CAR-T CELLS WITH HUMANIZED CD19 SCFV WITH MUTATION IN CDR 1 REGION
20210395362 · 2021-12-23
Assignee
Inventors
Cpc classification
A61K35/17
HUMAN NECESSITIES
C12N15/63
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C12N2501/599
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K35/17
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
Abstract
Provided is a humanized CD19 single-chain variable fragment (scFv) having a mutation of valine to glycine in CDR1, comprising VH having the amino acid sequence of SEQ ID NO: 6 and VL having the amino acid sequence of SEQ ID NO: 5. Also provided is a CD19 chimeric antigen receptor fusion protein comprising from N-terminus to C-terminus: (i) a single-chain variable fragment (scFv), (ii) a transmembrane domain, (iii) at least one co-stimulatory domains, and (iv) an activating domain. This humanized CD19-CAR-T cells have specific killing activity with secretion of cytokine IFN-gamma in CAR-T cells in vitro and in vivo.
Claims
1. A humanized single-chain variable fragment (scFv) of CD19 comprising VH having the amino acid sequence of SEQ ID NO: 6 and VL having the amino acid sequence of SEQ ID NO: 5.
2. The scFv of claim 1, further comprises a linker in between VH and VL.
3. The scFv of claim 2, which has the amino acid sequence of SEQ ID NO: 7.
4. A chimeric antigen receptor (CAR) fusion protein comprising from N-terminus to C-terminus: (i) the scFv of claim 1, (ii) a transmembrane domain, (iii) at least one co-stimulatory domain, and (Iv) an activating domain.
5. The CAR fusion protein of claim 4, which has the amino acid sequence of SEQ ID NO: 14.
6. An antibody against human CD19 comprising VH having the amino acid sequence of SEQ ID NO: 6 and VL having the amino acid sequence of SEQ ID NO: 5.
7. A nucleic acid molecule encoding the CAR fusion protein of claim 4.
8. A vector comprising the nucleic acid molecule of claim 7.
9. A host cell expressing the CAR fusion protein of claim 4.
10. A formulation comprising the cell of claim 9, and a pharmaceutically acceptable carrier, diluent or excipient.
11. The cell of claim 9, wherein the cell is T cell or NK cell.
12. A method for treating cancer or tumor comprising administering the cell of claim 9 to a subject in need of treatment.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
DEFINITIONS
[0084] As used herein, a “chimeric antigen receptor (CAR)” means a fused protein comprising an extracellular domain capable of binding to an antigen, a transmembrane domain derived from a polypeptide different from a polypeptide from which the extracellular domain is derived, and at least one intracellular domain. The “chimeric antigen receptor (CAR)” is sometimes called a “chimeric receptor”, a “T-body”, or a “chimeric immune receptor (CIR).” The “extracellular domain capable of binding to an antigen” means any oligopeptide or polypeptide that can bind to a certain antigen. The “intracellular domain” means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell.
[0085] “CDR”s are complementary-determining Regions of VH or VL chains of antibody which are critical for binding with antigen.
[0086] As used herein, “humanized antibodies” are antibodies from non-human species whose protein sequences have been modified to increase their similarity to antibody variants produced naturally in humans.
[0087] As used herein, a “domain” means one region in a polypeptide which is folded into a particular structure independently of other regions.
[0088] As used herein, a “single chain variable fragment (scFv)” means a single chain polypeptide derived from an antibody which retains the ability to bind to an antigen. An example of the scFv includes an antibody polypeptide which is formed by a recombinant DNA technique and in which Fv regions of immunoglobulin heavy chain (H chain) and light chain (L chain) fragments are linked via a spacer sequence. Various methods for engineering a scFv are known to a person skilled in the art.
[0089] As used herein, a “tumor antigen” means a biological molecule having antigenicity, expression of which causes cancer.
CD19
[0090] CD19 is a B-cell type lymphocyte antigen which is expressed on all B-cell malignancies, including acute lymphoblastic leukemia (ALL), chronic lymphoblastic leukemia (CLL), and Non-Hodgkin lymphomas. This universal expression among leukemia and lymphomas made this antigen an attractive target for targeting with CAR-T cells [3].
CD19 Structure and Signaling
[0091] The human CD19 protein is a 95 kDa transmembrane glycoprotein which consists of 556 amino-acids: 20-291-extracellular domain; 292-313-transmembrane domain; 314-556-cytoplasmic domain as shown below (extracellular domain underlined). It belongs to immunoglobulin superfamily proteins and mediates B cell receptor, BCR-dependent and independent signaling. CD19 binds to BCR and other cell surface protein to modulate intracellular signaling through binding other kinases and binding partners. CD19 signaling is connected with Src-family kinase, PI3Kinase, Abl, AKT-dependent signaling. CD19 is a biomarker of B-cells mediating survival signaling and immune responses.
TABLE-US-00001 (SEQ ID NO.: 16) 10 20 30 40 MPPPRLLFFL LFLTPMEVRP EEPLVVKVEE GDNAVLQCLK 50 60 70 80 GTSDGPTQQL TWSRESPLKP FLKLSLGLPG LGIHMRPLAI 90 100 110 120 WLYIENVSQQ MGGFYLCQPG PPSEKAWQPG WTVNVEGSGE 130 140 150 160 LFRWNVSDLG GLGCGLKNRS SEGPSSPSGK LMSPKLYVWA 170 180 190 200 KDRPEIWEGE PPCLPPRDSL NQSLSQDLTM APGSTLWLSC 210 220 230 240 GVPPDSVSRG PLSWTHVHPK GPKSLLSLEL KDDRPARDMW 250 260 270 280 VMETGLLLPR ATAQDAGKYY CHRGNLTMSF HLEITARPVL 290 300 310 320 WHWLLRTGGW KVSAVILAYL IFCLCSLVGI LHLQRALVLR 330 340 350 360 RKRKRMTDPT RRFFKVTPPP GSGPQNQYGN VLSLPTPTSG 370 380 390 400 LGRAQRWAAG LGGTAPSYGN PSSDVQADGA LGSRSPPGVG 410 420 430 440 PEEEEGEGYE EPDSEEDSEF YENDSNLGQD QLSQDGSGYE 450 460 470 480 NPEDEPLGPE DEDSFSNAES YENEDEELIQ PVARTMDFLS 490 500 510 520 PHGSAWDPSR EATSLGSQSY EDMRGILYAA PQLRSIRGQP 530 540 550 GPNHEEDADS YENMDNPDGP DPAWGGGGRM GTWSTR
Mutated CD19 scFv of the Present Invention
[0092] The inventors have generated humanized CD19 scFv containing a mutation in CDR region of VH (V27G) and generated CAR-T cells based on the humanized CD19 ScFv sequence containing this mutation specifically targeting CD19. The inventors have produced the humanized CD19-CAR-T cells to target cancer cells overexpressing CD19 antigen. The humanized CD19-CAR-T cells of the present invention secreted high level of IFN-gamma against leukemia cancer cells and killed Hela-CD19-positive target cells but not control Hela cells.
[0093] The present invention is directed to a humanized anti-human CD19 antibody from mouse clone FMC63, comprising humanized V.sub.H having the amino acid of SEQ ID NO: 6 and humanized V.sub.L having the amino acid of SEQ ID NO: 5, respectively. In one embodiment, the humanized anti-human CD19 antibody is a single-chain variable fragment (scFv).
[0094] The present invention is also directed to a chimeric antigen receptor fusion protein comprising from N-terminus to C-terminus: (i) a single-chain variable fragment (scFv) against CD19 (the present invention), (ii) a transmembrane domain, (iii) at least one co-stimulatory domains, and (iv) an activating domain.
[0095]
[0096] The inventors have generated humanized CD19-ScFv with mutation V27G in CDR1 region of CD19 scFv, and used this humanized CD19-ScFv for CAR generation to produce CD19-41BB-CD3-CAR-T (hCD19-CAR-T) cells against leukemia cells. The humanized CD19-CAR-T cells of the present invention secreted high levels of IFN-gamma, were positive by cytotoxicity assay with Hela-CD19 cells but not with Hela cells, which indicates specific killing activity of CAR-T cells against target cancer cells with CD19 overexpression.
[0097] The advantages of the humanized CD19-ScFv of the present invention vs. mouse CD19-ScFv include less immunogenicity to human due to humanized CD19 scFv. Thus, the humanized CD19-CAR-T cells are advantageous as therapeutic agents in many clinical applications.
[0098] The advantages of the humanized CD19-ScFv of the present invention, which includes a mutation in CDR1 of VH (V27G in VH), vs. humanized CD19-ScFv without a mutation include prolonged survival in mice treated with mutated humanized CD19-CAR T cells.
[0099] The present humanized CD19 ScFv can be used for immunotherapy applications: toxin/drug-conjugated antibody, monoclonal therapeutic antibody, and CAR-T cell immunotherapy.
[0100] Humanized CD19-CAR-T cells using the present humanized CD19 ScFv effectively target CD19 antigen in CD19-positive cancer cell lines.
[0101] Humanized CD19-CAR-T cells can be used in combination with different chemotherapy: checkpoint inhibitors, targeted therapies, small molecule inhibitors, and antibodies.
[0102] Humanized CD19-CAR-T cells can be used clinically for CD19-positive cancer cells.
[0103] Modifications of co-activation domains: CD28, 4-1BB and others can be used to increase its efficacy. Tag-conjugated humanized CD19 scFv can be used for CAR generation.
[0104] Humanized CD19-CAR-T cells can be used with different safety switches: t-EGFR, RQR (Rituximab-CD34-Rituximab), inducible caspase-9 and other.
[0105] Third generation CAR-T or other co-activation signaling domains can be used for the same humanized CD19-scFv inside CAR.
[0106] The humanized CD19 CAR can be combined with CARs targeting other tumor antigens or tumor microenvironment, e.g., VEGFR-1-3, PDL-1, bi-specific antibodies with CD19 and CD3 or other antigens can be generated for therapy.
[0107] The humanized CD19-CAR-T cells can be used against cancer stem cells or tumor initiating cells that are most resistant against chemotherapy and form aggressive tumors.
[0108] Vector
[0109] The invention also provides a DNA construct encoding the CAR sequences of the invention.
[0110] The nucleic acid sequences coding for the desired molecules can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the gene, by deriving the gene from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques. Alternatively, the gene of interest can be produced synthetically.
[0111] The present invention also provides vectors in which the DNA construct of the present invention is inserted. Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells. Lentiviral vectors have the advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the advantage of low immunogenicity.
[0112] In brief summary, the expression of natural or synthetic nucleic acids encoding CARs is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector. The vectors can be suitable for replication and integration in eukaryotes. Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
[0113] The expression constructs of the present invention may also be used for nucleic acid immune and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, incorporated by reference herein in their entireties. In another embodiment, the invention provides a gene therapy vector,
[0114] The nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors,
[0115] Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al, (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals. Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
[0116] A number of viral based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo. A number of retroviral systems are known in the art. In some embodiments, adenovirus vectors are used. A number of adenovirus vectors are known in the art. In one embodiment, lentivirus vectors are used.
[0117] Additional promoter elements, e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either cooperatively or independently to activate transcription.
[0118] One example of a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto. Another example of a suitable promoter is Elongation Growth Factor-1α (EF-1α). However, other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the invention should not be limited to the use of constitutive promoters, inducible promoters are also contemplated as part of the invention. The use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired. Examples of inducible promoters include, but are not limited to a metallothionein promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
[0119] In order to assess the expression of a CAR polypeptide or portions thereof, the expression vector to be introduced into a ceil can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors. In other aspects, the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells. Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.
[0120] Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences. In general, a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells. Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82). Suitable expression systems are well known and may be prepared using known techniques or obtained commercially. In general, the construct with the minimal 5′ flanking region showing the highest level of expression of reporter gene is identified as the promoter. Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
[0121] Methods of introducing and expressing genes into a cell are known in the art. In the context of an expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical, or biological means.
[0122] Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). A preferred method for the introduction of a polynucleotide into a host cell is calcium phosphate transfection.
[0123] Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
[0124] Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
[0125] In the case where a non-viral delivery system is utilized, an exemplary delivery vehicle is a liposome. The use of lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid. Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a “collapsed” structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids. For example, lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
[0126] In the case where a non-viral delivery system is utilized, genome editing technique is exemplarily employed to complete the invention, for example CRISPR-Cas9, ZFN or TALEN.
[0127] In a preferred embodiment of the invention, the vector is a lentiviral vector.
[0128] In a preferred embodiment of the invention, the DNA construct further comprises a signal peptide coding sequence. Preferably, the signal peptide sequence is ligated upstream of the nucleic acid sequence of antigen binding domain.
[0129] Therapeutic Application
[0130] The present invention encompasses a cell (e.g., T cell) transduced with a lentiviral vector (LV) encoding the CAR of the invention. The transduced T cell can elicit a CAR-mediated T-cell response.
[0131] Thus, the present invention also provides a method for stimulating a T cell-mediated immune response to a target cell population or tissue in a mammal comprising the step of administering to the mammal a T cell that expresses the CAR of the invention.
[0132] In one embodiment, the present invention includes a type of cellular therapy where T cells are genetically modified to express the CAR of the invention and the CAR-T cell is infused to a recipient in need thereof. The infused cell is able to kill tumor cells in the recipient. Unlike antibody therapies, CAR-T cells are able to replicate in vivo resulting in long-term persistence that can lead to sustained tumor control.
[0133] In one embodiment, the CAR-T cells of the invention can undergo robust in vivo T cell expansion and can persist for an extended amount of time. In addition, the CAR mediated immune response may be part of an adoptive immunotherapy approach in which CAR-modified T cells induce an immune response specific to the antigen binding moiety in the CAR. For example, an anti-CD19 CAR-T cell elicits an immune response specific against cells expressing CD19.
[0134] Although the data disclosed herein specifically disclose lentiviral vector comprising anti-CD19 scFv, hinge and transmembrane domain, and 4-1BB and CD3t signaling domains, the invention should be construed to include any number of variations for each of the components of the construct as described elsewhere herein.
[0135] Adaptation diseases that may be treated include CD19 positive tumors and diseases caused by excessive B cells. CD19 positive tumors may include CD19 positive non-solid tumors (such as hematological tumors, for example, leukemias and lymphomas) or solid tumors. Types of tumors or cancers to be treated with the CARs of the invention include, but are not limited to, carcinoma, blastoma, and sarcoma, and certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignancies e.g., sarcomas, carcinomas, and melanomas. Adult tumors/cancers and pediatric tumors/cancers are also included.
[0136] Hematologic cancers are cancers of the blood or bone marrow. Examples of hematological (or hematogenous) cancers include leukemias, including acute leukemias (such as acute lymphocytic leukemia, acute myelocytic leukemia, acute myelogenous leukemia and myeloblasts, promyeiocytic, myelomonocytic, monocytic and erythroleukemia), chronic leukemias (such as chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia, and chronic lymphocytic leukemia), polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma (indolent and high grade forms), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia and myelodysplasia.
[0137] Solid tumors are abnormal masses of tissue that usually do not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named for the type of cells that form them (such as sarcomas, carcinomas, and lymphomas). Examples of solid tumors, such as sarcomas and carcinomas, include fibrosarcoma, myxosarcoma, liposarcoma, mesothelioma, malignant lymphoma, pancreatic cancer and ovarian cancer.
[0138] The CAR-modified T cells of the invention may also serve as a type of vaccine for ex vivo immunization and/or in vivo therapy in a mammal. Preferably, the mammal is a human.
[0139] With respect to ex vivo immunization, at least one of the following occurs in vitro prior to administering the cell into a mammal: i) expansion of the cells, ii) introducing a nucleic acid encoding a CAR to the cells, and/or iii) cryopreservation of the cells.
[0140] Ex vivo procedures are well known in the art and are discussed more fully below. Briefly, cells are isolated from a mammal (preferably a human) and genetically modified (i.e., transduced or transfected in vitro) with a vector expressing a CAR disclosed herein. The CAR-modified cell can be administered to a mammalian recipient to provide a therapeutic benefit. The mammalian recipient may be a human and the CAR-modified cell can be autologous with respect to the recipient. Alternatively, the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
[0141] In addition to using a cell-based vaccine in terms of ex vivo immunization, the present invention also provides compositions and methods for in vivo immunization to elicit an immune response directed against an antigen in a patient.
[0142] Generally, the cells activated and expanded as described herein may be utilized in the treatment and prevention of diseases that arise in individuals who are immunocompromised. In particular, the CAR-modified T cells of the invention are used in the treatment of CCL. In certain embodiments, the cells of the invention are used in the treatment of patients at risk for developing CCL. Thus, the present invention provides methods for the treatment or prevention of CCL comprising administering to a subject in need thereof, a therapeutically effective amount of the CAR-modified T cells of the invention.
[0143] The CAR-modified T cells of the present invention may be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2, IL-17 or other cytokines or cell populations. Briefly, pharmaceutical compositions of the present invention may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. Compositions of the present invention are preferably formulated for intravenous administration.
[0144] Pharmaceutical compositions of the present invention may be administered in a manner appropriate to the disease to be treated (or prevented). The quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
[0145] When “an immunologically effective amount”, “an anti-tumor effective amount”, “an tumor-inhibiting effective amount”, or “therapeutic amount” is indicated, the precise amount of the compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 10.sup.4 to 10.sup.9 cells/kg body weight, preferably 10.sup.5 to 10.sup.6 cells/kg body weight, including all integer values within those ranges. T cell compositions may also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al, New Eng. J. of Med. 319: 1676, 1988). The optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
[0146] The administration of the subject compositions may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The compositions described herein may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally. In one embodiment, the T cell compositions of the present invention are administered to a patient by intradermal or subcutaneous injection. In another embodiment, the T cell compositions of the present invention are preferably administered by i.v. injection. The compositions of T cells may be injected directly into a tumor, lymph node, or site of infection.
[0147] In certain embodiments of the present invention, cells activated and expanded using the methods described herein, or other methods known in the art where T cells are expanded to therapeutic levels, are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities, including but not limited to treatment with agents such as antiviral therapy, cidofovir and interleukin-2, Cytarabine (also known as ARA-C) or natalizumab treatment for MS patients or efalizumab treatment for psoriasis patients or other treatments for PML patients. In further embodiments, the T cells of the invention may be used in combination with chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunotherapeutic agents. In a further embodiment, the cell compositions of the present invention are administered to a patient in conjunction with (e.g., before, simultaneously or following) bone marrow transplantation, or the use of chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide. For example, in one embodiment, subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. In certain embodiments, following the transplant, subjects receive an infusion of the expanded immune cells of the present invention. In an additional embodiment, expanded cells are administered before or following surgery.
[0148] The dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment. The scaling of dosages for human administration can be performed according to art-accepted practices. In general, 1×10.sup.6 to 1×10.sup.10 of the modified T cells of the invention (e.g., CAR-T 19 cells) can be applied to patients by means of, for example, intravenous infusion each treatment or each course of treatment.
[0149] The following examples further illustrate the present invention. These examples are intended merely to be illustrative of the present invention and are not to be construed as being limiting.
EXAMPLES
[0150] The inventors generated humanized CD19-ScFv-CAR constructs inside lentiviral vector cloned into Xba I and Eco R I sites of lentiviral vector. pCD510-FMC63-28z lentiviral CAR construct containing the humanized CD19 ScFv-41BB-CD3zeta insert—between the Xba I and Eco RI cloning sites.
[0151] The lentiviruses were generated in 293T cells and titer was established by RT-PCR. Then equal dose of lentiviruses was used for transduction of T cells.
Example 1. Humanized CD19 Antibody: VH and VL and scFv Sequences
[0152] The inventors have humanized CD19 scFv from mouse CD19 FMC63 scFv clone, and selected a humanized scFv with a mutation in CDR1 (Clone 11) based on the in vivo data efficacy. The structure of humanized CD19 scFv is: VL-linker-VH. Linker is G S T S G S G K P G S G E G S T K G (SEQ ID NO: 7).
[0153] The bold highlights the nucleotide sequence of humanized CD19 V.sub.L (SEQ ID NO: 1); the regular font highlights the nucleotide sequence of V.sub.H (SEQ ID NO: 2, bold mark mutation (ggc) coding G); in between (italicized, smaller font) is the nucleotide sequence (SEQ ID NO: 3) encoding linker G S T S G S G K P G S G G S T K G (SEQ ID NO: 7)
TABLE-US-00002 (SEQ ID NO.: 15) gatattcagatgacccagagcccgagcagcctgagcgcgagcgtgggcga tcgcgtgaccattacctgccgcgcgagccaggatattagcaaatatctga actggtatcagcagaaaccgggcaaagcgccgaaactgctgatttatcat accagccgcctgcatagcggcgtgccgagccgctttagcggcagcggcag cggcaccgattttaccctgaccattagcagcctgcagccggaagattttg cgacctattattgccagcagggcaacaccctgccgtatacctttggcggc ggcaccaaagtggaaattaaaggctccacctctggatccggcaagcccgg atctggcgagggatccaccaagggccaggtgcagctgcaggaaagcggcc cgggcctggtgaaaccgagcgaaaccctgagcctgacctgcaccgtgagc ggcggcagcctgccggattatggcgtgagctggattcgccagccgccggg caaaggcctggaatggattggcgtgatttggggcagcgaaaccacctatt ataacagcgcgctgaaaagccgcgtgaccattagcgtggataccagcaaa aaccagtttagcctgaaactgagcagcgtgaccgcggcggataccgcggt gtattattgcgcgaaacattattattatggcggcagctatgcgatggatt attggggccagggcaccctggtgaccgtgagcagc
[0154] Humanized CD19 scFv (SEQ ID NO: 4): bold VL, regular font VH, CDR regions underlined, the mutation is at amino acid position 27 of VH (SEQ ID NO: 6), which is shown as a bigger italic font G (V27G of VH)
TABLE-US-00003 (SEQ ID NO.: 4) DIQMTQSPSSLSASVGDRVTITCRASQDISKYLNWYQQKPGKAPKLLIYH TSRLHSGVPSRFSGSCSGTDFTLTISSLQPEDFATYYCQQGNTLPYTEGG GTKVEIK G S T S G S G K P G S G E G S T K G QVQLQESGPGLVKPSETLSLTCTVG SLPDYGVSWIRQPPGKGLEWKIGV IWGSETTYYNSALKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAKHYY YGGSYAMDYWGQGTLVTVSS
[0155] In the protein, the bold highlights the amino acid sequence of V.sub.L (SEQ ID NO: 5); the regular not italics font highlights the amino sequence of V.sub.H (SEQ ID NO: 6); in between italicized, smaller font is the amino acid sequence of linker sequence (SEQ ID NO: 7).
[0156] By 3D-modeling and binding experiments, the inventors have discovered that mutation in CDR1 region of VH in humanized CD19 antibody can improve the binding of the antibody with CD19 antigen. The mutation in clone 11, CDR1, V27G of VH is shown in
Example 2. Humanized CD19-CAR Sequences
[0157] The scheme of Humanized CD19-CAR construct is shown on
[0158] The following nucleotide sequence shows CD8 leader-Humanized CD19 ScFv-CD8 hinge-TM8-41BB-CD3 zeta of the present invention. The CAR structure includes Human CD8 signaling peptide, humanized CD19 scFv (V.sub.L-Linker-V.sub.H), CD8 hinge, CD8 trans-membrane, 41BB co-stimulatory and CD3 zeta activation domains (
[0159] CD8 leader sequence-CD19 scFv (V.sub.L-Linker-V.sub.H)-CD8 hinge CD8 TM-41BB-CD3-zeta:
TABLE-US-00004 <CD8 leader> (SEQ ID NO.: 8) ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCCAGGCCG <Humanized CD19 (VL-linker-VH), clone 11 scFv> (mutation ggc which codes V27G is shown in bold) (SEQ ID NO.: 15) gatattcagatgacccagagcccgagcagcctgagcgcgagcgtgggcgatcgcgtgacc attacctgccgcgcgagccaggatattagcaaatatctgaactggtatcagcagaaaccg ggcaaagcgccgaaactgctgatttatcataccagccgcctgcatagcggcgtgccgagc cgctttagcggcagcggcagcggcaccgattttaccctgaccattagcagcctgcagccg gaagattttgcgacctattattgccagcagggcaacaccctgccgtatacctttggcggc ggcaccaaagtggaaattaaa ggctccacctctggatccggcaagcccggatctggcgagggatccaccaagggc caggtgcagctgcaggaaagcggcccgggcctggtgaaaccgagcgaaaccctgagcctg acctgcaccgtgagoggcggcagcctgccggattatggcgtgagctggattcgccagccg ccgggcaaaggcctggaatggattggcgtgatttggggcagcgaaaccacctattataac agcgcgctgaaaagccgcgtgaccattagcgtggataccagcaaaaaccagtttagcctg aaactgagcagcgtgaccgcggcggataccgcggtgtattattgcgcgaaacattattat tatggcggcagctatgcgatggattattggggccagggcaccctggtgaccgtgagcagc <CD8 hinge> (SEQ ID NO.: 9) ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCC TGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGG GGCTGGACTTCGCCTGTGAT <CD8 TM> (SEQ ID NO.: 10) ATCTACATCTGGGCGCCCCTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTAT CACCCTTTACTGC <4-1BB co-stimulatory domain (SEQ ID NO.: 11) AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTAC AAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAG GATGTGAACTG <CD3 zeta> (SEQ ID NO.: 12) AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACCAG CTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGAC GTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCC TGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGA AAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAG CCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAATAG <EcoRI restriction site> (SEQ ID NO.: 13) gaattc
[0160] Translated amino-acid sequence of humanized CD19-4-1BB-CD3-CAR protein (see
TABLE-US-00005 (SEQ ID NO.: 14) M A L P V T A L L L P L A L L L H A A R P D I Q M T Q S P S S L S A S V G D R V T I T C R A S Q D I S K Y L N W Y Q Q K P G K A P K L L I Y H T S R L H S G V P S R F S G S G S G T D F T L T I S S L Q P E D F A T Y Y C Q Q G N T L P Y T F G G G T K V E I K G S T S G S G K P G S G E G S T K G Q V Q L Q E S G P G L V K P S E T L S L T C T V S G G S L P D Y G V S W I R Q P P G K G L E W I G V I W G S E T T Y Y N S A L K S R V T I S V D T S K N Q F S L K L S S V T A A D T A V Y Y C A K H Y Y Y G G S Y A M D Y W G Q G T L V T V S S T T T P A P R P P T P A P T I A S Q P L S L R P E A C R P A A G G A V H T R G L D F A C D I Y I W A P L A G T C G V L L L S L V I T L Y C K R G R K K L L Y I F K Q P F M R P V Q T T Q E E D G C S R F P E E E E G G C E L R V K F S R S A D A P A Y K Q G Q N Q L Y N E L N L G R R E E Y D V L D K R R G R D P E M G G K P R R K N P Q E G L Y N E L Q K D K M A E A Y S E I G M K G E R R R G K G H D G L Y Q G L S T A T K D T Y D A L H M Q A L P P R
Example 3. Humanized CD19-CAR-T Cells Kill Leukemia Cells and Secrete IFN-Gamma Against CD19-Positive Cancer Cells
[0161] We designed humanized CD19-CAR-T cells with humanized CD19-CAR construct shown in
[0162] The result was shown in
Example 4. Humanized CD19-CAR-T Cells Killed Hela-CD19 Cells but not Hela Cells
[0163] We incubated humanized effector CD19-CAR-T cells of the present invention with target Hela-CD19 target cells and also Hela (CD19-negative) control cells and performed real-time cytotoxicity assay (RTCA, as described in [4].
[0164] The result was shown in
[0165] xCELLigence Real-Time Cytotoxicity Assay was used for detection of humanized CD19-CAR-T and mouse CD19-41BB-CD3 CAR-T cell cytotoxicity, as described [4]. Normalized cell index is shown on Y-axis, and time in hours is shown on X-axis. From top to bottom on the right, Target cells alone; then effector cells added to target cells: T cells; Mock CAR-T cells; Mouse Cd19-CAR-T cells; Humanized CD19 CAR-T cells.
Example 5. Humanized CD19 CAR-T Cells Secrete IFN-Gamma Against Target Hela-CD19 Cells
[0166] We collected supernatant after co-incubation of humanized CD19-CAR-T cells and target Hela-CD19 and performed IFN-gamma assay, as described [5].
[0167] The result was shown in
Example 6. Humanized CD19-CAR-T Cells Decrease Raji Xenograft Tumor Growth In Vivo
[0168] We injected Raji-luciferase-positive cells into NSG-mice intravenously and then next day injected 1×10{circumflex over ( )}7 humanized CD19-CAR-T cells, as described [4]. We used IVIS system to detect Raji xenograft tumor cell growth by imaging.
[0169] The result was shown in
[0170] The quantification of imaging at day 14 is shown in
Example 7. Humanized CD19-CAR-T Cells Significantly Prolonged Survival of Mice in Raji Xenograft Model Over Mice Treated with Mouse CD19-CAR-T Cells
[0171] The Kaplan-Meier survival curve shows a significant increase of survival in mice after injecting mice with humanized CD19-CAR-T cells versus mouse CD19-CAR-T cell or control Mock-Car-T cells (
Example 8. Humanized CD19 CAR with V27G in CDR1 of VH Prolonged Survival of Mice Compared with Mice Treated with Non-Mutated Humanized CD19 CAR-T Cells
[0172] We compared humanized CD19-CAR with a V27G mutation in CDR1 of VH (Clone 11) with humanized CD19-CAR without a mutation. The “huCD19 no mutation” shown in
[0173] The results in
Example 9. CD19-CAR-T Cells are Detected by FACS with CD19 or FAB Antibody after Injection into Mice In Vivo
[0174] The mouse blood was collected at day 7 after injecting CAR-T cells to mice with Raji xenograft tumor cells to detect CAR-T cells in vivo.
[0175] The result was shown in
REFERENCES
[0176] 1. Maus, M. V.; Haas, A. R.; Beatty, G. L.; Albelda, S. M.; Levine, B. L.; Liu, X.; Zhao, Y.; Kalos, M.; June, C. H. T cells expressing chimeric antigen receptors can cause anaphylaxis in humans. Cancer Immunol Res 2013, 1, 26-31. [0177] 2. Maus, M. V.; Grupp, S. A.; Porter, D. L.; June, C. H. Antibody-modified t cells: Cars take the front seat for hematologic malignancies. Blood 2014, 123, 2625-2635. [0178] 3. Eshhar, Z.; Waks, T.; Gross, G. The emergence of t-bodies/car t cells. Cancer J 2014, 20, 123-126. [0179] 4. Berahovich, R.; Xu, S.; Zhou, H.; Harto, H.; Xu, Q.; Garcia, A.; Liu, F.; Golubovskaya, V. M.; Wu, L. Flag-tagged cd19-specific car-t cells eliminate cd19-bearing solid tumor cells in vitro and in vivo. Front Biosci (Landmark Ed) 2017, 22, 1644-1654. [0180] 5. Golubovskaya, V.; Berahovich, R.; Zhou, H.; Xu, S.; Harto, H.; Li, L.; Chao, C. C.; Mao, M. M.; Wu, L. Cd47-car-t cells effectively kill target cancer cells and block pancreatic tumor growth. Cancers (Basel) 2017, 9.