A1-HC-357insCharacteristic peptide 55 2A1-HC-378insCharacteristic peptide 56 2A1-HC-379insCharacteristic peptide 57 2A1-HC-386insCharacteristic peptide 58 2A1-HC-387insCharacteristic peptide 59 2A1-HC-410insCharacteristic peptide SEQ ID NO: 1 2A1 heavy chain variable region (VH) DNA sequence gatgtgcagc ttcaggagtc gggacctagc ctggtgaaac cttctcagtc tctgtccctc  60 acctgcactg tcactggcta ctcaatcacc agtgattttg cctggaactg gattcggcag 120 tttccaggaa acaagctgga gtggatgggc tacataagtt atagtggtaa cactaggtac 180 aacccatctc tcaaaagtcg aatctctatc actcgcgaca catccaagaa ccaattcttc 240 ctgcagttga actctgtgac tattgaggac acagccacat attactgtgt aacggcggga 300 cgcgggtttc cttattgggg ccaagggact ctggtcactg tctctgca              348 SEQ ID NO: 2 2A1 heavy chain variable region (VH) amino acid sequence DVQLQESGPSLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYISYSGNTRYNPSLK SRISITRDTSKNQFFLQLNSVTIEDTATYYCVTAGRGFPYWGQGTLVTVSA SEQ ID NO: 3 2A1 heavy chain variable region CDR1 SDFAWN SEQ ID NO: 4 2A1 heavy chain variable region CDR2 YISYSGNTRYNPSLKS SEQ ID NO: 5 2A1 heavy chain variable region CDR3 VTAGRGFPY SEQ ID NO: 6 2A1 light chain variable region (VL) DNA sequence gacatcctga tgacccaatc tccatcctcc atgtctgtat ctctgggaga cacagtcagc  60 atcacttgcc attcaagtca ggacattaac agtaatatag ggtggttgca gcagagacca 120 gggaaatcat ttaagggcct gatctatcat ggaaccaact tggacgatga agttccatca 180 aggttcagtg gcagtggatc tggagccgat tattctctca ccatcagcag cctggaatct 240 gaagattttg cagactatta ctgtgtacag tatgctcagt ttccgtggac gttcggtgga 300 ggcaccaagc tggaaatcaa acgt                                        324 SEQ ID NO: 7 2A1 light chain variable region (VL) amino acid sequence DILMTQSPSSMSVSLGDTVSITCHSSQDINSNIGWLQQRPGKSFKGLIYHGTNLDDEVPSRFSGS GSGADYSLTISSLESEDFADYYCVQYAQFPWTEGGGTKLEIKR SEQ ID NO: 8 2A1 light chain variable region CDR1 HSSQDINSNIG SEQ ID NO: 9 2A1 light chain variable region CDR2 HGTNLDDE SEQ ID NO: 10 2A1 light chain variable region CDR3 VQYAQFPWT SEQ ID NO: 11 2A1 heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaact cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gaggtcacat gcgtggtggt ggacgtgagc cacgaagacc ctgaggtcaa gttcaactgg 480 tacgtggacg gcgtggaggt gcataatgcc aagacaaagc cgcgggagga gcagtacaac 540 agcacgtacc gtgtggtcag cgtcctcacc gtcctgcacc aggactggct gaatggcaag 600 gagtacaagt gcaaggtctc caacaaagcc ctcccagccc ccatcgagaa aaccatctcc 660 aaagccaaag ggcagccccg agaaccacag gtgtacaccc tgcccccatc ccgggatgag 720 ctgaccaaga accaggtcag cctgacctgc ctggtcaaag gcttctatcc cagcgacatc 780 gccgtggagt gggagagcaa tgggcagccg gagaacaact acaagaccac gcctcccgtg 840 ctggactccg acggctcctt cttcctctat agcaagctca ccgtggacaa gagcaggtgg 900 cagcagggga acgtcttctc atgctccgtg atgcatgagg ctctgcacaa ccactacacg 960 cagaagagcc tctccctgtc tccgggtaaa                                  990 SEQ ID NO: 12 2A1 heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPELLGG 120 PSVFLFPPKP KDTLMISRTP EVTCVVVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN 180 STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ VYTLPPSRDE 240 LTKNQVSLTC LVKGFYPSDI AVEWESNGQP ENNYKTTPPV LDSDGSFFLY SKLTVDKSRW 300 QQGNVFSCSV MHEALHNHYT QKSLSLSPGK                                  330 SEQ ID NO: 13 2A1 light chain constant region (CL) DNA sequence acggtggctg caccatctgt cttcatcttc ccgccatctg atgagcagtt gaaatctgga  60 actgcctctg ttgtgtgcct gctgaataac ttctatccca gagaggccaa agtacagtgg 120 aaggtggata acgccctcca atcgggtaac tcccaggaga gtgtcacaga gcaggacagc 180 aaggacagca cctacagcct cagcagcacc ctgacgctga gcaaagcaga ctacgagaaa 240 cacaaagtct acgcctgcga agtcacccat cagggcctga gctcgcccgt cacaaagagc 300 ttcaacaggg gagagtgtta g 321 SEQ ID NO: 14 2A1 light chain constant region (CL) amino acid sequence TVAAPSVFIF PPSDEQLKSG TASVVCLLNN FYPREAKVQW KVDNALQSGN SQESVTEQDS  60 KDSTYSLSST LTLSKADYEK HKVYACEVTH QGLSSPVTKS FNRGEC                106 SEQ ID NO: 15 2A1-LC-Cys110ins light chain constant region (CL) DNA sequence gaaatcaaac gtacgtgtgt ggctgcacca tctgtcttca tcttcccgcc atctgatgag  60 cagttgaaat ctggaactgc ctctgttgtg tgcctgctga ataacttcta tcccagagag 120 gccaaagtac agtggaaggt ggataacgcc ctccaatcgg gtaactccca ggagagtgtc 180 acagagcagg acagcaagga cagcacctac agcctcagca gcaccctgac gctgagcaaa 240 gcagactacg agaaacacaa agtctacgcc tgcgaagtca cccatcaggg cctgagctcg 300 cccgtcacaa agagcttcaa caggggagag tgttag 336 SEQ ID NO: 16 2A1-LC-Cys110ins light chain constant region (CL) amino acid sequence EIKRTCVAAP SVFIFPPSDE QLKSGTASVV CLLNNFYPRE AKVQWKVDNA LQSGNSQESV  60 TEQDSKDSTY SLSSTLTLSK ADYEKHKVYA CEVTHQGLSS PVTKSFNRGE C          111 SEQ ID NO: 17 2A1-LC-Cys111ins light chain constant region (CL) DNA sequence gaaatcaaac gtacggtgtg tgctgcacca tctgtcttca tcttcccgcc atctgatgag  60 cagttgaaat ctggaactgc ctctgttgtg tgcctgctga ataacttcta tcccagagag 120 gccaaagtac agtggaaggt ggataacgcc ctccaatcgg gtaactccca ggagagtgtc 180 acagagcagg acagcaagga cagcacctac agcctcagca gcaccctgac gctgagcaaa 240 gcagactacg agaaacacaa agtctacgcc tgcgaagtca cccatcaggg cctgagctcg 300 cccgtcacaa agagcttcaa caggggagag tgttag                           336 SEQ ID NO: 18 2A1-LC-Cys111ins light chain constant region (CL) amino acid sequence EIKRTVCAAP SVFIFPPSDE QLKSGTASVV CLLNNFYPRE AKVQWKVDNA LQSGNSQESV  60 TEQDSKDSTY SLSSTLTLSK ADYEKHKVYA CEVTHQGLSS PVTKSFNRGE C          111 SEQ ID NO: 19 2A1-LC-Cys142ins light chain constant region (CL) DNA sequence gaaatcaaac gtacggtggc tgcaccatct gtcttcatct tcccgccatc tgatgagcag  60 ttgaaatctg gaactgcctc tgttgtgtgc ctgctgaata acttctatcc ctgtagagag 120 gccaaagtac agtggaaggt ggataacgcc ctccaatcgg gtaactccca ggagagtgtc 180 acagagcagg acagcaagga cagcacctac agcctcagca gcaccctgac gctgagcaaa 240 gcagactacg agaaacacaa agtctacgcc tgcgaagtca cccatcaggg cctgagctcg 300 cccgtcacaa agagcttcaa caggggagag tgttag                           336 SEQ ID NO: 20 2A1-LC-Cys142ins light chain constant region (CL) amino acid sequence EIKRTVAAPS VFIFPPSDEQ LKSGTASVVC LLNNFYPCRE AKVQWKVDNA LQSGNSQESV  60 TEQDSKDSTY SLSSTLTLSK ADYEKHKVYA CEVTHQGLSS PVTKSFNRGE C          111 SEQ ID NO: 21 2A1-HC-Cys254ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 tgtgaggtca catgcgtggt ggtggacgtg agccacgaag accctgaggt caagttcaac 480 tggtacgtgg acggcgtgga ggtgcataat gccaagacaa agccgcggga ggagcagtac 540 aacagcacgt accgtgtggt cagcgtcctc accgtcctgc accaggactg gctgaatggc 600 aaggagtaca agtgcaaggt ctccaacaaa gccctcccag cccccatcga gaaaaccatc 660 tccaaagcca aagggcagcc ccgagaacca caggtgtaca ccctgccccc atcccgggat 720 gagctgacca agaaccaggt cagcctgacc tgcctggtca aaggcttcta tcccagcgac 780 atcgccgtgg agtgggagag caatgggcag ccggagaaca actacaagac cacgcctccc 840 gtgctggact ccgacggctc cttcttcctc tatagcaagc tcaccgtgga caagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 22 2A1-HC-Cys254ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP CEVTCVVVDV SHEDPEVKFN WYVDGVEVEN AKTKPREEQY 180 NSTYRVVSVL TVLHQDWLNG KEYKCKVSNK ALPAPIEKTI SKAKGQPREP QVYTLPPSRD 240 ELTKNQVSLT CLVKGFYPSD IAVEWESNGQ PENNYKTTPP VLDSDGSFFL YSKLTVDKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG                                  330 SEQ ID NO: 23 2A1-HC-Cys255ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gagtgtgtca catgcgtggt ggtggacgtg agccacgaag accctgaggt caagttcaac 480 tggtacgtgg acggcgtgga ggtgcataat gccaagacaa agccgcggga ggagcagtac 540 aacagcacgt accgtgtggt cagcgtcctc accgtcctgc accaggactg gctgaatggc 600 aaggagtaca agtgcaaggt ctccaacaaa gccctcccag cccccatcga gaaaaccatc 660 tccaaagcca aagggcagcc ccgagaacca caggtgtaca ccctgccccc atcccgggat 720 gagctgacca agaaccaggt cagcctgacc tgcctggtca aaggcttcta tcccagcgac 780 atcgccgtgg agtgggagag caatgggcag ccggagaaca actacaagac cacgcctccc 840 gtgctggact ccgacggctc cttcttcctc tatagcaagc tcaccgtgga caagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 24 2A1-HC-Cys255ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP ECVTCVVVDV SHEDPEVKFN WYVDGVEVEN AKTKPREEQY 180 NSTYRVVSVL TVLHQDWLNG KEYKCKVSNK ALPAPIEKTI SKAKGQPREP QVYTLPPSRD 240 ELTKNQVSLT CLVKGFYPSD IAVEWESNGQ PENNYKTTPP VLDSDGSFFL YSKLTVDKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG                                  330 SEQ ID NO: 25 2A1-HC-Cys258ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gaggtcacat gctgtgtggt ggtggacgtg agccacgaag accctgaggt caagttcaac 480 tggtacgtgg acggcgtgga ggtgcataat gccaagacaa agccgcggga ggagcagtac 540 aacagcacgt accgtgtggt cagcgtcctc accgtcctgc accaggactg gctgaatggc 600 aaggagtaca agtgcaaggt ctccaacaaa gccctcccag cccccatcga gaaaaccatc 660 tccaaagcca aagggcagcc ccgagaacca caggtgtaca ccctgccccc atcccgggat 720 gagctgacca agaaccaggt cagcctgacc tgcctggtca aaggcttcta tcccagcgac 780 atcgccgtgg agtgggagag caatgggcag ccggagaaca actacaagac cacgcctccc 840 gtgctggact ccgacggctc cttcttcctc tatagcaagc tcaccgtgga caagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 26 2A1-HC-Cys258ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP EVTCCVVVDV SHEDPEVKFN WYVDGVEVEN AKTKPREEQY 180 NSTYRVVSVL TVLHQDWLNG KEYKCKVSNK ALPAPIEKTI SKAKGQPREP QVYTLPPSRD 240 ELTKNQVSLT CLVKGFYPSD IAVEWESNGQ PENNYKTTPP VLDSDGSFFL YSKLTVDKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG                                  330 SEQ ID NO: 27 2A1-HC-Cys259ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gaggtcacat gcgtgtgtgt ggtggacgtg agccacgaag accctgaggt caagttcaac 480 tggtacgtgg acggcgtgga ggtgcataat gccaagacaa agccgcggga ggagcagtac 540 aacagcacgt accgtgtggt cagcgtcctc accgtcctgc accaggactg gctgaatggc 600 aaggagtaca agtgcaaggt ctccaacaaa gccctcccag cccccatcga gaaaaccatc 660 tccaaagcca aagggcagcc ccgagaacca caggtgtaca ccctgccccc atcccgggat 720 gagctgacca agaaccaggt cagcctgacc tgcctggtca aaggcttcta tcccagcgac 780 atcgccgtgg agtgggagag caatgggcag ccggagaaca actacaagac cacgcctccc 840 gtgctggact ccgacggctc cttcttcctc tatagcaagc tcaccgtgga caagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 28 2A1-HC-Cys259ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP EVTCVCVVDV SHEDPEVKFN WYVDGVEVHN AKTKPREEQY 180 NSTYRVVSVL TVLHQDWLNG KEYKCKVSNK ALPAPIEKTI SKAKGQPREP QVYTLPPSRD 240 ELTKNQVSLT CLVKGFYPSD IAVEWESNGQ PENNYKTTPP VLDSDGSFFL YSKLTVDKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG                                  330 SEQ ID NO: 29 2A1-HC-Cys354ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gaggtcacat gcgtggtggt ggacgtgagc cacgaagacc ctgaggtcaa gttcaactgg 480 tacgtggacg gcgtggaggt gcataatgcc aagacaaagc cgcgggagga gcagtacaac 540 agcacgtacc gtgtggtcag cgtcctcacc gtcctgcacc aggactggct gaatggcaag 600 gagtacaagt gcaaggtctc caacaaagcc ctcccagccc ccatcgagaa aaccatctcc 660 aaagccaaag ggcagccccg agaaccacag gtgtacaccc tgcccccatc ccgggatgag 720 tgtctgacca agaaccaggt cagcctgacc tgcctggtca aaggcttcta tcccagcgac 780 atcgccgtgg agtgggagag caatgggcag ccggagaaca actacaagac cacgcctccc 840 gtgctggact ccgacggctc cttcttcctc tatagcaagc tcaccgtgga caagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 30 2A1-HC-Cys354ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP EVTCVVVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN 180 STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ VYTLPPSRDE 240 CLTKNQVSLT CLVKGFYPSD IAVEWESNGQ PENNYKTTPP VLDSDGSFFL YSKLTVDKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG 330 SEQ ID NO: 31 2A1-HC-Cys355ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gaggtcacat gcgtggtggt ggacgtgagc cacgaagacc ctgaggtcaa gttcaactgg 480 tacgtggacg gcgtggaggt gcataatgcc aagacaaagc cgcgggagga gcagtacaac 540 agcacgtacc gtgtggtcag cgtcctcacc gtcctgcacc aggactggct gaatggcaag 600 gagtacaagt gcaaggtctc caacaaagcc ctcccagccc ccatcgagaa aaccatctcc 660 aaagccaaag ggcagccccg agaaccacag gtgtacaccc tgcccccatc ccgggatgag 720 ctgtgtacca agaaccaggt cagcctgacc tgcctggtca aaggcttcta tcccagcgac 780 atcgccgtgg agtgggagag caatgggcag ccggagaaca actacaagac cacgcctccc 840 gtgctggact ccgacggctc cttcttcctc tatagcaagc tcaccgtgga caagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 32 2A1-HC-Cys355ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP EVTCVVVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN 180 STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ VYTLPPSRDE 240 LCTKNQVSLT CLVKGFYPSD IAVEWESNGQ PENNYKTTPP VLDSDGSFFL YSKLTVDKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG                                  330 SEQ ID NO: 33 2A1-HC-Cys357ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gaggtcacat gcgtggtggt ggacgtgagc cacgaagacc ctgaggtcaa gttcaactgg 480 tacgtggacg gcgtggaggt gcataatgcc aagacaaagc cgcgggagga gcagtacaac 540 agcacgtacc gtgtggtcag cgtcctcacc gtcctgcacc aggactggct gaatggcaag 600 gagtacaagt gcaaggtctc caacaaagcc ctcccagccc ccatcgagaa aaccatctcc 660 aaagccaaag ggcagccccg agaaccacag gtgtacaccc tgcccccatc ccgggatgag 720 ctgaccaagt gtaaccaggt cagcctgacc tgcctggtca aaggcttcta tcccagcgac 780 atcgccgtgg agtgggagag caatgggcag ccggagaaca actacaagac cacgcctccc 840 gtgctggact ccgacggctc cttcttcctc tatagcaagc tcaccgtgga caagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 34 2A1-HC-Cys357ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP EVTCVVVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN 180 STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ VYTLPPSRDE 240 LTKCNQVSLT CLVKGFYPSD IAVEWESNGQ PENNYKTTPP VLDSDGSFFL YSKLTVDKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG                                  330 SEQ ID NO: 35 2A1-HC-Cys378ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gaggtcacat gcgtggtggt ggacgtgagc cacgaagacc ctgaggtcaa gttcaactgg 480 tacgtggacg gcgtggaggt gcataatgcc aagacaaagc cgcgggagga gcagtacaac 540 agcacgtacc gtgtggtcag cgtcctcacc gtcctgcacc aggactggct gaatggcaag 600 gagtacaagt gcaaggtctc caacaaagcc ctcccagccc ccatcgagaa aaccatctcc 660 aaagccaaag ggcagccccg agaaccacag gtgtacaccc tgcccccatc ccgggatgag 720 ctgaccaaga accaggtcag cctgacctgc ctggtcaaag gcttctatcc cagcgacatc 780 gccgtggagt ggtgtgagag caatgggcag ccggagaaca actacaagac cacgcctccc 840 gtgctggact ccgacggctc cttcttcctc tatagcaagc tcaccgtgga caagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 36 2A1-HC-Cys378ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP EVTCVVVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN 180 STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ VYTLPPSRDE 240 LTKNQVSLTC LVKGFYPSDI AVEWCESNGQ PENNYKTTPP VLDSDGSFFL YSKLTVDKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG                                  330 SEQ ID NO: 37 2A1-HC-Cys379ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gaggtcacat gcgtggtggt ggacgtgagc cacgaagacc ctgaggtcaa gttcaactgg 480 tacgtggacg gcgtggaggt gcataatgcc aagacaaagc cgcgggagga gcagtacaac 540 agcacgtacc gtgtggtcag cgtcctcacc gtcctgcacc aggactggct gaatggcaag 600 gagtacaagt gcaaggtctc caacaaagcc ctcccagccc ccatcgagaa aaccatctcc 660 aaagccaaag ggcagccccg agaaccacag gtgtacaccc tgcccccatc ccgggatgag 720 ctgaccaaga accaggtcag cctgacctgc ctggtcaaag gcttctatcc cagcgacatc 780 gccgtggagt gggagtgtag caatgggcag ccggagaaca actacaagac cacgcctccc 840 gtgctggact ccgacggctc cttcttcctc tatagcaagc tcaccgtgga caagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 38 2A1-HC-Cys379ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP EVTCVVVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN 180 STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ VYTLPPSRDE 240 LTKNQVSLTC LVKGFYPSDI AVEWECSNGQ PENNYKTTPP VLDSDGSFFL YSKLTVDKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG                                  330 SEQ ID NO: 39 2A1-HC-Cys386ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gaggtcacat gcgtggtggt ggacgtgagc cacgaagacc ctgaggtcaa gttcaactgg 480 tacgtggacg gcgtggaggt gcataatgcc aagacaaagc cgcgggagga gcagtacaac 540 agcacgtacc gtgtggtcag cgtcctcacc gtcctgcacc aggactggct gaatggcaag 600 gagtacaagt gcaaggtctc caacaaagcc ctcccagccc ccatcgagaa aaccatctcc 660 aaagccaaag ggcagccccg agaaccacag gtgtacaccc tgcccccatc ccgggatgag 720 ctgaccaaga accaggtcag cctgacctgc ctggtcaaag gcttctatcc cagcgacatc 780 gccgtggagt gggagagcaa tgggcagccg gagaactgta actacaagac cacgcctccc 840 gtgctggact ccgacggctc cttcttcctc tatagcaagc tcaccgtgga caagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 40 2A1-HC-Cys386ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP EVTCVVVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN 180 STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ VYTLPPSRDE 240 LTKNQVSLTC LVKGFYPSDI AVEWESNGQP ENCNYKTTPP VLDSDGSFFL YSKLTVDKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG                                  330 SEQ ID NO: 41 2A1-HC-Cys387ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gaggtcacat gcgtggtggt ggacgtgagc cacgaagacc ctgaggtcaa gttcaactgg 480 tacgtggacg gcgtggaggt gcataatgcc aagacaaagc cgcgggagga gcagtacaac 540 agcacgtacc gtgtggtcag cgtcctcacc gtcctgcacc aggactggct gaatggcaag 600 gagtacaagt gcaaggtctc caacaaagcc ctcccagccc ccatcgagaa aaccatctcc 660 aaagccaaag ggcagccccg agaaccacag gtgtacaccc tgcccccatc ccgggatgag 720 ctgaccaaga accaggtcag cctgacctgc ctggtcaaag gcttctatcc cagcgacatc 780 gccgtggagt gggagagcaa tgggcagccg gagaacaact gttacaagac cacgcctccc 840 gtgctggact ccgacggctc cttcttcctc tatagcaagc tcaccgtgga caagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 42 2A1-HC-Cys387ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP EVTCVVVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN 180 STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ VYTLPPSRDE 240 LTKNQVSLTC LVKGFYPSDI AVEWESNGQP ENNCYKTTPP VLDSDGSFFL YSKLTVDKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG                                  330 SEQ ID NO: 43 2A1-HC-Cys410ins heavy chain constant region (CH) DNA sequence gctagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg  60 ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120 tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180 ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240 tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc 300 aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaatt cctgggggga 360 ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420 gaggtcacat gcgtggtggt ggacgtgagc cacgaagacc ctgaggtcaa gttcaactgg 480 tacgtggacg gcgtggaggt gcataatgcc aagacaaagc cgcgggagga gcagtacaac 540 agcacgtacc gtgtggtcag cgtcctcacc gtcctgcacc aggactggct gaatggcaag 600 gagtacaagt gcaaggtctc caacaaagcc ctcccagccc ccatcgagaa aaccatctcc 660 aaagccaaag ggcagccccg agaaccacag gtgtacaccc tgcccccatc ccgggatgag 720 ctgaccaaga accaggtcag cctgacctgc ctggtcaaag gcttctatcc cagcgacatc 780 gccgtggagt gggagagcaa tgggcagccg gagaacaact acaagaccac gcctcccgtg 840 ctggactccg acggctcctt cttcctctat agcaagctca ccgtggactg taagagcagg 900 tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 960 acgcagaaga gcctctccct gtctccgggt taa                              993 SEQ ID NO: 44 2A1-HC-Cys410ins heavy chain constant region (CH) amino acid sequence ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS  60 GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKRVEP KSCDKTHTCP PCPAPEFLGG 120 PSVFLFPPKP KDTLMISRTP EVTCVVVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN 180 STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ VYTLPPSRDE 240 LTKNQVSLTC LVKGFYPSDI AVEWESNGQP ENNYKTTPPV LDSDGSFFLY SKLTVDCKSR 300 WQQGNVFSCS VMHEALHNHY TQKSLSLSPG                                  330 SEQ ID NO: 45 2A1-LC-110ins Characteristic peptide EIKRTCVAAPS SEQ ID NO: 46 2A1-LC-111insCharacteristic peptide IKRTVCAAPSV SEQ ID NO: 47 2A1-LC-142insCharacteristic peptide NNFYPCREAKV SEQ ID NO: 48 2A1-HC-254insCharacteristic peptide ISRTPCEVTCV SEQ ID NO: 49 2A1-HC-255insCharacteristic peptide SRTPECVTCVV SEQ ID NO: 50 2A1-HC-258insCharacteristic peptide PEVTCCVVVDV SEQ ID NO: 51 2A1-HC-259insCharacteristic peptide EVTCVCVVDVS SEQ ID NO: 52 2A1-HC-354insCharacteristic peptide PSRDECLTKNQ SEQ ID NO: 53 2A1-HC-355insCharacteristic peptide SRDELCTKNQV SEQ ID NO: 54 2A1-HC-357insCharacteristic peptide DELTKCNQVSL SEQ ID NO: 55 2A1-HC-378insCharacteristic peptide IAVEWCESNGQ SEQ ID NO: 56 2A1-HC-379insCharacteristic peptide AVEWECSNGQP SEQ ID NO: 57 2A1-HC-386insCharacteristic peptide GQPENCNYKTT SEQ ID NO: 58 2A1-HC-387insCharacteristic peptide QPENNCYKTTP SEQ ID NO: 59 2A1-HC-410insCharacteristic peptide KLTVDCKSRWQ