ADENOVIRAL VECTORS ENCODING HEPATITIS B VIRAL ANTIGENS FUSED TO HERPES VIRUS GLYCOPROTEIN D AND METHODS OF USING THE SAME
20210393770 · 2021-12-23
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N2730/10122
CHEMISTRY; METALLURGY
C12N2730/10134
CHEMISTRY; METALLURGY
C12N2710/16034
CHEMISTRY; METALLURGY
C12N2710/16622
CHEMISTRY; METALLURGY
A61K39/292
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
International classification
C12N15/86
CHEMISTRY; METALLURGY
Abstract
Provided herein are non-naturally occurring variants of the hepatitis B virus (HBV) Core protein, the HBV polymerase N-terminal domain, and the HBV polymerase C-terminal domain, as well as immunogenic fragments thereof. Fusion proteins comprising the HBV variants fused to a herpes simplex virus (HSV) glycoprotein (gD) sequence, as well as methods of using the fusion proteins, are also provided.
Claims
1. A nucleic acid molecule comprising: a nucleotide sequence encoding an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, a nucleotide sequence encoding an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, and a nucleotide sequence encoding an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof.
2. The nucleic acid molecule of claim 1, encoding a fusion protein comprising the amino acid sequence of SEQ ID NO: 174.
3. The nucleic acid molecule of claim 1, further comprising a nucleotide sequence encoding: an N-terminal HSV gD sequence or a variant thereof, a C-terminal HSV gD sequence or a variant thereof, or both.
4. The nucleic acid molecule of claim 3, comprising: a nucleotide sequence encoding an N-terminal HSV gD sequence or a variant thereof; a nucleotide sequence encoding an HBV fusion protein comprising an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof; an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof; an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof; and a nucleotide sequence encoding a C-terminal HSV gD sequence or a variant thereof.
5. The nucleic acid molecule of claim 4, wherein the nucleotide sequence encodes an HBV fusion protein comprising the amino acid sequence of SEQ ID NO: 174.
6. The nucleic acid molecule of claim 5, wherein the nucleotide sequence encodes an N-terminal HSV gD sequence comprising the amino acid sequence of SEQ ID NO: 12.
7. The nucleic acid molecule of claim 5, wherein the nucleotide sequence encodes an N-terminal HSV gD sequence comprising amino acid residues 26-269 of SEQ ID NO: 12.
8. The nucleic acid molecule of claim 5, wherein the nucleotide sequence encodes a C-terminal HSV gD sequence comprising the transmembrane domain of the HSV gD.
9. The nucleic acid molecule of claim 8, wherein the nucleotide sequence encodes a C-terminal HSV gD sequence comprising the amino acid sequence of SEQ ID NO: 13.
10. The nucleic acid molecule of claim 4, comprising: a nucleotide sequence encoding an N-terminal HSV gD sequence comprising amino acid residues 26-269 of SEQ ID NO: 12, a nucleotide sequence encoding an HBV fusion protein comprising: an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof; and a nucleotide sequence encoding a C-terminal HSV gD sequence comprising the amino acid sequence of SEQ ID NO: 13.
11. The nucleic acid molecule of claim 10, wherein the nucleotide sequence encodes an N-terminal HSV gD sequence comprising the amino acid sequence of SEQ ID NO: 12.
12. The nucleic acid molecule of claim 10, wherein the nucleotide sequence encodes an HBV fusion protein comprising the amino acid sequence of SEQ ID NO: 174.
13. The nucleic acid molecule of claim 10, wherein the nucleotide sequence encodes a fusion protein comprising the amino acid sequence of SEQ ID NO: 185.
14. The nucleic acid molecule of claim 12, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 176.
15. The nucleic acid molecule of claim 13, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 184.
16. A virus comprising the nucleic acid molecule of claim 13.
17. The virus of claim 16, wherein the virus is an adenovirus.
18. The virus of claim 17, wherein the adenovirus is an AdC6 or AdC7.
19. A vaccine comprising the virus of claim 16.
20. A method of inducing an immune response to HBV in a subject, the method comprising providing to the subject an effective amount of the nucleic acid molecule of claim 13 to thereby induce an immune response to HBV.
21. The method of claim 20, wherein the nucleic acid molecule is in an AdC6 virus.
22. The method of claim 20, wherein the nucleic acid molecule is in an AdC7 virus.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0013] The summary, as well as the following detailed description, is further understood when read in conjunction with the appended drawings. For the purpose of illustrating the disclosed proteins, vaccines, and methods, there are shown in the drawings exemplary embodiments of the proteins, vaccines, and methods; however, the proteins, vaccines, and methods are not limited to the specific embodiments disclosed. In the drawings:
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
[0049] The disclosed proteins, vaccines, and methods may be understood more readily by reference to the following detailed description taken in connection with the accompanying figures, which form a part of this disclosure. It is to be understood that the disclosed proteins, vaccines, and methods are not limited to the specific proteins, vaccines, and methods described and/or shown herein, and that the terminology used herein is for the purpose of describing particular embodiments by way of example only and is not intended to be limiting of the claimed proteins, vaccines, and methods.
[0050] Unless specifically stated otherwise, any description as to a possible mechanism or mode of action or reason for improvement is meant to be illustrative only, and the disclosed proteins, vaccines, and methods are not to be constrained by the correctness or incorrectness of any such suggested mechanism or mode of action or reason for improvement.
[0051] Throughout this text, the descriptions refer to proteins and methods of using said proteins. Where the disclosure describes or claims a feature or embodiment associated with a proteins, such a feature or embodiment is equally applicable to the methods of using said proteins. Likewise, where the disclosure describes or claims a feature or embodiment associated with a method of using the proteins, such a feature or embodiment is equally applicable to the proteins.
[0052] Where a range of numerical values is recited or established herein, the range includes the endpoints thereof and all the individual integers and fractions within the range, and also includes each of the narrower ranges therein formed by all the various possible combinations of those endpoints and internal integers and fractions to form subgroups of the larger group of values within the stated range to the same extent as if each of those narrower ranges was explicitly recited. Where a range of numerical values is stated herein as being greater than a stated value, the range is nevertheless finite and is bounded on its upper end by a value that is operable within the context of the invention as described herein. Where a range of numerical values is stated herein as being less than a stated value, the range is nevertheless bounded on its lower end by a non-zero value. It is not intended that the scope of the invention be limited to the specific values recited when defining a range. All ranges are inclusive and combinable.
[0053] When values are expressed as approximations, by use of the antecedent “about,” it will be understood that the particular value forms another embodiment. Reference to a particular numerical value includes at least that particular value, unless the context clearly dictates otherwise.
[0054] It is to be appreciated that certain features of the disclosed proteins, vaccines, and methods which are, for clarity, described herein in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of the disclosed proteins, vaccines, and methods that are, for brevity, described in the context of a single embodiment, may also be provided separately or in any subcombination.
[0055] As used herein, the singular forms “a,” “an,” and “the” include the plural.
[0056] Various terms relating to aspects of the description are used throughout the specification and claims. Such terms are to be given their ordinary meaning in the art unless otherwise indicated. Other specifically defined terms are to be construed in a manner consistent with the definitions provided herein.
[0057] As used herein, “immunogenic fragment thereof” refers to a portion of the disclosed HBV Core (Core), HBV polymerase N-terminal domain (PolN), or HBV polymerase C-terminal domain (PolC) that can produce an immune response in a subject.
[0058] As used herein, “providing to the subject” and similar terms indicate a procedure by which the fusion proteins, nucleic acid molecules, vectors, or vaccines are delivered to a subject such that target cells, tissues, or segments of the body of the subject are contacted with the fusion proteins, nucleic acid molecules, vectors, or vaccines. “Providing to the subject” includes parenteral and non-parenteral routes of administration.
[0059] The term “biosimilar” (of an approved reference product/biological drug, i.e., reference listed drug) refers to a biological product that is highly similar to the reference product notwithstanding minor differences in clinically inactive components with no clinically meaningful differences between the biosimilar and the reference product in terms of safety, purity and potency, based upon data derived from (a) analytical studies that demonstrate that the biological product is highly similar to the reference product notwithstanding minor differences in clinically inactive components; (b) animal studies (including the assessment of toxicity); and/or (c) a clinical study or studies (including the assessment of immunogenicity and pharmacokinetics or pharmacodynamics) that are sufficient to demonstrate safety, purity, and potency in one or more appropriate conditions of use for which the reference product is licensed and intended to be used and for which licensure is sought for the biosimilar. The biosimilar may be an interchangeable product that may be substituted for the reference product at the pharmacy without the intervention of the prescribing healthcare professional. To meet the additional standard of “interchangeability,” the biosimilar is to be expected to produce the same clinical result as the reference product in any given patient and, if the biosimilar is administered more than once to an individual, the risk in terms of safety or diminished efficacy of alternating or switching between the use of the biosimilar and the reference product is not greater than the risk of using the reference product without such alternation or switch. The biosimilar utilizes the same mechanisms of action for the proposed conditions of use to the extent the mechanisms are known for the reference product. The condition or conditions of use prescribed, recommended, or suggested in the labeling proposed for the biosimilar have been previously approved for the reference product. The route of administration, the dosage form, and/or the strength of the biosimilar are the same as those of the reference product and the biosimilar is manufactured, processed, packed or held in a facility that meets standards designed to assure that the biosimilar continues to be safe, pure and potent. The biosimilar may include minor modifications in the amino acid sequence when compared to the reference product, such as N- or C-terminal truncations that are not expected to change the biosimilar performance. Biosimilars of the disclosed proteins and fusion proteins are included within the scope of this disclosure.
[0060] The term “subject” as used herein is intended to mean any animal, in particular, mammals. Although induction of an immune response in mice is exemplified herein, any type of mammal can be treated using the disclosed methods. Thus, the methods are applicable to human and nonhuman animals, although preferably used with mice and humans, and most preferably with humans.
[0061] The term “comprising” is intended to include examples encompassed by the terms “consisting essentially of” and “consisting of”; similarly, the term “consisting essentially of” is intended to include examples encompassed by the term “consisting of.”
[0062] The following abbreviations are used herein: hepatitis B virus (HBV); adenovirus (Ad); herpes simplex virus (HSV); glycoprotein (gD); and virus genomes (vg).
[0063] Provided herein is a non-naturally occurring variant of the hepatitis B virus (HBV) Core protein. The disclosed HBV Core protein can comprise the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof. Exemplary immunogenic fragments of SEQ ID NO: 6 include SEQ ID NOs: 20-54 provided in Table 3, below. In some embodiments, the immunogenic fragment of the HBV Core protein comprises the amino acid sequence of SEQ ID NO: 180. In some embodiments, the immunogenic fragment of the HBV Core protein comprises the amino acid sequence of SEQ ID NO: 183.
[0064] Nucleic acid molecules encoding the HBV Core protein or an immunogenic fragment thereof are also provided. The nucleic acid molecule can encode the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6. In some embodiments, the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 7. The nucleic acid molecules can encode the Core fragments provided in Table 3. In some embodiments, the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 180. In some embodiments, the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 183.
[0065] Vectors comprising the nucleic acid molecules encoding the HBV Core protein or an immunogenic fragment thereof are also provided. Suitable vectors include viral vectors, such as lentiviral vectors, retroviral vectors, adenoviral vectors, adeno-associated viral vectors, alphavirus replicons, herpes virus vectors, pox virus vectors, and rhabdovirus vectors. In some embodiments, the viral vector is an adenoviral vector. The adenoviral vector can be a chimpanzee-derived adenoviral vector. In some aspects, the vector is an AdC68 vector as described in Farina S F, Gao G P, Xiang Z Q, Rux J J, Burnett R M, Alvira M R, Marsh J, Ertl H C, Wilson J M. “Replication-defective vector based on a chimpanzee adenovirus.” J Virol. 2001 December; 75(23):11603-13. In some aspects, the vector is an AdC7 vector as described in Reyes-Sandoval A, Fitzgerald J C, Grant R, Roy S, Xiang Z Q, Li Y, Gao G P, Wilson J M, Ertl H C. “Human immunodeficiency virus type 1-specific immune responses in primates upon sequential immunization with adenoviral vaccine carriers of human and simian serotypes” J Virol. 2004 July; 78(14):7392-9. In some aspects, the vector is an AdC6 vector as described in Pinto A R, Fitzgerald J C, Giles-Davis W, Gao G P, Wilson J M, Ertl H C. “Induction of CD8+ T cells to an HIV-1 antigen through a prime boost regimen with heterologous E1-deleted adenoviral vaccine carriers” J Immunol. 2003 Dec. 15; 171(12):6774-9.
[0066] In some embodiments, the vector comprises the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7. In some embodiments, the vector is an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7. In some embodiments, the vector is an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7.
[0067] In some embodiments, the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 180. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 183. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector.
[0068] Vaccines comprising the vectors comprising the nucleic acid molecules encoding the HBV Core protein or an immunogenic fragment thereof are also disclosed. In some embodiments, the vaccine comprises a vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7. In some embodiments, the vaccine comprises an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7. In some embodiments, the vaccine comprises an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7. In some embodiments, the vaccine comprises an AdC6 vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 180. In some embodiments, the vaccine comprises an AdC7 vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 180. In some embodiments, the vaccine comprises an AdC6 vector that comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 183. In some embodiments, the vaccine comprises an AdC7 vector that comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 183.
[0069] The vaccine can further comprise a pharmaceutically acceptable carrier or pharmaceutical acceptable excipient. As used herein, “pharmaceutically acceptable carrier” or “pharmaceutical acceptable excipient” includes any material which, when combined with the disclosed fusion proteins, nucleic acids, or vectors, allows the fusion proteins, nucleic acids, or vectors to retain biological activity and is non-reactive with the subject's immune system. Examples include, but are not limited to, any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, water, emulsions such as oil/water emulsion, and various types of wetting agents. Preferred diluents for aerosol or parenteral administration are phosphate buffered saline or normal (0.9%) saline. Compositions comprising such carriers are formulated by well-known conventional methods (see, for example, Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro, ed., Mack Publishing Co., Easton, Pa., 1990; and Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing, 2000).
[0070] Also disclosed herein are non-naturally occurring variants of the HBV polymerase N-terminal domain (PolN) and the HBV polymerase C-terminal domain (PolC). The disclosed HBV polymerase N-terminal domain can comprise the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof. Exemplary immunogenic fragments of SEQ ID NO: 8 include SEQ ID NOs: 55-113 provided in Table 4, below. In some embodiments, the immunogenic fragment of the HBV PolN comprises the amino acid sequence of SEQ ID NO: 178. In some embodiments, the immunogenic fragment of the HBV PolN comprises the amino acid sequence of SEQ ID NO: 181. The disclosed HBV polymerase C-terminal domain can comprise the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof. Exemplary immunogenic fragments of SEQ ID NO: 10 include SEQ ID NOs: 114-172 provided in Table 5, below. In some embodiments, the immunogenic fragment of the HBV PolC comprises the amino acid sequence of SEQ ID NO: 179. In some embodiments, the immunogenic fragment of the HBV PolC comprises the amino acid sequence of SEQ ID NO: 182.
[0071] Nucleic acid molecules encoding the HBV polymerase N-terminal domain or an immunogenic fragment thereof, or the HBV polymerase C-terminal domain or an immunogenic fragment thereof, are also provided. The nucleic acid molecule can encode the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8. In some embodiments, the nucleic acid molecule encoding the HBV polymerase N-terminal domain comprises the nucleotide sequence of SEQ ID NO: 9. The nucleic acid molecules can encode the HBV polymerase N-terminal domain fragments provided in Table 4. The nucleic acid molecule can encode the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10. In some embodiments, the nucleic acid molecule encoding the HBV polymerase C-terminal domain comprises the nucleotide sequence of SEQ ID NO: 11. The nucleic acid molecules can encode the HBV polymerase C-terminal domain fragments provided in Table 5. In some embodiments, the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 178. In some embodiments, the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 181. In some embodiments, the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 179. In some embodiments, the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 182.
[0072] Vectors comprising the nucleic acid molecules encoding the HBV polymerase N-terminal domain or an immunogenic fragment thereof or C-terminal domain or an immunogenic fragment thereof are also provided. Suitable vectors include those described above. In some embodiments, the vector comprises the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9. In some embodiments, the vector comprises the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11. In some aspects, the vector is an adenoviral vector. Suitable adenoviral vectors include, for example, an AdC6 vector or AdC7 vector. In some embodiments, the vector is an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9. In some embodiments, the vector is an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9. In some embodiments, the vector is an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11. In some embodiments, the vector is an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11. In some embodiments, the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 178. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 181. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 179. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 182. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector.
[0073] Vaccines comprising the vectors comprising the nucleic acid molecules encoding the HBV polymerase N-terminal domain or an immunogenic fragment thereof or HBV polymerase C-terminal domain or an immunogenic fragment thereof are also disclosed. In some embodiments, the vaccine comprises a vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9. The vaccine can comprise an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9. The vaccine can comprise an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9. In some embodiments, the vaccine comprises a vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11. The vaccine can comprise an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11. The vaccine can comprise an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11. The vaccine can further comprise a pharmaceutically acceptable carrier or pharmaceutical acceptable excipient as disclosed above. In some embodiments, the vaccine comprises a vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 178. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vaccine comprises a vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 181. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vaccine comprises a vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 179. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vaccine comprises a vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 182. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector.
[0074] Fusion proteins comprising combinations of the disclosed HBV Core protein or immunogenic fragments thereof, the HBV polymerase N-terminal domain or immunogenic fragments thereof, and/or the HBV polymerase C-terminal domain or immunogenic fragments thereof are also provided herein. For example, the fusion protein can comprise: [0075] (1) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof; [0076] (2) one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 and one or more immunogenic fragments of the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8. For example, one or more of SEQ ID NOs: 20-54 provided in Table 3 (immunogenic fragments of SEQ ID NO: 6) and one or more of SEQ ID NOs: 55-113 provided in Table 4 (immunogenic fragments of SEQ ID NO: 8); [0077] (3) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; [0078] (4) one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 and one or more immunogenic fragments of the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10. For example, one or more of SEQ ID NOs: 20-54 provided in Table 3 (immunogenic fragments of SEQ ID NO: 6) and one or more of SEQ ID NOs: 114-172 provided in Table 5 (immunogenic fragments of SEQ ID NO: 10); [0079] (5) an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; [0080] (6) one or more immunogenic fragments of the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 and one or more immunogenic fragments of the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10. For example, one or more of SEQ ID NOs: 55-113 provided in Table 4 (immunogenic fragments of SEQ ID NO: 8) and one or more of SEQ ID NOs: 114-172 provided in Table 5 (immunogenic fragments of SEQ ID NO: 10); [0081] (7) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof, an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof, and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; [0082] (8) one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6, one or more immunogenic fragments of the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8, and one or more immunogenic fragments of the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10. For example, one or more of SEQ ID NOs: 20-54 provided in Table 3 (immunogenic fragments of SEQ ID NO: 6), one or more of SEQ ID NOs: 55-113 provided in Table 4 (immunogenic fragments of SEQ ID NO: 8), and one or more of SEQ ID NOs: 114-172 provided in Table 5 (immunogenic fragments of SEQ ID NO: 10); [0083] (9) An HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof; or [0084] (10) An HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof.
[0085] The fusion protein can comprise an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof. In some embodiments, the fusion protein comprises the amino acid sequence of SEQ ID NO: 174.
[0086] The fusion protein can comprise an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof. In some embodiments, the fusion protein comprises the amino acid sequence of SEQ ID NO: 175.
[0087] Also provided herein are fusion proteins comprising a herpes simplex virus (HSV) glycoprotein (gD) sequence and the disclosed HBV Core protein, the HBV polymerase N-terminal domain, the HBV polymerase C-terminal domain, or various combinations thereof.
[0088] The HSV gD is a receptor-binding glycoprotein of HSV. The gD ectodomain is organized in two structurally and functionally differentiated regions: the amino-terminus, which includes the signal sequence and receptor-binding sites; and the carboxy-terminus, which includes the pro-fusion domain and the transmembrane domain. gD interacts with the herpesvirus entry mediator (HVEM) receptor and the nectin receptors. Interaction of gD with the receptors results in the down-regulation of the HVEM receptors binding to BTLA or CD160, which are immunoinhibitory molecules that are expressed on T cells. In some embodiments, the disclosed fusion proteins comprising gD and the disclosed HBV Core protein, the HBV polymerase N-terminal domain, the HBV polymerase C-terminal domain (referred to as “gDCore,” “gDPolN” or “gDPolC,” respectively), or combinations thereof are expected to enhance a subject's immune response against HBV to a greater extent compared to the HBV Core and/or polymerase antigens alone (i.e. without gD).
[0089] Suitable HSV gD proteins for use in the disclosed fusion proteins include wild-type or mutant gD that retains the ability to: 1) augment stimulation of a CD8+ T cell response to an antigen; and/or 2) disrupt an HVEM-BTLA pathway activity.
[0090] The fusion proteins can comprise the HBV Core protein or an immunogenic fragment thereof, HBV polymerase N-terminal domain or an immunogenic fragment thereof, HBV polymerase C-terminal domain or an immunogenic fragment thereof disclosed herein, or any combination thereof, an N-terminal HSV gD protein sequence, and a C-terminal HSV gD protein sequence. The HBV Core protein, HBV polymerase N-terminal domain, and HBV polymerase C-terminal domain can be those provided in Table 9 or the immunogenic fragments provided in Tables 3-5. The HBV Core protein, HBV polymerase N-terminal domain, HBV polymerase C-terminal domain, or immunogenic fragments thereof can be inserted between the N-terminal HSV gD protein sequence and the C-terminal HSV gD protein sequence. In some aspects, the N-terminal HSV gD protein sequence comprises the amino acid sequence of SEQ ID NO: 12 and the C-terminal HSV gD protein sequence comprises the amino acid sequence of SEQ ID NO: 13. In some embodiments, the N-terminal HSV gD protein sequence comprises amino acid residues 26-269 of SEQ ID NO: 12.
[0091] The fusion protein can comprise: [0092] an N-terminal HSV gD sequence or a variant thereof; [0093] an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof; and [0094] a C-terminal HSV gD sequence or a variant thereof.
[0095] The immunogenic fragment of the HBV Core protein can comprise any one of SEQ ID NOs: 20-54, 180, or 183.
[0096] The fusion protein can comprise: [0097] an N-terminal HSV gD sequence or a variant thereof; [0098] an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or SEQ ID NO: 183; and [0099] a C-terminal HSV gD sequence or a variant thereof.
[0100] The fusion protein can comprise: [0101] an N-terminal HSV gD sequence or a variant thereof; [0102] an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof; and [0103] a C-terminal HSV gD protein sequence or a variant thereof.
[0104] The immunogenic fragment of the HBV polymerase N-terminal domain can comprise any one of SEQ ID NOs: 55-113, 178, or 181.
[0105] The fusion protein can comprise: [0106] an N-terminal HSV gD sequence or a variant thereof; [0107] an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or SEQ ID NO: 181; and [0108] a C-terminal HSV gD protein sequence or a variant thereof.
[0109] The fusion protein can comprise: [0110] an N-terminal HSV gD sequence or a variant thereof; [0111] an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; and [0112] a C-terminal HSV gD protein sequence or a variant thereof.
[0113] The immunogenic fragment of the HBV polymerase C-terminal domain can comprise any one of SEQ ID NOs: 114-172, 179, or 182.
[0114] The fusion protein can comprise: [0115] an N-terminal HSV gD sequence or a variant thereof; [0116] an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or SEQ ID NO: 182; and [0117] a C-terminal HSV gD protein sequence or a variant thereof.
[0118] The fusion protein can comprise: [0119] an N-terminal HSV gD sequence or a variant thereof; [0120] an HBV sequence comprising: [0121] (1) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof; [0122] (2) one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 and one or more immunogenic fragments of the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8. For example, one or more of SEQ ID NOs: 20-54 provided in Table 3 (immunogenic fragments of SEQ ID NO: 6) and one or more of SEQ ID NOs: 55-113 provided in Table 4 (immunogenic fragments of SEQ ID NO: 8); [0123] (3) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; [0124] (4) one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 and one or more immunogenic fragments of the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10. For example, one or more of SEQ ID NOs: 20-54 provided in Table 3 (immunogenic fragments of SEQ ID NO: 6) and one or more of SEQ ID NOs: 114-172 provided in Table 5 (immunogenic fragments of SEQ ID NO: 10); [0125] (5) an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; [0126] (6) one or more immunogenic fragments of the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 and one or more immunogenic fragments of the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10. For example, one or more of SEQ ID NOs: 55-113 provided in Table 4 (immunogenic fragments of SEQ ID NO: 8) and one or more of SEQ ID NOs: 114-172 provided in Table 5 (immunogenic fragments of SEQ ID NO: 10); [0127] (7) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof, an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof, and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; or [0128] (8) one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6, one or more immunogenic fragments of the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8, and one or more immunogenic fragments of the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10. For example, one or more of SEQ ID NOs: 20-54 provided in Table 3 (immunogenic fragments of SEQ ID NO: 6), one or more of SEQ ID NOs: 55-113 provided in Table 4 (immunogenic fragments of SEQ ID NO: 8), and one or more of SEQ ID NOs: 114-172 provided in Table 5 (immunogenic fragments of SEQ ID NO: 10); [0129] (9) an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof; or [0130] (10) an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof. and [0131] a C-terminal HSV gD protein sequence or a variant thereof.
[0132] In some embodiments, the N-terminal HSV gD sequence can comprise at least amino acids 1-269 of HSV gD. The N-terminal HSV gD sequence, for example, can comprise the amino acid sequence of SEQ ID NO: 12. In some embodiments, the N-terminal HSV gD sequence comprises amino acid residues 26-269 of SEQ ID NO: 12.
[0133] In some embodiments, the C-terminal HSV gD sequence comprises the transmembrane domain of the HSV gD. The C-terminal HSV gD sequence, for example, can comprise the amino acid sequence of SEQ ID NO: 13.
[0134] The fusion protein can comprise the amino acid sequence of SEQ ID NO: 14 (corresponding to gDCore) or an immunogenic fragment thereof. The fusion protein can comprise the amino acid sequence of SEQ ID NO: 16 (corresponding to gDPolN) or an immunogenic fragment thereof. The fusion protein can comprise the amino acid sequence of SEQ ID NO: 18 (corresponding to gDPolC) or an immunogenic fragment thereof. In some embodiments, the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or the immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide.
[0135] The fusion protein can comprise the amino acid sequence of SEQ ID NO: 185 (gDHBV2). The fusion protein can comprise the amino acid sequence of SEQ ID NO: 187 (gDHBV3).
[0136] Nucleic acid molecules encoding any of the disclosed fusion proteins are also provided. In some embodiments, the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 15 (corresponding to gDCore). In some embodiments, the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 17 (corresponding to gDPolN). In some embodiments, the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 19 (corresponding to gDPolC).
[0137] The nucleic acid molecule can comprise the nucleotide sequence of SEQ ID NO: 184 (gDHBV2). The nucleic acid molecule can comprise the nucleotide sequence of SEQ ID NO: 186 (gDHBV3).
[0138] Vectors comprising the nucleic acid molecules encoding the fusion proteins are also disclosed. Suitable vectors include those described above including, for example, an adenoviral vector. In some embodiments, the adenoviral vector is an AdC6 vector. In some embodiments, the adenoviral vector is an AdC7 vector. The vector can comprise the nucleotide sequence of SEQ ID NO: 184 (gDHBV2). In some aspects, the vector is an AdC6 vector that comprises the nucleotide sequence of SEQ ID NO: 184 (gDHBV2). In some aspects, the vector is an AdC7 vector that comprises the nucleotide sequence of SEQ ID NO: 184 (gDHBV2). The vector can comprise the nucleotide sequence of SEQ ID NO: 186 (gDHBV3). In some aspects, the vector is an AdC6 vector that comprises the nucleotide sequence of SEQ ID NO: 186 (gDHBV3). In some aspects, the vector is an AdC7 vector that comprises the nucleotide sequence of SEQ ID NO: 186 (gDHBV3).
[0139] Vaccines comprising any of the disclosed vectors are also provided. The vaccine can further comprise a pharmaceutically acceptable carrier or pharmaceutical acceptable excipient as disclosed above. The vaccine can comprise a vector comprising the nucleotide sequence of SEQ ID NO: 184 (gDHBV2). In some aspects, the vaccine comprises an AdC6 vector that comprises the nucleotide sequence of SEQ ID NO: 184 (gDHBV2). In some aspects, the vaccine comprises an AdC7 vector that comprises the nucleotide sequence of SEQ ID NO: 184 (gDHBV2). The vaccine can comprise a vector that comprises the nucleotide sequence of SEQ ID NO: 186 (gDHBV3). In some aspects, the vaccine comprises an AdC6 vector that comprises the nucleotide sequence of SEQ ID NO: 186 (gDHBV3). In some aspects, the vaccine comprises an AdC7 vector that comprises the nucleotide sequence of SEQ ID NO: 186 (gDHBV3).
[0140] Provided herein are methods of inducing an immune response to HBV in a subject, the methods comprising providing to the subject an effective amount of any of the disclosed fusion proteins, any of the disclosed nucleic acid molecules, any of the disclosed vectors, or any of the disclosed vaccines to thereby induce an immune response to HBV. In some embodiments, the methods comprise providing to the subject an effective amount of any of the disclosed fusion proteins to thereby induce an immune response to HBV. In some embodiments, the methods comprise providing to the subject an effective amount of any of the disclosed nucleic acid molecules to thereby induce an immune response to HBV. In some embodiments, the methods comprise providing to the subject an effective amount of any of the disclosed vectors to thereby induce an immune response to HBV. In some embodiments, the methods comprise providing to the subject an effective amount of any of the disclosed vaccines to thereby induce an immune response to HBV.
[0141] The methods can comprise providing to the subject an effective amount of a vaccine comprising an AdC6 vector, wherein the AdC6 vector comprises a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof. In some embodiments, the methods further comprise providing to the subject, subsequent to providing the vaccine comprising the AdC6 vector, a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof. Such prime-boost methods can comprise: [0142] Providing to the subject a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 14, or an immunogenic fragment thereof, and subsequently providing to the subject a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 14, or an immunogenic fragment thereof. In some embodiments, the amino acid sequence of SEQ ID NO: 14, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide; [0143] Providing to the subject a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 16, or an immunogenic fragment thereof, and subsequently providing to the subject a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 16, or an immunogenic fragment thereof. In some embodiments, the amino acid sequence of SEQ ID NO: 16, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide; or [0144] Providing to the subject a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 18, or an immunogenic fragment thereof, and subsequently providing to the subject a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 18, or an immunogenic fragment thereof. In some embodiments, the amino acid sequence of SEQ ID NO: 18, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide.
[0145] The methods can comprise providing to the subject an effective amount of a vaccine comprising an AdC7 vector, wherein the AdC7 vector comprises a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof. In some embodiments, the methods further comprise providing to the subject, subsequent to providing the vaccine comprising the AdC7 vector, a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof. Such prime-boost methods can comprise: [0146] Providing to the subject a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 14, or an immunogenic fragment thereof, and subsequently providing to the subject a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 14, or an immunogenic fragment thereof. In some embodiments, the amino acid sequence of SEQ ID NO: 14, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide; [0147] Providing to the subject a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 16, or an immunogenic fragment thereof, and subsequently providing to the subject a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 16, or an immunogenic fragment thereof. In some embodiments, the amino acid sequence of SEQ ID NO: 16, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide; or [0148] Providing to the subject a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 18, or an immunogenic fragment thereof, and subsequently providing to the subject a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 18, or an immunogenic fragment thereof. In some embodiments, the amino acid sequence of SEQ ID NO: 18, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide.
[0149] The methods can comprise providing to the subject an effective amount of a vaccine comprising an AdC6 vector, wherein the AdC6 vector comprises a fusion protein comprising the amino acid sequence of SEQ ID NO: 185 or 187, or an immunogenic fragment thereof. In some embodiments, the methods further comprise providing to the subject, subsequent to providing the vaccine comprising the AdC6 vector, a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185 or 187, or an immunogenic fragment thereof. Such prime-boost methods can comprise: [0150] Providing to the subject a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185, or an immunogenic fragment thereof, and subsequently providing to the subject a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185, or an immunogenic fragment thereof. In some embodiments, the amino acid sequence of SEQ ID NO: 185, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide; or [0151] Providing to the subject a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187, or an immunogenic fragment thereof, and subsequently providing to the subject a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187, or an immunogenic fragment thereof. In some embodiments, the amino acid sequence of SEQ ID NO: 187, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide.
[0152] The methods can comprise providing to the subject an effective amount of a vaccine comprising an AdC7 vector, wherein the AdC7 vector comprises a fusion protein comprising the amino acid sequence of SEQ ID NO: 185 or 187, or an immunogenic fragment thereof. In some embodiments, the methods further comprise providing to the subject, subsequent to providing the vaccine comprising the AdC7 vector, a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185 or 187, or an immunogenic fragment thereof. Such prime-boost methods can comprise: [0153] Providing to the subject a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185, or an immunogenic fragment thereof, and subsequently providing to the subject a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185, or an immunogenic fragment thereof. In some embodiments, the amino acid sequence of SEQ ID NO: 185, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide; or [0154] Providing to the subject a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187, or an immunogenic fragment thereof, and subsequently providing to the subject a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187, or an immunogenic fragment thereof. In some embodiments, the amino acid sequence of SEQ ID NO: 187, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide.
[0155] The immune response induced by the disclosed methods include, but is not limited to, T cell responses, B cell responses, or both (i.e. cellular and/or humoral immune responses). The immune response can be a primary immune response or a secondary immune response. The disclosed methods can induce a subject's immune response against HBV to a greater extent compared to the HBV Core or polymerase antigens alone (i.e. without gD).
[0156] The disclosed methods can be used for both therapeutic treatment and prophylactic or preventative measures and can reduce the severity and/or frequency of symptoms, eliminate symptoms and/or the underlying cause of the symptoms, reduce the frequency or likelihood of symptoms and/or their underlying cause, and improve or remediate damage caused, directly or indirectly, by HBV. Treatment also includes prolonging survival as compared to the expected survival of a subject not receiving treatment. Subjects to be treated include those that have HBV as well as those prone to have HBV or those in which HBV is to be prevented.
[0157] The amount of the disclosed fusion proteins, nucleic acid molecules, vectors, or vaccines needed to thereby induce an immune response to HBV (e.g. a “effective amount”) may vary according to factors such as the disease state, age, sex, and weight of the subject, and the ability of the fusion proteins, nucleic acid molecules, vectors, or vaccines to cause a desired response in the subject. Exemplary indicators of an effective amount include, for example, improved well-being of the subject and reduction, elimination, or prevention of HBV symptoms.
[0158] Also provided is the use of any of the disclosed fusion proteins, nucleic acid molecules, vectors, or vaccines in the manufacture of a medicament for inducing an immune response to HBV in a subject.
[0159] The disclosed fusion proteins, nucleic acid molecules, vectors, or vaccines for use in inducing an immune response to HBV in a subject is also provided.
Examples
[0160] The following examples are provided to further describe some of the embodiments disclosed herein. The examples are intended to illustrate, not to limit, the disclosed embodiments.
Generation of an Epitope-Optimized Core Sequence
[0161] Hepatitis B virus (HBV) can be grouped into several genotypes, based on phylogenic clustering. To assist in the development of an antigen insert for a multi-genotype HBV vaccine for patients with chronic infections, a preliminary bioinformatics evaluation of the genes encoding the HBV Core and HBV polymerase across genotypes A, B, C and D was conducted.
[0162] The Core amino acid sequences from the four major HBV clades were downloaded as aligned ClustalW sequences from Hepatitis B Virus database (HBVdb) (release version 45.0; last updated on Aug. 2, 2018). The amino acid sequences represented thousands of HBV genomes inputted from users across Europe, as summarized in the following table.
TABLE-US-00001 TABLE 1 Number of unique Core genomes analyzed Genotype HBV Gene Unique Genomes Analyzed HBV genotype A Core 1,482 HBV genotype B 2,800 HBV genotype C 2,768 HBV genotype D 1,579
[0163] “Consensus” Core sequences were first identified for each genotype using the Shannon Entropy tool hosted by the Los Alamos National Laboratory (www.hiv.lanl.gov/content/sequence/ENTROPY/entropy), which calculated the variation and frequency at each amino acid position. These calculations were repeated for each genotype, generating four “consensus” Core sequences, one for each genotype analyzed (SEQ ID NOs: 1-4):
TABLE-US-00002 Genotype A Consensus (SEQ ID NO: 1) MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP HHTALRQAILCWGELMTLATWVGNNLeDPASRDLVVNYVNTNMGLKIRQL LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR RRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC- Genotype B Consensus (SEQ ID NO: 2) MDIDpYKEFGASvELLSFLPSDFFPSiRDLLDTAsALYREALESPEHCSP HHTALRQAIlCWGELMNLATWVGSNLeDPASRELVVsYVNVNMGLKiRQL LWFHISCLTFGRETVLEYLVSFGVWIRTPpAYRPpNAPILSTLPETTVVR RRGRSPRRRTPSPRRRRSQSPRRRRSQSREsQC- Genotype C Consensus (SEQ ID NO: 3) MDIDpYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVsYVNVNMGLKiRQl LWFHISCLTFGRETVLEYLVSFGVWIRTPpAYRPPNAPILSTLPETTVVR RRGRSPRRRTPSPRRRRSQSPRRRSQSRESQC - Genotype D Consensus (SEQ ID NO: 4) MDIDPYKEFGAtVELLSFLPsDFFPSVRDLLDTASALYReALESPEHCSP HHTALRQAILCWGeLMtLATWVGgNLEDPaSRDLVVSYVNTNmGLKFRQL LWFHISCLTFGReTViEYLVSFGVWIRTPpAYRPPNAPILSTLPETTVvR RRGRSPRRRTPSPRRRTSQSPRRRRSQSRESQC- (Bold, underlined residues represent amino acids having less than 90% frequency).
[0164] The above “consensus” Core sequences were combined to generate an epitope-optimized Core sequence. Conserved amino acids were identified at each amino acid residue of the Core protein from each genotype (A, B, C and D) and the frequency and variation within a given sample of genotype genomes was determined. To select amino acids at sites of variation, each variation was tested using epitope prediction algorithms across multiple HLA types and the most immunogenic sequence was selected. Specifically: [0165] (1) Each residue across the four genotypes that was identical were maintained. The genome weighted frequency was also calculated to inform the variability with spacer added, where applicable, to align the sequences for diversity. [0166] (2) Residues that were not identical across the four genotypes were identified and the amino acid diversity was recorded (see Table 2). The initial Core sequence (SEQ ID NO: 5) is provided below, with the residues that were not identical across the four genotypes labeled as X.sub.1-X.sub.11 and the residues having less than 90% frequency in bold, underlined font:
TABLE-US-00003 MDIDPYKEFGA VELLSFLPSDFFPS
DLLDTASALYREALESPEHCS PHHTALRQAILCWGELM
LATWVG
NLeDPASR
LVV
YVN
NMGLK
RQLLWFHISCLTFGRETV
EYLVSFGVWIRTPPAYRPPNAPI LSTLPETTVVRRR
GRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
TABLE-US-00004 TABLE 2 Residues that were not identical across the four genotypes Residue # X.sub.1 X.sub.2 X.sub.3 X.sub.4 X.sub.5 X.sub.6 X.sub.7 X.sub.8 X.sub.9 X.sub.10 X.sub.11 Genotype A T V T N D N T I L D R Consensus A-Consensus 95.4% 98.2% 96.0% 94.0% 99.5% 98.9% 98.3% 98.8% 98.2% 95.8% 99.5% Frequency Genotype B S i N S E s V i L — — Consensus B-Consensus 97.1% 89.7% 93.5% 90.1% 91.5% 75.2% 93.6% 80.1% 99.4% — — Frequency Genotype C S I N S E s V i L — — Consensus C-Consensus 99.4% 90.3% 97.3% 96.3% 97.0% 83.7% 97.8% 78.7% 98.8% — — Frequency Genotype D t V t g D S T F i — — Consensus D-Consensus 75.7% 97.0% 87.5% 58.7% 98.4% 93.7% 96.5% 99.1% 77.8% — — Frequency [0167] (3) To determine the final amino acid at these positions, epitope prediction algorithms were used to select the appropriate amino acid. For amino acids that showed variability between the genotypes, amino acids that were present in 3 of the genotypes were selected or an MHC class I epitope prediction software was used to select the most immunogenic amino acids. This approach maximized the potential immunogenicity across the greatest number of HLA types. The epitope-optimized Core sequence across all genotypes and within genotypes is shown below (SEQ ID NO: 6):
TABLE-US-00005 DIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH HTALRQAILCWGELMTLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLL WFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRR RDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
[0168] The average variation at each site across all genomes, weighted by the number of clade-specific genomes analyzed, was calculated and showed areas and residues of higher and greater conservation.
Generation of Epitope-Optimized Polymerase Sequences
[0169] An epitope-optimized polymerase sequence was generated from the four major HBV clades as discussed above for the Core sequence. Because the polymerase is long, two fragments—an N-terminal fragment (from which a highly variable segment between the genotypes was removed) and a C-terminal fragment—were generated. Both fragments are approximately 300 amino acids in length. The epitope-optimized polymerase amino acid sequences are shown below and in Table 9:
TABLE-US-00006 Epitope-optimized HBV polymerase N-terminal amino acid sequence (SEQ ID NO: 8): PLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIP WTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIVDRCKQFVGPLTV NEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTL WKAGILYKRETTRSASFCGSPYSWEQELQHGSCWWLQFRNSKPCSEYCLT HLVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVV DFSQFSRGITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLH PAAMP Epitope-optimized HBV polymerase C-terminal amino acid sequence (SEQ ID NO: 10): HLLVGSSGLSRYVARLSSNSRIINHQHGTMQNLHDSCSRNLYVSLLLLYK TFGRKLHLYSHPIILKTKRWGYSLNFMGYVIGSWGSLPQDHIIQKIKECF RKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYACIQSKQAFTF SPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTF VAPLPIHTAELLAACFARSRSGAKILGTDNSVVLSRKYTSFPWLLGCAAN WILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRTSLYAVS PSV
Generation of AdC6 and AdC7 Vectors Expressing the Epitope-Optimized Core and Polymerase Sequences
[0170] The genes encoding the epitope-optimized Core or polymerase amino acid sequences were cloned into transfer vectors that contained the herpes simplex virus (HSV) glycoprotein D (gD) sequence under the control of the CMV promoter. The genes were then cloned into the E1-deleted, E3 ORF 3, 4, 5, 6, and 7-deleted replication deficient adenoviral vector (as described in PCT/US2017/043315) to generate the following vectors: [0171] AdC6 containing the epitope-optimized Core sequence fused to gD (AdC6-gDCore); [0172] AdC6 containing the epitope-optimized polymerase N-terminal sequence fused to gD (AdC6-gDPolN); [0173] AdC6 containing the epitope-optimized polymerase C-terminal sequence fused to gD (AdC6-gDPolC); [0174] AdC7 containing the epitope-optimized Core sequence fused to gD (AdC7-gDCore); [0175] AdC7 containing the epitope-optimized polymerase N-terminal sequence fused to gD (AdC7-gDPolN); and [0176] AdC7 containing the epitope-optimized polymerase C-terminal sequence fused to gD (AdC7-gDPolC).
[0177] Correct clones were identified by restriction enzyme digest and the cloning sites were sequenced. Vectors were rescued and expanded in HEK 293 cells, purified by cesium chloride (CsCl) gradient centrifugation, and the vector concentration (vp) was determined by spectrophotometry. Vectors were titrated for infectious units upon their expansion in serial dilutions in HEK 293 cells, followed by isolation and reverse transcription of RNA and a nested hexon-specific PCR reaction. Genetic integrity of the vectors was determined by restriction enzyme digest followed by gel electrophoresis of purified viral DNA. Protein expression was determined by Western blotting using gD-specific antibodies. Genetic stability was determined by serial passages (12-15) of the vectors in HEK 293 cells followed by restriction enzyme digest of purified viral DNA and gel electrophoresis.
Testing of Immunogenicity of Vaccines in Mice
[0178] C57Bl/6, BALB/c, and HLA-A2 tg mice (n=5 per group) were injected with various concentrations of each of the above vectors. Naïve mice served as controls. Mice were bled at different times after the injection and frequencies of insert-specific CD8+ and CD4+ T cells were determined by intracellular cytokine staining (ICS) for IFN-γ. Two months after the first injection, AdC6-immune mice were boosted with the heterologous vector (AdC7) expressing the same insert. Frequencies of HBV-specific T cells were tested again. Results after priming are shown in
[0179] C57Bl/6 mice showed a very robust CD8+ T cell response to the epitope-optimized polymerase N-terminal sequence and lower responses to the epitope-optimized polymerase C-terminal sequence and the epitope-optimized Core sequence, while CD4+ responses were better against the epitope-optimized Core sequence and the epitope-optimized polymerase C-terminal sequence (
TABLE-US-00007 TABLE 3 Epitope-Optimized Core Peptides SEQ ID Peptide Amino Acid Sequence NO: Prime 1 DIDPYKEFGATVELL 20 CD8 (B/c) 2 KEFGATVELLSFLPS 21 CD8 (B/c) 3 TVELLSFLPSDFFPS 22 CD8 (B/c) 4 SFLPSDFFPSIRDLL 23 CD8 (B/c) 5 DFFPSIRDLLDTASA 24 CD8 (B/c) 6 IRDLLDTASALYREA 25 7 DTASALYREALESPE 26 CD4 (B/c) 8 LYREALESPEHCSPH 27 CD4 (B1/6); CD4 (B/c) 9 LESPEHCSPHHTALR 28 CD4 (B/c) 10 HCSPHHTALRQAILC 29 CD4 (B/c) 11 HTALRQAILCWGELM 30 CD4 (B/c) 12 QAILCWGELMTLATW 31 13 WGELMTLATWVGSNL 32 CD8 (B/c); CD4 (B/c); CD8 (HLA) 14 TLATWVGSNLEDPAS 33 CD8 (B/c); CD4 (B/c) 15 VGSNLEDPASRELVV 34 CD8 (B/c); CD4 (B/c) 16 EDPASRELVVSYVNV 35 CD8 (B/c); CD4 (B/c) 17 RELVVSYVNVNMGLK 36 CD8 (B/c); CD4 (B/c) 18 SYVNVNMGLKIRQLL 37 19 NMGLKIRQLLWFHIS 38 CD4 (B/c) 20 IRQLLWFHISCLTFG 39 CD4 (B/c) 21 WFHISCLTFGRETVI 40 CD4 (B/c) 22 CLTFGRETVIEYLVS 41 CD4 (B/c) 23 RETVIEYLVSFGVWI 42 CD4 (B/c) 24 EYLVSFGVWIRTPPA 43 25 FGVWIRTPPAYRPPN 44 26 RTPPAYRPPNAPILS 45 CD8 (B1/6) 27 YRPPNAPILSTLPET 46 28 APILSTLPETTVVRR 47 CD4 (B1/6) 29 TLPETTVVRRRDRGR 48 CD8 (B1/6) 30 TVVRRRDRGRSPRRR 49 31 RDRGRSPRRRTPSPR 50 32 SPRRRTPSPRRRRSQ 51 33 TPSPRRRRSQSPRRR 52 34 RRRSQSPRRRRRSQSR 53 35 SPRRRRRSQSRESQC 54 B/c = BALB/c; B1/6 = C57B1/6; HLA = HLA-A2
TABLE-US-00008 TABLE 4 Epitope-Optimized PolN Peptides SEQ ID Peptide Amino Acid Sequence NO: Prime 1 PLSYQHFRKLLLLDE 55 2 HFRKLLLLDEEAGPL 56 3 LLLDEEAGPLEEELP 57 4 EAGPLEEELPRLADE 58 5 EEELPRLADEGLNRR 59 6 RLADEGLNRRVAEDL 60 7 GLNRRVAEDLNLGNL 61 8 VAEDLNLGNLNVSIP 62 9 NLGNLNVSIPWTHKV 63 10 NVSIPWTHKVGNFTG 64 CD4 (B/c) 11 WTHKVGNFTGLYSST 65 12 GNFTGLYSSTVPVFN 66 13 LYSSTVPVFNPEWQT 67 14 VPVFNPEWQTPSFPK 68 CD4 (B/c) 15 PEWQTPSFPKIHKLQE 69 16 PSFPKIHKLQEDIVDR 70 17 IHKLQEDIVDRCKQFV 71 18 EDIVDRCKQFVGPLTV 72 19 RCKQFVGPLTVNEKRR 73 20 VGPLTVNEKRRLKLIM 74 21 VNEKRRLKLIMPARFY 75 22 RLKLIMPARFYPNVTK 76 23 MPARFYPNVTKYLPLD 77 24 YPNVTKYLPLDKGIKP 78 25 KYLPLDKGIKPYYPEH 79 26 DKGIKPYYPEHAVNHY 80 27 PYYPEHAVNHYFQTRH 81 28 HAVNHYFQTRHYLHTL 82 29 YFQTRHYLHTLWKAGI 83 30 HYLHTLWKAGILYKRE 84 31 LWKAGILYKRETTRSA 85 32 ILYKRETTRSASFCGS 86 33 ETTRSASFCGSPYSWE 87 34 ASFCGSPYSWEQELQH 88 CD8 (B1/6); CD8 (B/c); CD8 (HLA) 35 SPYSWEQELQHGSCWW 89 CD8 (B1/6); CD8 (B/c); CD8 (HLA) 36 EQELQHGSCWWLQFRN 90 37 HGSCWWLQFRNSKPCS 91 CD8 (B1/6); CD8 (B/c); CD8 (HLA) 38 WLQFRNSKPCSEYCLT 92 CD8 (B1/6); CD8 (B/c); CD8 (HLA) 39 NSKPCSEYCLTHLVNL 93 CD8 (B1/6) 40 SEYCLTHLVNLLEDWG 94 CD8 (B1/6); CD8 (B/c); CD8 (HLA) 41 THLVNLLEDWGPCDEH 95 42 LLEDWGPCDEHGEHHI 96 43 GPCDEHGEHHIRIPRT 97 44 HGEHHIRIPRTPARVT 98 45 IRIPRTPARVTGGVFL 99 46 TPARVTGGVFLVDKNP 100 47 TGGVFLVDKNPHNTAE 101 48 LVDKNPHNTAESRLVV 102 49 PHNTAESRLVVDFSQF 103 50 ESRLVVDFSQFSRGIT 104 CD8 (B1/6); CD8 (B/c)′ CD8 (HLA) 51 VDFSQFSRGITRVSWP 105 CD8 (B1/6); CD8 (B/c); CD8 (HLA) 52 FSRGITRVSWPKFAVP 106 53 TRVSWPKFAVPNLQSL 107 CD8 (B1/6); CD8 (B/c); CD8 (HLA) 54 PKFAVPNLQSLTNLLS 108 CD8 (B1/6); CD8 (B/c); CD8 (HLA) 55 PNLQSLTNLLSSNLSW 109 CD8 (B1/6) 56 LTNLLSSNLSWLSLDV 110 CD8 (B1/6); CD8 (B/c); CD8 (HLA) 57 SSNLSWLSLDVSAAFY 111 58 WLSLDVSAAFYHIPLH 112 CD8 (B1/6); CD8 (B/c); CD8 (HLA) 59 VSAAFYHIPLHPAAMP 113 CD8 (B1/6); CD8 (B/c); CD8 (HLA) B/c = BALB/c; B1/6 = C57B1/6; HLA = HLA-A2
TABLE-US-00009 TABLE 5 Epitope-Optimized PolC Peptides SEQ Prime Amino Acid ID Peptide Sequence NO: 1 HLLVGSSGLSRYVAR 114 2 SSGLSRYVARLSSNSR 115 3 RYVARLSSNSRIINHQ 116 4 LSSNSRIINHQHGTMQ 117 5 RIINHQHGTMQNLHDS 118 6 QHGTMQNLHDSCSRNL 119 7 QNLHDSCSRNLYVSLL 120 8 SCSRNLYVSLLLLYKT 121 9 LYVSLLLLYKTFGRKL 122 10 LLLYKTFGRKLHLYSH 123 CD8 (HLA) 11 TFGRKLHLYSHPIILK 124 12 LHLYSHPIILKTKRWG 125 CD8 (B/c); CD8 (HLA) 13 HPIILKTKRWGYSLNF 126 CD8 (HLA) 14 KTKRWGYSLNFMGYVI 127 15 GYSLNFMGYVIGSWGS 128 CD8 (HLA) 16 FMGYVIGSWGSLPQDH 129 17 IGSWGSLPQDHIIQKI 130 18 SLPQDHIIQKIKECFR 131 19 HIIQKIKECFRKLPVN 132 20 IKECFRKLPVNRPIDW 133 21 RKLPVNRPIDWKVCQR 134 22 NRPIDWKVCQRIVGLL 135 23 WKVCQRIVGLLGFAAP 136 24 RIVGLLGFAAPFTQCG 137 25 LGFAAPFTQCGYPALM 138 26 PFTQCGYPALMPLYAC 139 CD8 (HLA) 27 GYPALMPLYACIQSKQ 140 28 MPLYACIQSKQAFTFS 141 CD8 (B/c); CD8 (HLA) 29 CIQSKQAFTFSPTYKA 142 CD8 (HLA) 30 QAFTFSPTYKAFLSKQ 143 31 SPTYKAFLSKQYLNLY 144 CD8 (B1/6); CD8 (HLA) 32 AFLSKQYLNLYPVARQ 145 CD8 (B1/6) 33 QYLNLYPVARQRPGLC 146 34 YPVARQRPGLCQVFAD 147 CD8 (HLA) 35 QRPGLCQVFADATPTG 148 CD4 (B/c) 36 CQVFADATPTGWGLAM 149 CD8 (B/c); CD8 (HLA) 37 DATPTGWGLAMGHQRM 150 CD8 (HLA) 38 GWGLAMGHQRMRGTFV 151 39 MGHQRMRGTFVAPLPI 152 CD4 (B/c); CD8 (HLA) 40 MRGTFVAPLPIHTAEL 153 41 VAPLPIHTAELLAACF 154 42 IHTAELLAACFARSRS 155 CD8 (HLA) 43 LLAACFARSRSGAKIL 156 44 FARSRSGAKILGTDNS 157 CD8 (B/c); CD8 (HLA) 45 SGAKILGTDNSVVLSR 158 CD8 (HLA) 46 LGTDNSVVLSRKYTSF 159 47 SVVLSRKYTSFPWLLG 160 48 RKYTSFPWLLGCAANW 161 CD8 (HLA) 49 FPWLLGCAANWILRGT 162 50 GCAANWILRGTSFVYV 163 51 WILRGTSFVYVPSALN 164 CD4 (B/c) 52 TSFVYVPSALNPADDP 165 53 VPSALNPADDPSRGRL 166 54 NPADDPSRGRLGLSRP 167 55 PSRGRLGLSRPLLRLP 168 CD4 (B/c) 56 LGLSRPLLRLPFRPTT 169 57 PLLRLPFRPTTGRTSL 170 58 PFRPTTGRTSLYAVSP 171 59 TGRTSLYAVSPSV 172 B/c = BALB/c; B1/6 = C57B1/6; HLA = HLA-A2
TABLE-US-00010 TABLE 6 Epitope-Optimized Core Pool Core Matrix A B C D E F G 1 2 3 4 5 6 H 7 8 9 10 11 12 I 13 14 15 16 17 18 J 19 20 21 22 23 24 K 25 26 27 28 29 30 L 31 32 33 34 35
TABLE-US-00011 TABLE 7 Epitope-Optimized PolN Pool Pol N Matrix A B C D E F G H I 1 2 3 4 5 6 7 8 J 9 10 11 12 13 14 15 16 K 17 18 19 20 21 22 23 24 L 25 26 27 28 29 30 31 32 M 33 34 35 36 37 38 39 40 N 41 42 43 44 45 46 47 48 O 49 50 51 52 53 54 55 56 P 57 58 59
TABLE-US-00012 TABLE 8 Epitope-Optimized PolC Pool Pol C Matrix A B C D E F G H I 1 2 3 4 5 6 7 8 J 9 10 11 12 13 14 15 16 K 17 18 19 20 21 22 23 24 L 25 26 27 28 29 30 31 32 M 33 34 35 36 37 38 39 40 N 41 42 43 44 45 46 47 48 O 49 50 51 52 53 54 55 56 P 57 58
[0180] After the boost, which was tested in C57Bl/6, BALB/c and HLA-A2 tg mice, increases in responses were mainly seen for inserts and at vector doses that upon priming induced suboptimal responses, i.e., for Core tested at the 1×10.sup.9 vp vector dose (
Immunogenicity Summary
[0181] The above results illustrate that: [0182] The vaccines are immunogenic: PolN>PolC>Core for CD8+ T cells; Core>PolC>PolN for CD4+ T cell responses; [0183] Immune responses can be boosted by a heterologous vaccine carrier; [0184] Immune responses are broad; and [0185] The breadth of the T cell responses increases after the boost.
Effect of Vaccination on HBV Titers Low Dose AAV-1.3HBV Challenge
[0186] A group of 3 mice were challenged with 1×10.sup.10, 1×10.sup.11 or 1.5×10.sup.11 vg of AAV-1.3HBV and were vaccinated with AdC6-gDPolN 8 weeks later. Viral titers were tested 8 weeks after vaccination and compared to pre-vaccination titers.
Epitope Shifting
[0187] CD8+ T cells to HBV antigens become exhausted during chronic HBV infections. Progression towards exhaustion is more rapid and pronounced for CD8+ T cells to dominant, as compared to subdominant, epitopes. The underlying reason is that exhaustion is driven by overwhelming antigen-driven stimulation through the T cell receptor; dominant epitopes are presented at higher levels on MHC class I antigens expressed by antigen presenting cells than subdominant epitopes with lower avidity to their restricting elements. Typical vaccine approaches primarily induce immune responses to dominant epitopes. Therapeutic vaccines should take into account loss of T cells to dominant epitopes during chronic virus infections and should be designed to favor expansion of CD8+ T cells to subdominant epitopes, which have a higher likelihood of resisting disease-driven exhaustion, translating to superior disease control.
[0188] The epitope profile in naïve mice immunized with an adenovirus vector comprising a nucleic acid sequence encoding the HBV polymerase N-terminal domain (PolN) fused to the herpes simplex virus glycoprotein D (“AdC6-gDPolN”, wherein the amino acid sequence of gDPolN is SEQ ID NO: 16) was determined. Responses in mice that had not been pre-treated with the AAV8-1.3HBV vector were compared to those obtained in mice infected with an AAV8 vector expressing the 1.3HBV genome prior to vaccination with the AdC6-gDPolN. The AAV8-1.3HBV vector induced high titers of HBV in serum, which could drive CD8+ T cell exhaustion.
[0189] In the first series of experiments a peptide pool matrix was used to identify epitopes in mice vaccinated with the AdC6-gDPolN vector, but not challenged with an AAV-1.3HBV vector. A number of regions in these naïve mice were identified that elicited potent responses (e.g. greater than 1% IFN-γ production CD8+CD44+ T cells.
[0190] Based on these data, a new HBV polymerase N-terminal domain insert (HBV PolN v2) was generated (SEQ ID NO: 173):
TABLE-US-00013 HFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLPEWQTPSFPK IHLQEDIVDRCKQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKP YYPEHAVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEQELQH GSCWWLQFRNSKPCSEYCLTHLVNLLEDWGPCDEHGEHHIRIPRTPARVT
[0191] This insert induced CD8+ T cell responses mainly to subdominant epitopes to which responses remain intact in mice with high HBV viral loads.
Immunogenicity and Efficacy of gDCore, gDPolN, and gDPolC Vaccines
[0192] The immunogenicity and efficacy the AdC6-gDCore, AdC6-gDPolN, AdC6-gDPolC, AdC7-gDCore, AdC7-gDPolN, and AdC7-gDPolC vaccines in an AAV8-HBV mouse model were analyzed.
Methods—Immunogenicity
[0193] C57Bl/6 mice (n=5 per group) were injected with various doses of: AdC6-gDCore (gDCore nucleic acid sequence corresponding to SEQ ID NO: 15); AdC6-gDPolN (gDPolN nucleic acid sequence corresponding to SEQ ID NO: 17); or AdC6-gDPolC (gDPolC nucleic acid sequence corresponding to SEQ ID NO: 19). Two months after the first injection, AdC6 vector-immunized mice were boosted with AdC7 vectors containing the same insert (e.g. AdC7-gDCore, AdC7-gDPolN, or AdC7-gDPolC). Mice were bled at 14 days and 56 days after the injection and T cell frequencies to the various HBV inserts were analyzed by intracellular cytokine staining (ICS) for interferon (IFN)-γ upon stimulation of cells with overlapping peptides representing the HBV sequences. Control cells were cultured without peptides. Frequencies and phenotype of CD8+ T cells to one immunodominant epitope within PolN were tested for by staining with an MHC I tetramer. The breadth and specificity of CD8+ T cell responses to individual peptides within a target sequence was performed via epitope mapping of splenocytes (CD8+ T cells tested by ICS for IFN-γ).
[0194] To assess CD8+ T cells in the liver, C57Bl/6 mice (n=8 per group) received intravenous administration of 1×10.sup.10 viral genomes (vg) of AAV8-1.3HBV, 1×10.sup.11 vg of AAV8-1.3HBV, or nothing via their tail vein, and 4 weeks later received a single IM injection of 5×10.sup.9 viral particles (vp) of AdC6-gDPolN. Eight weeks after the IM injection, mice were sacrificed, livers were removed, and lymphocytes were isolated and stained with T cell markers and a tetramer recognizing the T cell receptor to an immunodominant epitope present in the PolN sequence.
[0195] In a separate experiment, three groups of C57Bl/6 mice (n=4 per group) received a single IM injection of 5×10.sup.9 vp of AdC6-gDPolN at four weeks (−) or received either intravenous administration of 1×10.sup.11 viral genomes (vg) of AAV8-1.3HBV via their tail vein with or without a single IM injection of 5×10.sup.9 vp of AdC6-gDPolN four weeks later. Approximately 2 months after administration of AAV8-1.3HBV, mice were sacrificed, livers were removed and liver slices were prepared from each of the three groups, stained with hematoxylin and eosin and evaluated for lymphocytic infiltrates. From the same experiment, cells were stained with a specific tetramer and fluorochrome labeled antibodies to T-bet (clone 4B10, BV785 stain) or antibodies to PD-1 (clone 29F.1A12, BF605 stain), TIM-3 (clone RMT3-23, Pe/Cy7 stain), CTLA-4 (clone UC10-4B9, PE stain), or LAG-3 (clone C9B7W, BV650 stain). Cells were analyzed by flow cytometry and gated on CD44+CD8 tetramer positive cells, which were then gated on the markers. Percent marker positive cells were identified from histograms in comparison to naïve T cells.
Methods—Efficacy
[0196] AAV8-1.3HBV Vector Studies—To assess the impact of AdC6-gDPolN on chronic HBV virus exposure, C57Bl/6 mice (n=8 per group) were challenged intravenously via their tail vein with 1×10.sup.10 vg of AAV8-1.3HBV and four weeks later immunized with a single IM injection of 5×10.sup.9 vp of AdC6-gDPolN. HBV DNA viral titers were evaluated by qPCR; pre- and post-vaccination changes from baseline (log.sub.10 copies/mL) were reported. Viral genome copy numbers were assessed at four, six, eight, ten, and twelve weeks after AAV8 challenge. Viral dynamics were assessed by PCR over time and the change in log 10 in HBV copies per mL were assessed. The number of mice showing a one, two or three log reductions at different points after treatment was assessed.
[0197] Impact of chronic HBV virus exposure on CD8+ T cell antigen recognition over time—The effect of AAV8-1.3HBV on vaccine-induced hepatic CD8+ T cells was assessed. The epitope profile in splenocytes of naïve mice immunized with a single IM injection of 5×10.sup.9 vp of AdC6-gDPolN was determined 4 weeks after vaccination. Mice challenged with 1×10.sup.10 and 1.5×10.sup.11 vg of AAV8-1.3HBV and subsequently vaccinated with 5×10.sup.9 vp of AdC6-gDPolN 4 weeks later had CD8+ T cell epitope profiles in splenocytes performed 10 weeks after vaccination (14 weeks after AAV injection). Epitope profiles between AAV-naïve and AAV-treated vaccinated animals were compared. PolN-specific CD8+ T cells from liver were analyzed for differentiation markers.
Results
[0198] Immunogenicity—Vaccination induced robust and sustained CD8+ T cell responses to PolN (median frequencies over all circulating CD8+ T cells: 6.0%) and lower responses to PolC and core (median frequencies: 1.0% & 0.4%, respectively;
[0199] At week 12 following AdC6-gDPolN vaccination, AAV8-1.3HBV-infected vaccinated mice showed a preferential increase in hepatic CD8+ infiltrates (
[0200] Efficacy—Following a single IM injection of the AdC6-gDPolN vector, AAV8-1.3HBV-infected mice had multi-log HBV DNA declines in serum that persisted throughout the 8-week post vaccination period (
[0201] Following a single AdC6-gDPolN vector injection, distinct CD8+ T cell recognition patterns to PolN peptides in splenocytes were observed when AAV-HBV-infected and naïve mice were compared.
Discussion
[0202] An HBV therapeutic vaccine that targets early CD8+ T cell activation using gD as a genetically encoded checkpoint inhibitor was generated and was shown to: [0203] Induce potent and durable CD8+ T cell responses to key HBV antigens (
[0206] In the disclosed AAV studies, AAV-induced HBV infection caused loss of CD8+ T cell recognition to dominant epitopes of PolN following vaccination with AdC6-gDPolN (
Immunogenicity of AdC6/7-gDPolN in Blood and Liver Following Vaccination in AAV-Induced HBV-Infected Animals
[0207] The following studies were performed to evaluate CD8.sup.+ T cell responses to the AdC6-gDPolN vaccine in blood, spleens, and livers of animals in the presence of pre-existing AAV-induced HBV infection.
Experiment #1—CD8+ T Cell Responses in AAV8-1.3HBV Infected Mice: Response Kinetics in Blood
[0208] Purpose—To assess the effect of sustained titers of HBV antigen on CD8.sup.+ T cell responses to the gDPolN antigen as expressed within the AdC6 vector.
[0209] Methods—C57Bl/6 mice were injected i.v. with the 10.sup.10 of the AAV8-1.3HBV vector. Four weeks later they were vaccinated with 5×10.sup.9vp of the AdC6-gDPolN vector. Control mice received only the AdC6-gDPolN vector. Naïve mice served as additional controls. Mice were boosted 2 months later with the same dose of the AdC7-gDPolN vaccine. Blood was collected at various times after the prime and the boost and PBMCs were tested for IFN-γ-producing CD8.sup.+ T cells.
[0210] Results—As shown in
Experiment #2—CD8+ T Cell Responses in AAV8-1.3HBV Infected Mice: Responses in Liver
[0211] Purpose—To assess CD8.sup.+ T cell responses including markers indicative of T cell exhaustion in livers of AAV8-1.3HBV-infected, vaccinated mice.
[0212] Methods—C57Bl/6 mice were injected i.v. with the 10.sup.10 or 10.sup.11vg of the AAV8-1.3HBV vectors. Four weeks later they were vaccinated with 5×10.sup.9vp of the AdC6-gDPolN vector. Control mice received only the AdC6-gDPolN vector. Naïve mice served as additional controls. Mice were boosted 2 months later with the same dose of the AdC7-gDPolN vaccine.
[0213] To obtain hepatic lymphocytes, livers were cut into small fragments and treated with 2 mg/ml Collagenase P, 1 mg/ml DNase I (all from Roche, Basel Switzerland) and 2% FBS (Tissue Culture Biologicals, Tulare, Calif.) in L15 under agitation for 1 hour. Liver fragments were homogenized, filtrated through 70 μm strainers and lymphocytes were purified by Percoll-gradient centrifugation and washed with DMEM supplemented with 10% FBS. Lymphocytes were stained with a violet live/dead dye (Thermo Fisher Scientific), anti-CD8-APC (clone 53-6.7, BioLegend), anti-CD44-Alexa Flour 700 (clone IM7, BioLegend), anti-EOMES-Alexa Fluor 488 (clone Dan11mag, eBioscience), anti-PD1-BV605 (clone 29F.1A12, BioLegend), anti-LAG3-BV650 (clone C9B7W, BioLegend), anti-T-bet-BV786 (clone 4B10, BioLegend), anti-CTLA-4-PE-A (clone UC10-4B9, BioLegend), anti-TIM-3-Pe-Cy7-A (clone RMT3-23, BioLegend), and an APC-labeled MHC class I tetramer (NIH tetramer Facility, Emory University, Atlanta Ga.) corresponding to amino acids 396-404 FAVPNLQSL (SEQ ID NO: 188) (peptide 55) of the HBV polymerase at +4° C. for 30 min in the dark. Cells were washed and were analyzed by a BD FACS Celesta (BD Biosciences, San Jose, Calif.) and DiVa software. Post-acquisition analyses were performed with FlowJo (TreeStar, Ashland, Oreg.).
[0214] Results—The frequencies of CD8.sup.+ T cells within the lymphocytic liver infiltrates were analyzed. Frequencies of CD8.sup.+ T cells within the lymphocytic liver infiltrates were increased in vaccinated mice as compared to naïve mice, and further increases were seen in mice that prior to vaccination had been injected with the AAV8-1.3HBV vector (
[0215] The phenotypes of the infiltrating tetramer.sup.+CD8.sup.+ T cells in comparison to naïve (i.e., tetramer.sup.−CD44.sup.−CD8.sup.+ T cells) were assessed by determining the mean fluorescent intensity of a dye linked to a given antibody (
[0216] T-bet which controls a number of CD8.sup.+ T cell functions, was reduced on hepatic CD8.sup.+ T cells from mice that had been injected with AAV8-1.3HBV prior to vaccination in comparison the vaccine only group. Exhaustion markers were not increased in AAV8-1.3HBV-pre-treated groups suggesting that the observed loss of PolN-specific CD8.sup.+ T cells in presence of HBV was unlikely to be caused by classical CD8.sup.+ T cell exhaustion (
Experiment #3—Breadth of the PolN-Specific CD8+ T Cell Response in AAV8-1.3HBV Infected Mice
[0217] Purpose—To assess if the presence of HBV affects the breadth of the CD8.sup.+ T cell response to PolN expressed within gD by the AdC vaccines.
[0218] Methods—Mice were injected i.v. with the 10.sup.10 or 10.sup.11vg of the AAV8-1.3HBV vectors and were boosted 2 months later with the corresponding AdC7 vectors. Control mice received only the AdC6-gDPolN vector. Mice were euthanized 10 weeks later and the pooled splenocytes were tested against pools of peptides in the non-AAV infected animal study. Results are provided in
[0219] In a second experiment, mice were injected i.v. with the 10.sup.10 or 10.sup.11vg of the AAV8-1.3HBV vectors. Four weeks later they were vaccinated with 5×10.sup.10vp of the AdC6-gDPolN vector. Control mice received only the AdC6-gDPolN vector. Naïve mice served as additional controls. Splenocytes were analyzed 6 weeks later for IFN-γ-producing CD8.sup.+ T cells in response to individual peptides spanning the PolN sequence. Results are provided in
[0220] Results—The presence of HBV, especially high titers of HBV such as after injection with the 10.sup.11 vg dose of AAV8-HBV1.3, not only reduced overall CD8.sup.+ T cell responses to the PolN sequence as presented by the AdC6-gDPolN vaccine but also caused a shift in the epitope recognition profile.
Experiment #4—Functions of Hepatic PolN-Specific CD8+ T Cells in AAV8-1.3HBV Infected Mice
[0221] Purpose—To evaluate if liver-infiltrating PolN-specific CD8.sup.+ T cells remain functional in AAV8-1.3HBV infected mice.
[0222] Methods—In the first experiment, C57BL/6 mice were injected i.v. with 3×10.sup.11 vg of AAV8-1.3HBV. One group was vaccinated 8 weeks later with 5×10.sup.10 vp of AdC6-gDPolN vector. The other group was left unvaccinated. Mice were euthanized 4.5 months later and splenocytes were tested for frequencies of CD8.sup.+ T cells producing IFN-γ in response to the PolN peptide pool.
[0223] In the second experiment, mice were injected with graded concentrations of AAV8-1.3HBV (1×10.sup.10, 4×10.sup.10, or 1×10.sup.11). All mice were vaccinated 4 weeks later with 5×10.sup.10 vp of the AdC6-gDPolN vector. The mice were boosted 2 months later with the same dose of the AdC7-gDPolN vector. Mice were euthanized 2 months later and lymphocytes were isolated from livers and tested for CD8.sup.+ T cells producing IFN-γ in response to the PolN peptide pool. Cells were also stained with an antibody to Tox, a transcription factor that increases in exhausted T cells.
[0224] Results—As shown in
Experiment #5—Effect of Vaccination of AAV8-1.3HBV Infected Mice on Liver Histology
[0225] Purpose—To assess if AdC6/7-gDPolN vaccination of AAV.8-1.3HBV-vaccinated mice causes sustained liver damage.
[0226] Methods—Mice were injected with 10.sup.10 vg of the AAV8-1.3HPV given i.v. One month later they were vaccinated with 5×10.sup.9 vp of the AdC6-gDPolN vector. The mice were boosted 2 months later with the same dose of the AdC7-gDPolN vector given at the same dose. The mice were euthanized ˜2 months later. Liver sections were collected and fixed in 10% formaldehyde. Sections (˜3 μm in thickness) were prepared and stained with Hematoxylin Eosin (H&E). They were reviewed under a light microscope at 20× magnification.
[0227] Results—One out of 33 sections from mice that had received both the AAV vector and the vaccine showed a small lymphocytic infiltrate that was at the margin of the liver section.
[0228] As shown in
Conclusions
[0229] CD8.sup.+ T cell responses to PolN were reduced in AAV8-1.3HBV infected mice. Nevertheless, they remained detectable. [0230] Exhaustion markers were not increased in AAV8-1.3HBV pre-treated animals suggesting that the observed loss of PolN-specific CD8.sup.+ T cells in the presence of HBV was unlikely to be caused by classical CD8.sup.+ T cell exhaustion. [0231] AAV-induced HBV-infection caused a shift in the epitope recognition profile of CD8.sup.+ T cell responses to PolN. [0232] Vaccine-induced CD8.sup.+ T cells remained functional in mice that had been previously infected with the AAV8-1.3HBV vector. [0233] The vaccine used in a prime boost regimen did not cause overt liver damage in HBV positive mice.
Generation of HBV PolN-PolC-Core Constructs
[0234] Two multi-antigen inserts (second generation PolN-PolC-Core and third generation PolN-PolC-Core) were generated. The sequences of these inserts are shown below:
TABLE-US-00014 2.sup.nd generation HBV vaccine insert (“HBV2”)(Pol N (italics)-Pol C (underlined)-Core) (SEQ ID NO: 174) YLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGS PYSWEQELQHGSCWWLQFRNSKPCSEYCLTHLVNLLEDWGPCDEHGEHHI RIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGITRVSWPKFAVP NLQSLTNLLSSNLSWLSLDVQAFTFSPTYKAFLSKQYLNLYPVARQRPGL CQVFADATPTGWGLAMGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKI LGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDVGSNL EDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWI RTPPAYRPPNAPILSTLPETTVVRRRDRGR 3.sup.rd generation HBV vaccine insert (“HBV3”)(Pol N (italics)-Pol C (underlined)-Core) (SEQ ID NO: 175) HFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLPEWQTPSFPK IHLQEDIVDRCKQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKP YYPEHAVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEQELQH GSCWWLQFRNSKPCSEYCLTHLVNLLEDWGPCDEHGEHHIRIPRTPARVT QAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQR MRGTFVAPLPIHTAELLAACFARSRSGAKILGTDNSVVLSRKYTSFPWLL GCAANWILRGTSFVYVPSALNPADDVGSNLEDPASRELVVSYVNVNMGLK IRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPET TVVRRRDRGR
[0235] The second generation HBV (“HBV2”) insert includes immuno-dominant PolN epitopes identified from mice that had not been infected with the AAV8-1.3HBV vector prior to vaccination. Many of these epitopes were found to be lost in a mouse model of chronic HBV infection brought about by pre-administering an AAV8-1.3HBV vector (as defined in “Epitope Shifting” above). The third generation HBV (“HBV3”) insert selects for contiguous regions of PolN that were preferentially recognized by mice with high loads of HBV (see above). Regions of Core and PolC were selected for both constructs using the following general formula: regions with the highest immune responses on either prime (
Genetic Integrity and Stability of the 2.sup.nd and 3.sup.rd Generation HBV Inserts (HBV2 and HBV3)
[0236] Western Blot—Purified recombinant viral vector preparations (AdC6-gDHBV2, AdC6-gDHBV3, AdC7-gDHBV2, and AdC7-gDHBV3) were evaluated for their ability to elicit transgene-product expression in vitro. To that end, Western Blot assays were performed to assess the expression of gD protein in cell lysates following cell culture infection with the vector of interest. Adherent HEK293 cell monolayers were infected with known quantities of the purified vector and harvested at 48 hours post-infection, resuspended in lysis and extraction buffer containing protease inhibitors, and lysed by sonication. The total protein extracts were denatured by the use of dithiothreitol as a redox agent and submitted to electrophoresis in a 12% Bis-Tris polyacrylamide gel (PAGE). Subsequent to protein separation by SDS-PAGE, the samples were transferred onto an activated polyvinylidene difluoride membrane by wet electrophoretic transfer. The membrane was immunostained for the detection of gD protein using the primary antibody to gD diluted to 1:1000 in saline (clone PA1-30233, Invitrogen, Carlsbad, Calif.) for 1 h at room temperature. Membranes were washed with 1×TBS-T prior to incubating with HRP-conjugated goat anti-rabbit secondary IgG (ab6721, Abcam, Cambridge UK) for 1 h at room temperature. This was followed by the addition of a luminol-based chemiluminescent substrate. The stained membrane was exposed to an autoradiography film and signal emission was evaluated after processing by an automated film developer. Following documentation of the gD protein expression in infected HEK293 cell lysates, the membrane was stripped and re-probed for the presence of β-actin in the total protein extract samples. This staining step was employed to evaluate the consistency of the PAGE sample loading step and thus better support the semi-quantitative analysis of the in vitro stimulation of gD protein expression by the recombinant viral vector.
[0237] Stability—To ensure the genetic integrity of the viral construct, the genetic stability of each recombinant viral vector lot was assessed through sequential viral passages in adherent HEK293 cell cultures. The recombinant virus pool resulting from each transfection was cultured under standard growing conditions for a total of 12 passages. In the last passage, the virus pool was expanded and the crude harvest purified by cesium chloride gradient. Following vector purification, viral DNA was isolated using the QIAGEN DNeasy Blood & Tissue Kit and evaluated by restriction enzyme digest with Ase I and Bgl II, two restriction enzymes that cleave the DNA template in distinct construct-specific pre-defined banding patterns. After digestion, samples were submitted to electrophoresis in 1% agarose gel containing ethidium bromide to allow for the visualization of the digested bands, followed by documentation of results using a digital gel imaging system. Viral preparations that exhibited banding patterns identical to those of an early passage virus were considered to have maintained the original molecular clone structure and thus deemed stable at the end of 12 viral passages.
[0238] Results—The banding patterns of viral vector DNAs remained stable after 12 passages compared to that after 5 passages indicating the vector genomes were stable (data not shown).
Immunogenicity of the 2.sup.nd and 3.sup.rd Generation HBV Inserts (HBV2 and HBV3) as Expressed by AdC6 or AdC7 Vectors
[0239] Purpose—To assess CD8.sup.+ T cell responses to the HBV2 and HBV3 inserts expressed by AdC6 vectors or AdC7 vectors.
[0240] Methods—Groups of C57Bl/6 mice were injected with 5×10.sup.9 or 5×10.sup.10 vp of AdC6-gDHBV2 or AdC6-gDHBV3 vector. Mice injected with the same doses of the AdC6-gDPolN vector served as positive controls; naïve mice served as negative controls. Mice were bled 14 days later and PBMCs were tested for frequencies of CD8.sup.+ T cells producing IFN-γ in response to peptide pools corresponding to the HBV inserts. Four weeks later (6 weeks after vaccination) mice were bled again and tested with the PolN-specific tetramer. AdC6-gDHBV3 immunized mice were excluded as this insert lacks the epitope that corresponds to the tetramer.
[0241] Groups of C57Bl/6 mice were injected with 5×10.sup.9 or 5×10.sup.10 vp of AdC7-gDHBV2 or 5×10.sup.10 vp of AdC7-gDHBV3 vector. Naïve mice served as negative controls. Mice were bled 14 days later and PBMCs were tested for frequencies of CD8.sup.+ T cells producing IFN-γ in response to peptide pools corresponding to the HBV inserts.
Immunogenicity of AdC7Prime/AdC6 Boost
[0242] Mice were bled ˜4 weeks later and PBMCs were retested by ICS for CD8.sup.+ T cells producing IFN-γ and/or TNF-α in response to the peptides for the inserts. Mice were boosted two months after the prime with the same dose of the heterologous vector expressing the same insert. PBMCs were tested by ICS 2 weeks later and pre- and post-boost CD8.sup.+ and CD4.sup.+ T cell responses were compared. The AdC7-gDHBV2 vector induced robust frequencies of CD8.sup.+ T cells producing IFN-γ and/or TNF-α after the prime. Frequencies increased after the AdC6-gDHBV2 boost and this was especially pronounced after the low vector doses and for CD8.sup.+ T cells producing IFN-γ. The AdC7-gDHBV3 vector was poorly immunogenic but CD8.sup.+ T cell responses became positive after the AdC6-gDHBV3 boost. In the same token CD4+ T cell responses were marginal after the prime but increased after the boost. There was no marked difference in CD4 responses to the HBV2 or HBV3 insert.
Conclusions
[0243] Both the AdC6-gDHBV2 and AdC7-gDHBV2 vectors were highly immunogenic (
Comparison of HBV DNA Viral Titers in AdC6-gDPolN, AdC6-gDHBV2, AdC6-gDHBV3, or AdC6-HBV2 AAV-Infected Mice
Methods
[0246] Five groups of C57Bl/6 mice were challenged with 1×10.sup.9 vg of AAV8-1.3HBV and were vaccinated 4 weeks later with 1×10.sup.10 vp of either AdC6-gDPolN (n=10), AdC6-gDHBV2 (n=10), AdC6-gDHBV3 (n=10), or AdC6-HBV2 without gD (n=10); AAV-infected, non-vaccinated animals (“naive”) (n=10) and non-AAV-infected, non-vaccinated animals (n=2-5) served as controls. Viral titers were tested 4 weeks after AAV injection (before vaccination) and compared to levels 4 weeks after vaccination (week 8 after AAV injection).
Results
[0247] At week 8, the median HBV viral titers increased by 0.98 log.sub.10 cps/mL in naïve mice, remained unchanged in AdC6-HBV2 vaccinated mice, and declined by −0.04, −1.09 and −2.13 log.sub.10 cps/mL in AdC6-gDHBV3, AdC6-gDPolN and AdC6-gDHBV2 vaccinated animals, respectively (
Immunogenicity Studies for gDHBV2 and gDHBV3
[0248] The induction of CD8.sup.+ T cell responses and their breadth to segments of HBV core and polymerase contained in either gDHBV2 or gDHBV3 following a single prime injection or prime followed by a boost vaccination with a heterologous vector containing the same insert were evaluated.
Experiment 1
[0249] Purpose: Assess IFN-γ.sup.+CD8.sup.+ T cell responses following prime and boost vaccinations with gD-HBV2 and gD-HBV3 expressed by heterologous chimpanzee adenoviral vectors (AdC6 and AdC7) in C57Bl/6 mice.
[0250] Methods: Four groups of five C57Bl/6 mice were immunized via intramuscular injection as follows: (a) 5×10.sup.10 vp AdC7-gDHBV2 followed two months later by 5×10.sup.10 vp AdC6-gDHBV2; (b) 5×10.sup.9 vp AdC7-gDHBV2 followed two months later by 5×10.sup.9 vp AdC6-gDHBV2; (c) 5×10.sup.10 vp AdC7-gDHBV3 followed two months later by 5×10.sup.10 vp AdC6-gDHBV3; or (d) no vaccine. Blood was assessed by ICS for IFN-γ.sup.+CD8.sup.+ T cell responses 2 and 6 weeks after the prime, prior to the boost, and then 2 and 4 weeks after the boost.
[0251] Results: At all time points tested each vaccine construct was found to induce IFN-γ.sup.+CD8.sup.+ T cells.
Experiment 2
[0252] Purpose: Compare IFN-γ.sup.+CD8.sup.+ T cell responses following different doses of prime and boost vaccinations with gD-HBV2 and gD-HBV3 to that with gD-PolN using heterologous chimpanzee adenoviral vectors (AdC6 and AdC7) in C57Bl/6 mice.
[0253] Methods: Groups of C57Bl/6 mice (n=5 mice/group) were immunized as follows:
[0254] gDPolN Groups [0255] (a) 5×10.sup.9 vp AdC6-gDPolN followed three months later by 5×10.sup.9 vp AdC7-gDPolN; and [0256] (b) 5×10.sup.10 vp AdC6-gDPolN followed three months later by 5×10.sup.10 vp AdC7-gDPolN gDHBV2 Groups [0257] (c) 5×10.sup.9 vp AdC6-gDHBV2 followed three months later by 5×10.sup.9 vp AdC7-gDHBV2 and; [0258] (d) 5×10.sup.10 vp AdC6-gDHBV2 followed three months later by 5×10.sup.10 vp AdC7-gDHBV2 gDHBV3 Groups [0259] (e) 5×10.sup.9 vp AdC6-gDHBV3 followed three months later by 5×10.sup.9 vp AdC7-gDHBV3 and; [0260] (f) 5×10.sup.10 vp AdC6-gDHBV3 followed three months later by 5×10.sup.10 vp AdC7-gDHBV3
[0261] No Treatment Served as Controls
[0262] For all treatment groups, immunogenicity CD8.sup.+ T cell responses was from blood assessed by ICS for IFN-γ.sup.+ at two and six weeks after the prime, prior to the boost, and then two and six weeks after the boost. Immunogenicity was also assessed by tetramer staining using an APC-labeled MHC class I tetramer (NIH tetramer Facility, Emory University, Atlanta Ga.) corresponding to amino acids 396-404 FAVPNLQSL (peptide 55) of the HBV polymerase at week four after the prime. HBV3 does not contain the FAVPNLQSL peptide.
[0263] Results: At all time points, each vaccine tested was found to induce IFN-γ.sup.+CD8.sup.+ T cells. Results obtained with the gDHBV2 vaccine were similar to those obtained with the gDPolN vaccine; the gDHBV3 vaccine was less immunogenic. Upon tetramer staining, frequencies of the specific CD8.sup.+ T cells were comparable between the two vaccines; a number of activation markers tended to be more highly expressed on tetramer+ CD8+ T cells from the gDHBV2-immunized groups.
[0264]
[0265]
[0266]
Experiment 3
[0267] The breadth of responses were assessed from pooled splenocytes of vaccinated C57BL/6 mice which were tested by ICS against the individual peptides present in the HBV vaccine inserts.
[0268] Methods: Four groups of five C57Bl/6 mice were immunized via intramuscular injection as follows: (a) 5×10.sup.10 vp AdC7-gDHBV2 followed two months later by 5×10.sup.10 vp AdC6-gDHBV2; (b) 5×10.sup.9 vp AdC7-gDHBV2 followed two months later by 5×10.sup.9 vp AdC6-gDHBV2; (c) 5×10.sup.10 vp AdC7-gDHBV3 followed two months later by 5×10.sup.10 vp AdC6-gDHBV3; or (3) no vaccine. Animals were sacrificed eight weeks after the boost and pooled splenocytes were assessed by ICS for IFN-γ.sup.+CD8.sup.+ T cell responses to individual HBV2 or HBV3 peptides (cut-off for positive responses set at 0.1%).
[0269] Results: Independent of the dose, the prime boost regimen with the gDHBV2 vaccines induced responses to several epitopes within core and polymerase.
Experiment 4
[0270] The breadth of responses were assessed from pooled splenocytes of vaccinated BALB/c mice which were tested by ICS against the individual peptides present in the HBV vaccine inserts.
[0271] Methods: Five groups of five BALB/c mice were immunized via intramuscular injection as follows: (a) 5×10.sup.10 vp AdC6-gDHBV2; (b) 5×10.sup.10 vp AdC6-gDHBV3; (c) 5×10.sup.10 vp AdC7-gDHBV2; (d) 5×10.sup.10 vp AdC7-gDHBV3; or (e) no vaccine. 12 weeks post vaccination animals were sacrificed, spleens were collected and pooled splenocytes were assessed by ICS for IFN-γ.sup.+CD8.sup.+ T cell responses to individual HBV2 or HBV3 peptides (cut-off for positive responses set at 0.1%).
[0272] Results: At week 12, each vaccine construct was found to be immunogenic across multiple regions of the Core and Polymerase genes delivered by the vaccine.
Experiment 5
[0273] Methods: Five groups of C57Bl/6 mice were challenged with 1×10.sup.9 vg of AAV8-1.3HBV and were vaccinated 4 weeks later (“prime vaccination”) with 1×10.sup.10 vp of either AdC6-gDPolN (n=10), AdC6-gDHBV2 (n=10), AdC6-gDHBV3 (n=10), or AdC6-HBV2 without gD (n=10); AAV-infected, non-vaccinated animals (n=10) and non-AAV-infected, non-vaccinated animals (n=2-5) serve as controls. Mice will be bled at various times after the injection and frequencies of insert-specific CD8+ and CD4+ T cells will be determined by intracellular cytokine staining (ICS) for IFN-γ. PCR will be performed at 2 weeks, 6 weeks, and 8 weeks after the prime vaccination, and a T cell assay will be performed at 4 weeks after the prime vaccination.
[0274] At 8 weeks following the prime vaccination, mice will be boosted with AdC7 vectors containing the same antigenic insert used in the prime vaccination (“boost vaccination”) and blood and serum will be tested for CD8+/CD4+ T cell as previously described at different time points after vaccination. PCR will be performed at 2 weeks, 6 weeks, and 10 weeks after the boost vaccination, and a T cell assay will be performed at 4 weeks and 12 weeks after the boost vaccination.
[0275] Those skilled in the art will appreciate that numerous changes and modifications can be made to the preferred embodiments of the invention and that such changes and modifications can be made without departing from the spirit of the invention. It is, therefore, intended that the appended claims cover all such equivalent variations as fall within the true spirit and scope of the invention.
[0276] The disclosures of each patent, patent application, and publication cited or described in this document are hereby incorporated herein by reference, in their entirety.
TABLE-US-00015 TABLE 9 Sequences Sequence Genotype A MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAL Consensus YREALESPEHCSPHHTALRQAILCWGELMTLATWVGN (SEQ ID NO: 1) NLeDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFG RETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTV VRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC Genotype B MDIDpYKEFGASvELLSFLPSDFFPSiRDLLDTAsAL Consensus YREALESPEHCSPHHTALRQAIlCWGELMNLATWVGS (SEQ ID NO: 2) NLeDPASRELVVsYVNVNMGLKiRQLLWFHISCLTFG RETVLEYLVSFGVWIRTPpAYRPpNAPILSTLPETTV VRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREsQC Genotype C MDIDpYKEFGASVELLSFLPSDFFPSIRDLLDTASAL Consensus YREALESPEHCSPHHTALRQAILCWGELMNLATWVGS (SEQ ID NO: 3) NLEDPASRELVVsYVNVNMGLKiRQlLWFHISCLTFG RETVLEYLVSFGVWIRTPpAYRPPNAPILSTLPETTV VRRRGRSPRRRTPSPRRRRSQSPRRRSQSRESQC Genotype D MDIDPYKEFGAtVELLSFLPsDFFPSVRDLLDTASALYReAL Consensus ESPEHCSPHHTALRQAILCWGeLMtLATWVGgNLEDPaSRDL (SEQ ID NO: 4) VVSYVNTNmGLKFRQLLWFHISCLTFGReTViEYLVSFGVWI RTPpAYRPPNAPILSTLPETTVvRRRGRSPRRRTPSPRRRRS QSPRRRRSQSRESQC Initial Core MDIDPYKEFGA VELLSFLPSDFFPS
DLLDTASALYREAL sequence ESPEHCSPHHTALRQAILCWGELM
LATWVG
NLeDPASR
(SEQ ID NO: 5)
LVV
YVN
NMGLK
RQLLWFHISCLIFGRETV
EYLVSF GVWIRTPPAYRPPNAPILSTLPETTVVRRR
GRSPRRRT PSPRRRRSQSPRRRRSQSRESQC Epitope- DIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALE optimized Core SPEHCSPHHTALRQAILCWGELMTLATWVGSNLEDPASRELV amino acid VSYVNVNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIR sequence TPPAYRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRR (SEQ ID NO: 6) SQSPRRRRSQSRESQC Epitope- GACATCGACCCCTACAAGGAGTTCGGCGCCACCGTGGAGCTG optimized Core CTGAGCTTCCTGCCCAGCGACTTCTTCCCCAGCATCAGGGAC nucleotide CTGCTGGACACCGCCAGCGCCCTGTACAGGGAGGCCCTGGAG sequence AGCCCCGAGCACTGCAGCCCCCACCACACCGCCCTGAGGCAG (SEQ ID NO: 7) GCCATCCTGTGCTGGGGCGAGCTGATGACCCTGGCCACCTGG GTGGGCAGCAACCTGGAGGACCCCGCCAGCAGGGAGCTGGTG GTGAGCTACGTGAACGTGAACATGGGCCTGAAGATCAGGCAG CTGCTGTGGTTCCACATCAGCTGCCTGACCTTCGGCAGGGAG ACCGTGATCGAGTACCTGGTGAGCTTCGGCGTGTGGATCAGG ACCCCCCCCGCCTACAGGCCCCCCAACGCCCCCATCCTGAGC ACCCTGCCCGAGACCACCGTGGTGAGGAGGAGGGACAGGGGC AGGAGCCCCAGGAGGAGGACCCCCAGCCCCAGGAGGAGGAGG AGCCAGAGCCCCAGGAGGAGGAGGAGCCAGAGCAGGGAGAGC CAGTGC Epitope- PLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNL optimized GNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQ polymerase N- EDIVDRCKQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDK terminal amino GIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKRETTRSASFC acid sequence GSPYSWEQELQHGSCWWLQFRNSKPCSEYCLTHLVNLLEDWG (SEQ ID NO: 8) PCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDF SQFSRGITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAF YHIPLHPAAMP Epitope- CCCCTGAGCTACCAGCACTTCAGGAAGCTGCTGCTGCTGGAC optimized GAGGAGGCCGGCCCCCTGGAGGAGGAGCTGCCCAGGCTGGCC polymerase N- GACGAGGGCCTGAACAGGAGGGTGGCCGAGGACCTGAACCTG terminus GGCAACCTGAACGTGAGCATCCCCTGGACCCACAAGGTGGGC nucleotide AACTTCACCGGCCTGTACAGCAGCACCGTGCCCGTGTTCAAC sequence CCCGAGTGGCAGACCCCCAGCTTCCCCAAGATCCACCTGCAG (SEQ ID NO: 9) GAGGACATCGTGGACAGGTGCAAGCAGTTCGTGGGCCCCCTG ACCGTGAACGAGAAGAGGAGGCTGAAGCTGATCATGCCCGCC AGGTTCTACCCCAACGTGACCAAGTACCTGCCCCTGGACAAG GGCATCAAGCCCTACTACCCCGAGCACGCCGTGAACCACTAC TTCCAGACCAGGCACTACCTGCACACCCTGTGGAAGGCCGGC ATCCTGTACAAGAGGGAGACCACCAGGAGCGCCAGCTTCTGC GGCAGCCCCTACAGCTGGGAGCAGGAGCTGCAGCACGGCAGC TGCTGGTGGCTGCAGTTCAGGAACAGCAAGCCCTGCAGCGAG TACTGCCTGACCCACCTGGTGAACCTGCTGGAGGACTGGGGC CCCTGCGACGAGCACGGCGAGCACCACATCAGGATCCCCAGG ACCCCCGCCAGGGTGACCGGCGGCGTGTTCCTGGTGGACAAG AACCCCCACAACACCGCCGAGAGCAGGCTGGTGGTGGACTTC AGCCAGTTCAGCAGGGGCATCACCAGGGTGAGCTGGCCCAAG TTCGCCGTGCCCAACCTGCAGAGCCTGACCAACCTGCTGAGC AGCAACCTGAGCTGGCTGAGCCTGGACGTGAGCGCCGCCTTC TACCACATCCCCCTG CACCCCGCCGCCATGCCC Epitope- HLLVGSSGLSRYVARLSSNSRIINHQHGTMQNLHDSCSRNLY optimized VSLLLLYKTFGRKLHLYSHPIILKTKRWGYSLNFMGYVIGSW polymerase C- GSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAP terminal amino FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLSKQYLNLYPV acid sequence ARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVAPLPIHTAE (SEQ ID NO: 10) LLAACFARSRSGAKILGTDNSVVLSRKYTSFPWLLGCAANWI LRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRT SLYAVSPSV Epitope- CACCTGCTGGTGGGCAGCAGCGGCCTGAGCAGGTACGTGGCC optimized AGGCTGAGCAGCAACAGCAGGATCATCAACCACCAGCACGGC polymerase C- ACCATGCAGAACCTGCACGACAGCTGCAGCAGGAACCTGTAC terminal GTGAGCCTGCTGCTGCTGTACAAGACCTTCGGCAGGAAGCTG nucleotide CACCTGTACAGCCACCCCATCATCCTGAAGACCAAGAGGTGG sequence GGCTACAGCCTGAACTTCATGGGCTACGTGATCGGCAGCTGG (SEQ ID NO: 11) GGCAGCCTGCCCCAGGACCACATCATCCAGAAGATCAAGGAG TGCTTCAGGAAGCTGCCCGTGAACAGGCCCATCGACTGGAAG GTGTGCCAGAGGATCGTGGGCCTGCTGGGCTTCGCCGCCCCC TTCACCCAGTGCGGCTACCCCGCCCTGATGCCCCTGTACGCC TGCATCCAGAGCAAGCAGGCCTTCACCTTCAGCCCCACCTAC AAGGCCTTCCTGAGCAAGCAGTACCTGAACCTGTACCCCGTG GCCAGGCAGAGGCCCGGCCTGTGCCAGGTGTTCGCCGACGCC ACCCCCACCGGCTGGGGCCTGGCCATGGGCCACCAGAGGATG AGGGGCACCTTCGTGGCCCCCCTGCCCATCCACACCGCCGAG CTGCTGGCCGCCTGCTTCGCCAGGAGCAGGAGCGGCGCCAAG ATCCTGGGCACCGACAACAGCGTGGTGCTGAGCAGGAAGTAC ACCAGCTTCCCCTGGCTGCTGGGCTGCGCCGCCAACTGGATC CTGAGGGGCACCAGCTTCGTGTACGTGCCCAGCGCCCTGAAC CCCGCCGACGACCCCAGCAGGGGCAGGCTGGGCCTGAGCAGG CCCCTGCTGAGGCTGCCCTTCAGGCCCACCACCGGCAGGACC AGCCTGTACGCCGTGAGCCCCAGCGTG N- terminal HSV MGGAAARLGAVILFVVIVGLHGVRGKYALADASLKMADPNRF gD sequence RGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYY (SEQ ID NO: 12) AVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFR Signal peptide MGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSA in italics VSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRA KGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPEN QRTVAVYSLKIAGWHGP C-terminal HSV GPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVG gD sequence TVAPQIPPNWHIPSIQDAATPYHPPATPNNMGLIAGAVGGSL (SEQ ID NO: 13) LAALVICGIVYWMHRRTRKAPKRIRLPHIREDDQPSSHQPLF Y gDCore amino MGGAAARLGAVILFVVIVGLHGVRGKYALADASLKMADPNRF acid sequence RGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYY Core underlined AVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFR (SEQ ID NO: 14) MGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSA Signal peptide VSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRA in italics KGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPEN QRTVAVYSLKIAGWHGPDIDPYKEFGATVELLSFLPSDFFPS IRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTL ATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTF GRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRR DRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQCGPKAPYTST LLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPN WHIPSIQDAATPYHPPATPNNMGLIAGAVGGSLLAALVICGI VYWMHRRTRKAPKRIRLPHIREDDQPSSHQPLFY gDCore nucleic atggggggggctgccgccaggttgggggccgtgattttgttt acid sequence gtcgtcatagtgggcctccatggggtccgcggcaaatatgcc Core underlined ttggcggatgcctctctcaagatggccgaccccaatcgcttt (SEQ ID NO: 15) cgcggcaaagaccttccggtcctggaccagctgaccgaccct ccgggggtccggcgcgtgtaccacatccaggcgggcctaccg gacccgttccagccccccagcctcccgatcacggtttactac gccgtgttggagcgcgcctgccgcagcgtgctcctaaacgca ccgtcggaggccccccagattgtccgcggggcctccgaagac gtccggaaacaaccctacaacctgaccatcgcttggtttcgg atgggaggcaactgtgctatccccatcacggtcatggagtac accgaatgctcctacaacaagtctctgggggcctgtcccatc cgaacgcagccccgctggaactactatgacagcttcagcgcc gtcagcgaggataacctggggttcctgatgcacgcccccgcg tttgagaccgccggcacgtacctgcggctcgtgaagataaac gactggacggagattacacagtttatcctggagcaccgagcc aagggctcctgtaagtacgccctcccgctgcgcatccccccg tcagcctgcctctccccccaggcctaccagcagggggtgacg gtggacagcatcgggatgctgccccgcttcatccccgagaac cagcgcaccgtcgccgtatacagcttgaagatcgccgggtgg cacgggcccgacatcgacccctacaaggagttcggcgccacc gtggagctgctgagcttcctgcccagcgacttcttccccagc atcagggacctgctggacaccgccagcgccctgtacagggag gccctggagagccccgagcactgcagcccccaccacaccgcc ctgaggcaggccatcctgtgctggggcgagctgatgaccctg gccacctgggtgggcagcaacctggaggaccccgccagcagg gagctggtggtgagctacgtgaacgtgaacatgggcctgaag atcaggcagctgctgtggttccacatcagctgcctgaccttc ggcagggagaccgtgatcgagtacctggtgagcttcggcgtg tggatcaggaccccccccgcctacaggccccccaacgccccc atcctgagcaccctgcccgagaccaccgtggtgaggaggagg gacaggggcaggagccccaggaggaggacccccagccccagg aggaggaggagccagagccccaggaggaggaggagccagagc agggagagccagtgcgggcccaaggccccatacacgagcacc ctgctgcccccggagctgtccgagacccccaacgccacgcag ccagaactcgccccggaagaccccgaggattcggccctcttg gaggaccccgtggggacggtggcgccgcaaatcccaccaaac tggcacatcccgtcgatccaggacgccgcgacgccttaccat cccccggccaccccgaacaacatgggcctgatcgccggcgcg gtgggcggcagtctcctggcagccctggtcatttgcggaatt gtgtactggatgcaccgccgcactcggaaagccccaaagcgc atacgcctcccccacatccgggaagacgaccagccgtcctcg caccagcccttgttttactag gDPolN amino MGGAAARLGAVILFVVIVGLHGVRGKYALADASLKMADPNRF acid sequence RGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYY PolN underlined AVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFR (SEQ ID NO: 16) MGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSA Signal peptide VSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRA in italics KGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPEN QRTVAVYSLKIAGWHGPPLSYQHFRKLLLLDEEAGPLEEELP RLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVP VFNPEWQTPSFPKIHLQEDIVDRCKQFVGPLTVNEKRRLKLI MPARFYPNVTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLW KAGILYKRETTRSASFCGSPYSWEQELQHGSCWWLQFRNSKP CSEYCLTHLVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFL VDKNPHNTAESRLVVDFSQFSRGITRVSWPKFAVPNLQSLTN LLSSNLSWLSLDVSAAFYHIPLHPAAMPGPKAPYTSTLLPPE LSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPS IQDAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMH RRTRKAPKRIRLPHIREDDQPSSHQPLFY* gDPolN nucleic atggggggggctgccgccaggttgggggccgtgattttgttt acid sequence gtcgtcatagtgggcctccatggggtccgcggcaaatatgcc PolN underlined ttggcggatgcctctctcaagatggccgaccccaatcgcttt (SEQ ID NO: 17) cgcggcaaagaccttccggtcctggaccagctgaccgaccct ccgggggtccggcgcgtgtaccacatccaggcgggcctaccg gacccgttccagccccccagcctcccgatcacggtttactac gccgtgttggagcgcgcctgccgcagcgtgctcctaaacgca ccgtcggaggccccccagattgtccgcggggcctccgaagac gtccggaaacaaccctacaacctgaccatcgcttggtttcgg atgggaggcaactgtgctatccccatcacggtcatggagtac accgaatgctcctacaacaagtctctgggggcctgtcccatc cgaacgcagccccgctggaactactatgacagcttcagcgcc gtcagcgaggataacctggggttcctgatgcacgcccccgcg tttgagaccgccggcacgtacctgcggctcgtgaagataaac gactggacggagattacacagtttatcctggagcaccgagcc aagggctcctgtaagtacgccctcccgctgcgcatccccccg tcagcctgcctctccccccaggcctaccagcagggggtgacg gtggacagcatcgggatgctgccccgcttcatccccgagaac cagcgcaccgtcgccgtatacagcttgaagatcgccgggtgg cacgggccccccctgagctaccagcacttcaggaagctgctg ctgctggacgaggaggccggccccctggaggaggagctgccc aggctggccgacgagggcctgaacaggagggtggccgaggac ctgaacctgggcaacctgaacgtgagcatcccctggacccac aaggtgggcaacttcaccggcctgtacagcagcaccgtgccc gtgttcaaccccgagtggcagacccccagcttccccaagatc cacctgcaggaggacatcgtggacaggtgcaagcagttcgtg ggtcccctgaccgtgaacgagaagaggaggctgaagctgatc atgcccgccaggttctaccccaacgtgaccaagtacctgccc ctggacaagggcatcaagccctactaccccgagcacgccgtg aaccactacttccagaccaggcactacctgcacaccctgtgg aaggccggcatcctgtacaagagggagaccaccaggagcgcc agcttctgcggcagcccctacagctgggagcaggagctgcag cacggcagctgctggtggctgcagttcaggaacagcaagccc tgcagcgagtactgcctgacccacctggtgaacctgctggag gactggggtccctgcgacgagcacggcgagcaccacatcagg atccccaggacccccgccagggtgaccggcggcgtgttcctg gtggacaagaacccccacaacaccgccgagagcaggctggtg gtggacttcagccagttcagcaggggcatcaccagggtgagc tggcccaagttcgccgtgcccaacctgcagagcctgaccaac ctgctgagcagcaacctgagctggctgagcctggacgtgagc gccgccttctaccacatccccctgcaccccgccgccatgccc gggcccaaggccccatacacgagcaccctgctgcccccggag ctgtccgagacccccaacgccacgcagccagaactcgccccg gaagaccccgaggattcggccctcttggaggaccccgtgggg acggtggcgccgcaaatcccaccaaactggcacatcccgtcg atccaggacgccgcgacgccttaccatcccccggccaccccg aacaacatgggcctgatcgccggcgcggtgggcggcagtctc ctggcagccctggtcatttgcggaattgtgtactggatgcac cgccgcactcggaaagccccaaagcgcatacgcctcccccac atccgggaagacgaccagccgtcctcgcaccagcccttgttt tactag gDPolC amino MGGAAARLGAVILFVVIVGLHGVRGKYALADASLKMADPNRF acid sequence RGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYY PolC underlined AVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFR (SEQ ID NO: 18) MGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSA Signal peptide VSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRA in italics KGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPEN QRTVAVYSLKIAGWHGPHLLVGSSGLSRYVARLSSNSRIINH QHGTMQNLHDSCSRNLYVSLLLLYKTFGRKLHLYSHPIILKT KRWGYSLNPMGYVIGSWGSLPQDHIIQKIKECFRKLPVNRPI DWKVCQRIVGLLGFAAPFTQCGYPALMPLYACIQSKQAFTFS PTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGH QRMRGTFVAPLPIHTAELLAACFARSRSGAKILGTDNSVVLS RKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLG LSRPLLRLPFRPTTGRTSLYAVSPSVGPKAPYTSTLLPPELS ETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQ DAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMHRR TRKAPKRIRLPHIREDDQPSSHQPLFY gDPolC nucleic atggggggggctgccgccaggttgggggccgtgattttgttt acid sequence gtcgtcatagtgggcctccatggggtccgcggcaaatatgcc PolC underlined ttggcggatgcctctctcaagatggccgaccccaatcgcttt (SEQ ID NO: 19) cgcggcaaagaccttccggtcctggaccagctgaccgaccct ccgggggtccggcgcgtgtaccacatccaggcgggcctaccg gacccgttccagccccccagcctcccgatcacggtttactac gccgtgttggagcgcgcctgccgcagcgtgctcctaaacgca ccgtcggaggccccccagattgtccgcggggcctccgaagac gtccggaaacaaccctacaacctgaccatcgcttggtttcgg atgggaggcaactgtgctatccccatcacggtcatggagtac accgaatgctcctacaacaagtctctgggggcctgtcccatc cgaacgcagccccgctggaactactatgacagcttcagcgcc gtcagcgaggataacctggggttcctgatgcacgcccccgcg tttgagaccgccggcacgtacctgcggctcgtgaagataaac gactggacggagattacacagtttatcctggagcaccgagcc aagggctcctgtaagtacgccctcccgctgcgcatccccccg tcagcctgcctctccccccaggcctaccagcagggggtgacg gtggacagcatcgggatgctgccccgcttcatccccgagaac cagcgcaccgtcgccgtatacagcttgaagatcgccgggtgg cacgggccccacctgctggtgggcagcagcggcctgagcagg tacgtggccaggctgagcagcaacagcaggatcatcaaccac cagcacggcaccatgcagaacctgcacgacagctgcagcagg aacctgtacgtgagcctgctgctgctgtacaagaccttcggc aggaagctgcacctgtacagccaccccatcatcctgaagacc aagaggtggggctacagcctgaacttcatgggctacgtgatc ggcagctggggcagcctgccccaggaccacatcatccagaag atcaaggagtgcttcaggaagctgcccgtgaacaggcccatc gactggaaggtgtgccagaggatcgtgggcctgctgggcttc gccgcccccttcacccagtgcggctaccccgccctgatgccc ctgtacgcctgcatccagagcaagcaggccttcaccttcagc cccacctacaaggccttcctgagcaagcagtacctgaacctg taccccgtggccaggcagaggcccggcctgtgccaggtgttc gccgacgccacccccaccggctggggcctggccatgggccac cagaggatgaggggcaccttcgtggcccccctgcccatccac accgccgagctgctggccgcctgcttcgccaggagcaggagc ggcgccaagatcctgggcaccgacaacagcgtggtgctgagc aggaagtacaccagcttcccctggctgctgggctgcgccgcc aactggatcctgaggggcaccagcttcgtgtacgtgcccagc gccctgaaccccgccgacgaccccagcaggggcaggctgggc ctgagcaggcccctgctgaggctgcccttcaggcccaccacc ggcaggaccagcctgtacgccgtgagccccagcgtggggccc aaggccccatacacgagcaccctgctgcccccggagctgtcc gagacccccaacgccacgcagccagaactcgccccggaagac cccgaggattcggccctcttggaggaccccgtggggacggtg gcgccgcaaatcccaccaaactggcacatcccgtcgatccag gacgccgcgacgccttaccatcccccggccaccccgaacaac atgggcctgatcgccggcgcggtgggcggcagtctcctggca gccctggtcatttgcggaattgtgtactggatgcaccgccgc actcggaaagccccaaagcgcatacgcctcccccacatccgg gaagacgaccagccgtcctcgcaccagcccttgttttactag HBV PolN v2 HFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLPE amino acid WQTPSFPKIHLQEDIVDRCKQFVGPLTVNEKRRLKLIMPARF sequence YPNVTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGIL (SEQ ID NO: YKRETTRSASFCGSPYSWEQELQHGSCWWLQFRNSKPCSEYC 173) LTHLVNLLEDWGPCDEHGEHHIRIPRTPARVT HBV2 amino acid YLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKRETT sequence RSASFCGSPYSWEQELQHGSCWWLQFRNSKPCSEYCLTHLVN (SEQ ID NO: LLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNRENTAES 174) RLVVDFSQFSRGITRVSWPKFAVPNIQSLTNILSSNISWLSL (Pol N DVQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPT (italics)-Pol C GWGLAMGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKILG (underlined)- TDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPAD Core) DVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGR ETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDR GR HBV3 amino acid HFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNIGNIPE sequence WQTPSFPKIHIQEDIVDRCKQFVGPLTVNEKRRLKLIMPARF (SEQ ID NO: YPNVTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGIL 175) YKRETTRSASFCGSPYSWEQELQHGSCWWLQFRNSKPCSEYC (Pol N LTHLVNILEDWGPCDEHGEHHIRIPRTPARVTQAFTFSPTYK (italics)-Pol C AFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMR (underlined)- GTFVAPLPIHTAELLAACFARSRSGAKILGTDNSVVLSRKYT Core) SFPWLLGCAANWILRGTSFVYVPSALNPADDVGSNLEDPASR ELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGV WIRTPPAYRPPNAPILSTLPETTVVRRRDRGR HBV2 nucleic tatctgccgctggataaaggcattaaaccgtattatccggaacatgcggtgaaccattatttt acid sequence cagacccgccattatctgcataccctgtggaaagcgggcattctgtataaacgcgaaacc (SEQ ID NO: acccgcagcgcgagcttttgcggcagcccgtatagctgggaacaggaactgcagcatg 176) gcagctgctggtggctgcagtttcgcaacagcaaaccgtgcagcgaatattgcctgaccc atctggtgaacctgctggaagattggggaccgtgcgatgaacatggcgaacatcatattc gcattccgcgcaccccggcgcgcgtgaccggcggcgtgtttctggtggataaaaacccg cataacaccgcggaaagccgcctggtggtggattttagccagtttagccgcggcattacc cgcgtgagctggccgaaatttgcggtgccgaacctgcagagcctgaccaacctgctgag cagcaacctgagctggctgagcctggatgtgcaggcgtttacctttagcccgacctataaa gcgtttctgagcaaacagtatctgaacctgtatccggtggcgcgccagcgcccgggcctg tgccaggtgtttgcggatgcgaccccgaccggctggggcctggcgatgggccatcagc gcatgcgcggcacctttgtggcgccgctgccgattcataccgcggaactgctggcggcg tgctttgcgcgcagccgcagcggcgcgaaaattctgggcaccgataacagcgtggtgct gagccgcaaatataccagctttccgtggctgctgggctgcgcggcgaactggattctgcg cggcaccagctttgtgtatgtgccgagcgcgctgaacccggcggatgatgtgggcagca acctggaagatccggcgagccgcgaactggtggtgagctatgtgaacgtgaacatggg cctgaaaattcgccagctgctgtggtttcatattagctgcctgacctttggccgcgaaaccg tgattgaatatctggtgagctttggcgtgtggattcgcaccccgccggcgtatcgcccgcc gaacgcgccgattctgagcaccctgccggaaaccaccgtggtgcgccgccgcgatcgg ggccgc HBV3 nucleic cattttcgcaaactgctgctgctggatgaagaagcgggaccgctggaagaagaactgcc acid sequence gcgcctggcggatgaaggcctgaaccgccgcgtggcggaagatctgaacctgggcaa (SEQ ID NO: cctgccggaatggcagaccccgagctttccgaaaattcatctgcaggaagatattgtggat 177) cgctgcaaacagtttgtgggaccgctgaccgtgaacgaaaaacgccgcctgaaactgatt atgccggcgcgcttttatccgaacgtgaccaaatatctgccgctggataaaggcattaaac cgtattatccggaacatgcggtgaaccattattttcagacccgccattatctgcataccctgt ggaaagcgggcattctgtataaacgcgaaaccacccgcagcgcgagcttttgcggcagc ccgtatagctgggaacaggaactgcagcatggcagctgctggtggctgcagtttcgcaa cagcaaaccgtgcagcgaatattgcctgacccatctggtgaacctgctggaagattgggg accgtgcgatgaacatggcgaacatcatattcgcattccgcgcaccccggcgcgcgtga cccaggcgtttacctttagcccgacctataaagcgtttctgagcaaacagtatctgaacctg tatccggtggcgcgccagcgcccgggcctgtgccaggtgtttgcggatgcgaccccga ccggctggggcctggcgatgggccatcagcgcatgcgcggcacctttgtggcgccgct gccgattcataccgcggaactgctggcggcgtgctttgcgcgcagccgcagcggcgcg aaaattctgggcaccgataacagcgtggtgctgagccgcaaatataccagctttccgtgg ctgctgggctgcgcggcgaactggattctgcgcggcaccagctttgtgtatgtgccgagc gcgctgaacccggcggatgatgtgggcagcaacctggaagatccggcgagccgcgaa ctggtggtgagctatgtgaacgtgaacatgggcctgaaaattcgccagctgctgtggtttc atattagctgcctgacctttggccgcgaaaccgtgattgaatatctggtgagctttggcgtgt ggattcgcaccccgccggcgtatcgcccgccgaacgcgccgattctgagcaccctgcc ggaaaccaccgtggtgcgccgccgagatcgaggccgc HBV2 PolN amino YLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKRETT acid sequence RSASFCGSPYSWEQELQHGSCWWLQFRNSKPCSEYCLTHLVN (SEQ ID NO: LLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAES 178) RLVVDFSQFSRGITRVSWPKFAVPNLQSLTNLLSSNLSWLSL DV HBV2 PolC amino QAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGW acid sequence GLAMGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKILGTD (SEQ ID NO: NSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADD 179) HBV2 Core amino VGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRE acid sequence TVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRG (SEQ ID NO: R 180) HBV3 PolN amino HFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLPE acid sequence WQTPSFPKIHLQEDIVDRCKQFVGPLTVNEKRRLKLIMPARF (SEQ ID NO: YPNVTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGIL 181) YKRETTRSASFCGSPYSWEQELQHGSCWWLQFRNSKPCSEYC LTHLVNLLEDWGPCDEHGEHHIRIPRTPARVT HBV3 PolC amino QAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGW acid sequence GLAMGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKILGTD (SEQ ID NO: NSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADD 182) HBV3 Core amino VGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRE acid sequence TVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRG (SEQ ID NO: R 183) gD-HBV2 nucleic atggggggggctgccgccaggttgggggccgtgattttgttt acid sequence gtcgtcatagtgggcctccatggggtccgcggcaaatatgcc (SEQ ID NO: ttggcggatgcctctctcaagatggccgaccccaatcgcttt 184) cgcggcaaagaccttccggtcctggaccagctgaccgaccct ccgggggtccggcgcgtgtaccacatccaggcgggcctaccg gacccgttccagccccccagcctcccgatcacggtttactac gccgtgttggagcgcgcctgccgcagcgtgctcctaaacgca ccgtcggaggccccccagattgtccgcggggcctccgaagac gtccggaaacaaccctacaacctgaccatcgcttggtttcgg atgggaggcaactgtgctatccccatcacggtcatggagtac accgaatgctcctacaacaagtctctgggggcctgtcccatc cgaacgcagccccgctggaactactatgacagcttcagcgcc gtcagcgaggataacctggggttcctgatgcacgcccccgcg tttgagaccgccggcacgtacctgcggctcgtgaagataaac gactggacggagattacacagtttatcctggagcaccgagcc aagggctcctgtaagtacgccctcccgctgcgcatccccccg tcagcctgcctctccccccaggcctaccagcagggggtgacg gtggacagcatcgggatgctgccccgcttcatccccgagaac cagcgcaccgtcgccgtatacagcttgaagatcgccgggtgg cacgggccctatctgccgctggataaaggcattaaaccgtat tatccggaacatgcggtgaaccattattttcagacccgccat tatctgcataccctgtggaaagcgggcattctgtataaacgc gaaaccacccgcagcgcgagcttttgcggcagcccgtatagc tgggaacaggaactgcagcatggcagctgctggtggctgcag tttcgcaacagcaaaccgtgcagcgaatattgcctgacccat ctggtgaacctgctggaagattggggaccgtgcgatgaacat ggcgaacatcatattcgcattccgcgcaccccggcgcgcgtg accggcggcgtgtttctggtggataaaaacccgcataacacc gcggaaagccgcctggtggtggattttagccagtttagccgc ggcattacccgcgtgagctggccgaaatttgcggtgccgaac ctgcagagcctgaccaacctgctgagcagcaacctgagctgg ctgagcctggatgtgcaggcgtttacctttagcccgacctat aaagcgtttctgagcaaacagtatctgaacctgtatccggtg gcgcgccagcgcccgggcctgtgccaggtgtttgcggatgcg accccgaccggctggggcctggcgatgggccatcagcgcatg cgcggcacctttgtggcgccgctgccgattcataccgcggaa ctgctggcggcgtgctttgcgcgcagccgcagcggcgcgaaa attctgggcaccgataacagcgtggtgctgagccgcaaatat accagctttccgtggctgctgggctgcgcggcgaactggatt ctgcgcggcaccagctttgtgtatgtgccgagcgcgctgaac ccggcggatgatgtgggcagcaacctggaagatccggcgagc cgcgaactggtggtgagctatgtgaacgtgaacatgggcctg aaaattcgccagctgctgtggtttcatattagctgcctgacc tttggccgcgaaaccgtgattgaatatctggtgagctttggc gtgtggattcgcaccccgccggcgtatcgcccgccgaacgcg ccgattctgagcaccctgccggaaaccaccgtggtgcgccgc cgcgatcggggccgcgggcccaaggccccatacacgagcacc ctgctgcccccggagctgtccgagacccccaacgccacgcag ccagaactcgccccggaagaccccgaggattcggccctcttg gaggaccccgtggggacggtggcgccgcaaatcccaccaaac tggcacatcccgtcgatccaggacgccgcgacgccttaccat cccccggccaccccgaacaacatgggcctgatcgccggcgcg gtgggcggcagtctcctggcagccctggtcatttgcggaatt gtgtactggatgcaccgccgcactcggaaagccccaaagcgc atacgcctcccccacatccgggaagacgaccagccgtcctcg caccagcccttgttttactag gD-HBV2 amino MGGAAARLGAVILFVVIVGLHGVRGKYALADASLKMADPNRF acid sequence RGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYY (SEQ ID NO: AVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFR 185) MGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSA VSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRA KGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPEN QRTVAVYSLKIAGWHGPYLPLDKGIKPYYPEHAVNHYFQTRH YLHTLWKAGILYKRETTRSASFCGSPYSWEQELQHGSCWWLQ FRNSKPCSEYCLTHLVNLLEDWGPCDEHGEHHIRIPRTPARV TGGVFLVDKNPHNTAESRLVVDFSQFSRGITRVSWPKFAVPN LQSLTNLLSSNLSWLSLDVQAFTFSPTYKAFLSKQYLNLYPV ARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVAPLPIHTAE LLAACFARSRSGAKILGTDNSVVLSRKYTSFPWLLGCAANWI LRGTSFVYVPSALNPADDVGSNLEDPASRELVVSYVNVNMGL KIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNA PILSTLPETTVVRRRDRGRGPKAPYTSTLLPPELSETPNATQ PELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYH PPATPNNMGLIAGAVGGSLLAALVICGIVYWMHRRTRKAPKR IRLPHIREDDQPSSHQPLFY* gD-HBV3 nucleic atggggggggctgccgccaggttgggggccgtgattttgttt acid sequence gtcgtcatagtgggcctccatggggtccgcggcaaatatgcc (SEQ ID NO: ttggcggatgcctctctcaagatggccgaccccaatcgcttt 186) cgcggcaaagaccttccggtcctggaccagctgaccgaccct ccgggggtccggcgcgtgtaccacatccaggcgggcctaccg gacccgttccagccccccagcctcccgatcacggtttactac gccgtgttggagcgcgcctgccgcagcgtgctcctaaacgca ccgtcggaggccccccagattgtccgcggggcctccgaagac gtccggaaacaaccctacaacctgaccatcgcttggtttcgg atgggaggcaactgtgctatccccatcacggtcatggagtac accgaatgctcctacaacaagtctctgggggcctgtcccatc cgaacgcagccccgctggaactactatgacagcttcagcgcc gtcagcgaggataacctggggttcctgatgcacgcccccgcg tttgagaccgccggcacgtacctgcggctcgtgaagataaac gactggacggagattacacagtttatcctggagcaccgagcc aagggctcctgtaagtacgccctcccgctgcgcatccccccg tcagcctgcctctccccccaggcctaccagcagggggtgacg gtggacagcatcgggatgctgccccgcttcatccccgagaac cagcgcaccgtcgccgtatacagcttgaagatcgccgggtgg cacgggccccattttcgcaaactgctgctgctggatgaagaa gcgggaccgctggaagaagaactgccgcgcctggcggatgaa ggcctgaaccgccgcgtggcggaagatctgaacctgggcaac ctgccggaatggcagaccccgagctttccgaaaattcatctg caggaagatattgtggatcgctgcaaacagtttgtgggaccg ctgaccgtgaacgaaaaacgccgcctgaaactgattatgccg gcgcgcttttatccgaacgtgaccaaatatctgccgctggat aaaggcattaaaccgtattatccggaacatgcggtgaaccat tattttcagacccgccattatctgcataccctgtggaaagcg ggcattctgtataaacgcgaaaccacccgcagcgcgagcttt tgcggcagcccgtatagctgggaacaggaactgcagcatggc agctgctggtggctgcagtttcgcaacagcaaaccgtgcagc gaatattgcctgacccatctggtgaacctgctggaagattgg ggaccgtgcgatgaacatggcgaacatcatattcgcattccg cgcaccccggcgcgcgtgacccaggcgtttacctttagcccg acctataaagcgtttctgagcaaacagtatctgaacctgtat ccggtggcgcgccagcgcccgggcctgtgccaggtgtttgcg gatgcgaccccgaccggctggggcctggcgatgggccatcag cgcatgcgcggcacctttgtggcgccgctgccgattcatacc gcggaactgctggcggcgtgctttgcgcgcagccgcagcggc gcgaaaattctgggcaccgataacagcgtggtgctgagccgc aaatataccagctttccgtggctgctgggctgcgcggcgaac tggattctgcgcggcaccagctttgtgtatgtgccgagcgcg ctgaacccggcggatgatgtgggcagcaacctggaagatccg gcgagccgcgaactggtggtgagctatgtgaacgtgaacatg ggcctgaaaattcgccagctgctgtggtttcatattagctgc ctgacctttggccgcgaaaccgtgattgaatatctggtgagc tttggcgtgtggattcgcaccccgccggcgtatcgcccgccg aacgcgccgattctgagcaccctgccggaaaccaccgtggtg cgccgccgagatcgaggccgcgggcccaaggccccatacacg agcaccctgctgcccccggagctgtccgagacccccaacgcc acgcagccagaactcgccccggaagaccccgaggattcggcc ctcttggaggaccccgtggggacggtggcgccgcaaatccca ccaaactggcacatcccgtcgatccaggacgccgcgacgcct taccatcccccggccaccccgaacaacatgggcctgatcgcc ggcgcggtgggcggcagtctcctggcagccctggtcatttgc ggaattgtgtactggatgcaccgccgcactcggaaagcccca aagcgcatacgcctcccccacatccgggaagacgaccagccg tcctcgcaccagcccttgttttactag gD-HBV3 amino MGGAAARLGAVILFVVIVGLHGVRGKYALADASLKMADPNRF acid sequence RGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYY (SEQ ID NO: AVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFR 187) MGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSA VSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRA KGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPEN QRTVAVYSLKIAGWHGPHFRKLLLLDEEAGPLEEELPRLADE GLNRRVAEDLNLGNLPEWQTPSFPKIHLQEDIVDRCKQFVGP LTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHAVNH YFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEQELQHG SCWWLQFRNSKPCSEYCLTHLVNLLEDWGPCDEHGEHHIRIP RTPARVTQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFA DATPTGWGLAMGHQRMRGTFVAPLPIHTAELLAACFARSRSG AKILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSA LNPADDVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISc LTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVV RRRDRGRGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSA LLEDPVGTVAPQIPPNWHIPSIQDAATPYHPPATPNNMGLIA GAVGGSLLAALVICGIVYWMHRRTRKAPKRIRLPHIREDDQP SSHQPLFY*
Embodiments
[0277] The following list of embodiments is intended to complement, rather than displace or supersede, the previous descriptions. [0278] Embodiment 1. A hepatitis B virus (HBV) Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof. [0279] Embodiment 2. The HBV Core protein of embodiment 1, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 20-54. [0280] Embodiment 3. A hepatitis B virus (HBV) Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof. [0281] Embodiment 4. A nucleic acid molecule encoding the HBV Core protein of any one of embodiments 1-3. [0282] Embodiment 5. The nucleic acid molecule of embodiment 4, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 7. [0283] Embodiment 6. A vector comprising the nucleic acid molecule of embodiment 4 or 5. [0284] Embodiment 7. The vector of embodiment 6, wherein the vector is an adenoviral vector. [0285] Embodiment 8. The vector of embodiment 7, wherein the adenoviral vector is an AdC6 vector or AdC7 vector. [0286] Embodiment 9. A vaccine comprising the vector of any one of embodiments 6-8. [0287] Embodiment 10. A HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof. [0288] Embodiment 11. The HBV polymerase N-terminal domain of embodiment 10, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 55-113. [0289] Embodiment 12. A HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof. [0290] Embodiment 13. A HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof. [0291] Embodiment 14. The HBV polymerase C-terminal domain of embodiment 13, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 114-172. [0292] Embodiment 15. A HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof. [0293] Embodiment 16. A nucleic acid molecule encoding the HBV polymerase of any one of embodiments 10-15. [0294] Embodiment 17. The nucleic acid molecule of embodiment 16, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 9. [0295] Embodiment 18. The nucleic acid molecule of embodiment 16, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 11. [0296] Embodiment 19. A vector comprising the nucleic acid molecule of any one of embodiments 16-18. [0297] Embodiment 20. The vector of embodiment 19, wherein the vector is an adenoviral vector. [0298] Embodiment 21. The vector of embodiment 20, wherein the adenoviral vector is an AdC6 vector or AdC7 vector. [0299] Embodiment 22. A vaccine comprising the vector of any one of embodiments 19-21. [0300] Embodiment 23. A fusion protein comprising: [0301] one or more of an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof, an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof, and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof. [0302] Embodiment 24. The fusion protein of embodiment 23, comprising: [0303] (1) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof; [0304] (2) one or more of SEQ ID NOs: 20-54 (immunogenic fragments of SEQ ID NO: 6) and one or more of SEQ ID NOs: 55-113 (immunogenic fragments of SEQ ID NO: 8); [0305] (3) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; [0306] (4) one or more of SEQ ID NOs: 20-54 (immunogenic fragments of SEQ ID NO: 6) and one or more of SEQ ID NOs: 114-172 (immunogenic fragments of SEQ ID NO: 10); [0307] (5) an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; [0308] (6) one or more of SEQ ID NOs: 55-113 (immunogenic fragments of SEQ ID NO: 8) and one or more of SEQ ID NOs: 114-172 (immunogenic fragments of SEQ ID NO: 10); [0309] (7) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof, an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof, and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; or [0310] (8) one or more of SEQ ID NOs: 20-54 (immunogenic fragments of SEQ ID NO: 6), one or more of SEQ ID NOs: 55-113 (immunogenic fragments of SEQ ID NO: 8), and one or more of SEQ ID NOs: 114-172 (immunogenic fragments of SEQ ID NO: 10). [0311] Embodiment 25. A fusion protein comprising: [0312] an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof. [0313] Embodiment 26. The fusion protein of embodiment 25, comprising the amino acid sequence of SEQ ID NO: 174. [0314] Embodiment 27. A fusion protein comprising: [0315] an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof. [0316] Embodiment 28. The fusion protein of embodiment 27, comprising the amino acid sequence of SEQ ID NO: 175. [0317] Embodiment 29. A fusion protein comprising: [0318] an N-terminal herpes simplex virus (HSV) glycoprotein (gD) sequence or a variant thereof [0319] an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof; and [0320] a C-terminal HSV gD sequence or a variant thereof. [0321] Embodiment 30. The fusion protein of embodiment 29, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 20-54. [0322] Embodiment 31. A fusion protein comprising: [0323] an N-terminal HSV gD sequence or a variant thereof [0324] an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof; and [0325] a C-terminal HSV gD protein sequence or a variant thereof. [0326] Embodiment 32. The fusion protein of embodiment 31, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 55-113. [0327] Embodiment 33. A fusion protein comprising: [0328] an N-terminal HSV gD sequence or a variant thereof [0329] an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; and [0330] a C-terminal HSV gD protein sequence or a variant thereof. [0331] Embodiment 34. The fusion protein of embodiment 33, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 114-172. [0332] Embodiment 35. A fusion protein comprising: [0333] an N-terminal HSV gD sequence or a variant thereof [0334] an HBV sequence comprising: [0335] (1) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof; [0336] (2) one or more of SEQ ID NOs: 20-54 (immunogenic fragments of SEQ ID NO: 6) and one or more of SEQ ID NOs: 55-113 (immunogenic fragments of SEQ ID NO: 8); [0337] (3) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; [0338] (4) one or more of SEQ ID NOs: 20-54 (immunogenic fragments of SEQ ID NO: 6) and one or more of SEQ ID NOs: 114-172 (immunogenic fragments of SEQ ID NO: 10); [0339] (5) an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; [0340] (6) one or more of SEQ ID NOs: 55-113 (immunogenic fragments of SEQ ID NO: 8) and one or more of SEQ ID NOs: 114-172 (immunogenic fragments of SEQ ID NO: 10); [0341] (7) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof, an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof, and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; or [0342] (8) one or more of SEQ ID NOs: 20-54 (immunogenic fragments of SEQ ID NO: 6), one or more of SEQ ID NOs: 55-113 (immunogenic fragments of SEQ ID NO: 8), and one or more of SEQ ID NOs: 114-172 (immunogenic fragments of SEQ ID NO: 10) and [0343] a C-terminal HSV gD protein sequence or a variant thereof. [0344] Embodiment 36. A fusion protein comprising: [0345] an N-terminal HSV gD sequence or a variant thereof; [0346] an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof; and [0347] a C-terminal HSV gD sequence or a variant thereof. [0348] Embodiment 37. A fusion protein comprising: [0349] an N-terminal HSV gD sequence or a variant thereof [0350] an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof; and [0351] a C-terminal HSV gD protein sequence or a variant thereof. [0352] Embodiment 38. A fusion protein comprising: [0353] an N-terminal HSV gD sequence or a variant thereof [0354] an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof; and [0355] a C-terminal HSV gD protein sequence or a variant thereof. [0356] Embodiment 39. A fusion protein comprising: [0357] an N-terminal HSV gD sequence or a variant thereof [0358] an HBV sequence comprising: [0359] (1) an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof; or [0360] (2) an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof; and [0361] a C-terminal HSV gD protein sequence or a variant thereof. [0362] Embodiment 40. The fusion protein of embodiment 39, wherein the HBV sequence comprises an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof. [0363] Embodiment 41. The fusion protein of embodiment 40, wherein the HBV sequence comprises the amino acid sequence of SEQ ID NO: 174. [0364] Embodiment 42. The fusion protein of embodiment 39, wherein the HBV sequence comprises an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof [0365] Embodiment 43. The fusion protein of embodiment 42, wherein the HBV sequence comprises the amino acid sequence of SEQ ID NO: 175. [0366] Embodiment 44. The fusion protein of any one of embodiments 29-43, wherein the N-terminal HSV gD sequence comprises the amino acid sequence of SEQ ID NO: 12. [0367] Embodiment 45. The fusion protein of any one of embodiments 29-43, wherein the N-terminal HSV gD sequence comprises amino acid residues 26-269 of SEQ ID NO: 12. [0368] Embodiment 46. The fusion protein of any one of embodiments 29-45, wherein the C-terminal HSV gD sequence comprises the transmembrane domain of the HSV gD. [0369] Embodiment 47. The fusion protein of any one of embodiments 29-46, wherein the C-terminal HSV gD sequence comprises the amino acid sequence of SEQ ID NO: 13. [0370] Embodiment 48. The fusion protein of any one of embodiments 29-47, wherein the fusion protein comprises the amino acid sequence of any one of SEQ ID NO: 14 or an immunogenic fragment thereof, SEQ ID NO: 16 or an immunogenic fragment thereof, or SEQ ID NO: 18 or an immunogenic fragment thereof. [0371] Embodiment 49. The fusion protein of any one of embodiments 39-47, wherein the fusion protein comprises the amino acid sequence of SEQ ID NO: 185. [0372] Embodiment 50. The fusion protein of any one of embodiments 39-47, wherein the fusion protein comprises the amino acid sequence of SEQ ID NO: 187. [0373] Embodiment 51. A nucleic acid molecule encoding the fusion protein of any one of embodiments 23-50. [0374] Embodiment 52. The nucleic acid molecule of embodiment 51, wherein the nucleic acid molecule comprises the nucleotide sequence of any one of SEQ ID NOs: 15, 17, or 19. [0375] Embodiment 53. The nucleic acid molecule of embodiment 51, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 176. [0376] Embodiment 54. The nucleic acid molecule of embodiment 51, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 177. [0377] Embodiment 55. The nucleic acid molecule of embodiment 51, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 184. [0378] Embodiment 56. The nucleic acid molecule of embodiment 51, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 186. [0379] Embodiment 57. A vector comprising the nucleic acid molecule of any one of embodiments 51-56. [0380] Embodiment 58. The vector of embodiment 57, wherein the vector is an adenoviral vector. [0381] Embodiment 59. The vector of embodiment 58, wherein the adenoviral vector is an AdC6 vector or AdC7 vector. [0382] Embodiment 60. A vaccine comprising the vector of any one of embodiments 57-59. [0383] Embodiment 61. A method of inducing an immune response to HBV in a subject, the method comprising providing to the subject an effective amount of the fusion protein of any one of embodiments 23-50, the nucleic acid molecule of any one of embodiments 51-56, the vector of any one of embodiments 57-59, or the vaccine of embodiment 60 to thereby induce an immune response to HBV. [0384] Embodiment 62. The method of embodiment 61, wherein the vaccine comprises an AdC6 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof. [0385] Embodiment 63. The method of embodiment 62, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC6 vector, a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof. [0386] Embodiment 64. The method of embodiment 61, wherein the vaccine comprises an AdC7 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof. [0387] Embodiment 65. The method of embodiment 64, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC7 vector, a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof. [0388] Embodiment 66. The method of embodiment 61, wherein the vaccine comprises an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185. [0389] Embodiment 67. The method of embodiment 66, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC6 vector, a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185. [0390] Embodiment 68. The method of embodiment 61, wherein the vaccine comprises an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185. [0391] Embodiment 69. The method of embodiment 68, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC7 vector, a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185. [0392] Embodiment 70. The method of embodiment 61, wherein the vaccine comprises an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187. [0393] Embodiment 71. The method of embodiment 70, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC6 vector, a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187. [0394] Embodiment 72. The method of embodiment 61, wherein the vaccine comprises an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187. [0395] Embodiment 73. The method of embodiment 72, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC7 vector, a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187. [0396] Embodiment 74. The method of any one of embodiments 61-73, wherein the amino acid sequence of any one of SEQ ID NOs: 14, 16, 18, 185, or 187, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide.