NUCLEIC ACID LIBRARIES, PEPTIDE LIBRARIES AND USES THEREOF
20210388342 · 2021-12-16
Assignee
Inventors
Cpc classification
C12N15/1086
CHEMISTRY; METALLURGY
C12Q1/6806
CHEMISTRY; METALLURGY
C12Q1/6806
CHEMISTRY; METALLURGY
C40B40/08
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to nucleic acid libraries, peptide libraries and uses thereof. The invention relates to libraries of nucleic acids that encode a plurality of peptides that represent fragments of naturally occurring proteins. In particular, the invention relates to a library of nucleic acids, each nucleic acid comprising a coding region of defined nucleic acid sequence encoding for a peptide having a length of between 25 and 110 amino acids, and having an amino acid sequence being a region of a sequence selected from the amino acid sequence of a naturally occurring protein of one or more organisms; wherein the library comprises nucleic acids that encode for a plurality of at least 10,000 different such peptides, and wherein the amino acid sequence of each of at least 50 of such peptides is a sequence region of the amino acid sequence of a different protein of a plurality of different such naturally occurring proteins.
Claims
1. A library of nucleic acids, each nucleic acid comprising a coding region of defined nucleic acid sequence encoding for a peptide having a length of between 25 and 110 amino acids, and having an amino acid sequence being a region of a sequence selected from the amino acid sequence of a naturally occurring protein of one or more organisms; wherein the library comprises nucleic acids that encode for a plurality of at least 10,000 different such peptides, and wherein the amino acid sequence of each of at least 50 of such peptides is a sequence region of the amino acid sequence of a different protein of a plurality of different such naturally occurring proteins, and wherein each peptide encoded by the library is predicted from its amino acid sequence to have an isoelectric point (pI) of greater than 8.0 or less than 6.0.
2. The library of nucleic acids of any one of claim 1, wherein each of the plurality of different naturally occurring proteins fulfils one or more pre-determined criteria.
3. The library of nucleic acids of claim 2, wherein each of the plurality of naturally occurring proteins is associated with a given disease, such as cancer.
4. The library of nucleic acids of claim 3, wherein the disease is breast cancer.
5. The library of nucleic acids of claim 2, wherein each of the plurality of naturally occurring proteins is a cytoplasmic protein.
6. The library of nucleic acids of claim 5, wherein each of the plurality of naturally occurring proteins is a cytoplasmic kinase.
7. The library of nucleic acids of claim 2, wherein each of the plurality of naturally occurring proteins interacts with a given protein or at least one protein from a (functional) class of proteins.
8. The library of nucleic acids of claim 7, wherein each of the plurality of naturally occurring proteins interacts with KRas.
9. The library of nucleic acids of any one of claims 1 to 8, wherein the library comprises nucleic acids that encode for a plurality of at least 50,000 different such peptides, and wherein the amino acid sequence of each of at least 100 of such peptide is a sequence region of the amino acid sequence of at least 100 different naturally occurring proteins; in particular wherein the library comprises nucleic acids that encode for a plurality of at least 100,000 different such peptides, and wherein the amino acid sequence of each of at least 150 of such peptide is a sequence region of the amino acid sequence of at least 150 different naturally occurring proteins.
10. The library of nucleic acids of any one of claims 1 to 9, wherein the library comprises nucleic acids that encode for a plurality of at least 10,000 different such peptides, and wherein the amino acid sequence of each of at least 1,000 of such peptides is a sequence region of the amino acid sequence of a different protein of such plurality of different naturally occurring proteins.
11. The library of nucleic acids of any one of claims 1 to 10, wherein the library comprises nucleic acids that encode for a plurality of at least 200,000 different such peptides, and wherein the amino acid sequence of each of at least 20,000 of such peptide is a sequence region of the amino acid sequence of at least 20,000 different naturally occurring proteins; in particular wherein the library comprises nucleic acids that encode for a plurality of at least 300,000 different such peptides, and wherein the amino acid sequence of each of at least 25,000 of such peptide is a sequence region of the amino acid sequence of at least 25,000 different naturally occurring proteins.
12. The library of nucleic acids of any one of claim 1 or 11, wherein that in respect of at least about 1% of the naturally occurring proteins a plurality of the nucleic acids encodes for different peptides from the amino acid sequences of such naturally occurring proteins.
13. The library of nucleic acids of claim 12, wherein that in respect of at least about 50% of the naturally occurring proteins a plurality of the nucleic acids encodes for different peptides from the amino acid sequences of such naturally occurring proteins.
14. The library of nucleic acids of claim 13, wherein the plurality of the nucleic acids encodes for different peptides, and the amino acid sequences of which are sequence regions spaced along the amino acid sequence of the naturally occurring protein.
15. The library of nucleic acids of claim 14, wherein the sequence regions are spaced by a window of amino acids apart, or by multiples of such window, along the amino acid sequence of the naturally occurring protein wherein, the window is between 1 and about 55 amino acids; in particular wherein the window is between about 5 and about 20 amino acids; most particularly wherein the window of spacing is about 8, 10, 12 or 15 amino acids.
16. The library of nucleic acids of any one of claims 1 to 14 comprising nucleic acids encoding for at least 100,000 different peptides from at least 10,000 different naturally occurring proteins.
17. The library of nucleic acids of any one of claims 1 to 16, wherein each nucleic acid encodes a different peptide.
18. The library of nucleic acids of any one of claims 1 to 17, wherein the mean number of nucleic acids that encode a different peptide from the naturally occurring proteins is greater than 1; in particular between about 1.01 and 1.5 such nucleic acids (peptides) per such protein.
19. The library of nucleic acids of claim 18, wherein the mean number of nucleic acids that encode a different peptide from the naturally occurring proteins is at least about 5 such nucleic acids (peptides) per such protein, in particular wherein the mean is between about 5 and about 2,000 such nucleic acids (peptides) per such protein or is between about 5 and about 1,000 nucleic acids (peptides) per such protein.
20. The library of nucleic acids of claim 19, wherein the mean number of nucleic acids that encode a different peptide from the naturally occurring proteins is between about 100 and about 1,500 such nucleic acids (peptides) per such protein or is between about 250 and about 1,000 such nucleic acids (peptides) per such protein.
21. The library of nucleic acids of claim 19, wherein the mean number of nucleic acids that encode a different peptide from the naturally occurring proteins is between about 5 and about 100 such nucleic acids (peptides) per such protein or is between about 5 and about 50 such nucleic acids (peptides) per such protein.
22. The library of nucleic acids of any one of claims 1 to 21, wherein the amino acid sequence of the naturally occurring protein is one selected from the group of amino acids sequences of non-redundant proteins comprised in a reference proteome, suitably, the reference proteome is one or more of the reference proteomes selected from the group of reference proteomes listed in Table A and/or Table B, or an updated version of such reference proteome.
23. The library of nucleic acids of any one of claims 1 to 22, wherein the amino acid sequences of the plurality of encoded peptides are sequence regions selected from amino acid sequences of naturally occurring proteins (or polypeptide chains or domains thereof) with a known three-dimensional structure; in particular wherein the naturally occurring protein (or polypeptide chain or domain thereof) is comprised in the Protein Data Bank, and optionally that has a Pfam annotation.
24. The library of nucleic acids of any one of claims 22 to 23, wherein the sequence region selected from the amino acid sequence of the protein does not include an ambiguous amino acid of such amino acid sequence comprised in the reference proteome or the Protein Data Bank.
25. The library of nucleic acids according to any preceding claim, wherein the library is for expression in a mammalian cell, preferably a human cell.
26. The library of nucleic acids according to any preceding claim, wherein the library is cloned into a lentiviral vector or a retroviral vector.
27. A library of peptides encoded by the library of nucleic acids of any one of claims 1 to 26.
28. A method of identifying a target protein that modulates a phenotype of a mammalian cell, said method comprising: a. exposing a population of in vitro cultured mammalian cells capable of displaying said phenotype to a library of nucleic acids according to any of claims 1-26 or a library of peptides according to claim 27, b. identifying in said cell population an alteration in said phenotype following said exposure, c. selection of said cells undergoing the phenotypic change and identifying a peptide encoded by (or a peptide of) such library that alters the phenotype of the cell, d. providing said peptide and identifying the cellular protein that binds to said peptide, said cellular protein being a target protein that modulates the phenotype of the mammalian cell.
29. The method according to claim 28, wherein the method includes a further step of identifying a compound that binds to said target protein and displaces or blocks binding of said peptide, wherein the compound modulates the phenotype of a mammalian cell.
30. Use of: (a) a library of nucleic acids according to any of claims 1-26; and/or (b) a library of peptides according to claim 27, to identify a peptide that binds to a target.
31. Use according to claim 30, wherein the target is a protein target.
32. Use according to claim 30 or claim 31, wherein the identified peptide modulates a phenotype of a mammalian cell.
33. Use of: (a) a library of nucleic acids according to any of claims 1-26; and/or (b) a library of peptides according to claim 27, to identify a compound which binds to a target.
34. Use according to claim 33, wherein the target is a protein target.
35. Use according to claim 33 or claim 34 wherein, said compound displaces or blocks binding of a peptide to the target.
36. Use according to any of claims 33 to 35, wherein, the peptide and/or the compound modulates a phenotype of a mammalian cell.
37. A method according to claim 28 or claim 29, or Use according to claims 30 to 36, wherein the phenotype is a phenotype related to the modulation of a cell-signalling pathway.
38. A method or use according to claim 37, wherein the method or use comprises the identification of peptides which modulate cell-signalling pathways and the identification of protein targets and surface sites on such proteins that participate in signal transduction.
39. A method or use according to claim 37 or 38, wherein the cell-signalling pathway is active or altered in cancer cells.
Description
[0013] The figures show:
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023] The present invention, and particular non-limiting aspects and/or embodiments thereof, can be described in more detail as follows:
[0024] In a first aspect, the present invention provides a library of nucleic acids, each nucleic acid comprising a coding region of defined nucleic acid sequence encoding for a peptide having a length of between 25 and 110 amino acids, and having an amino acid sequence being a region of a sequence selected from the amino acid sequence of a naturally occurring protein of one or more organisms; wherein the library comprises nucleic acids that encode for a plurality of at least about 10,000 (or 5,000) different such peptides, and wherein the amino acid sequence of each of at least 50 (or at least 25) of such peptides is a sequence region of the amino acid sequence of a different protein of a plurality of different such naturally occurring proteins (or wherein, for clarity, in respect of each of the different naturally occurring proteins, the library comprises one or more nucleic acids encoding for a peptide having an amino acid sequence being a sequence region of the amino acid sequence of such naturally occurring protein.
[0025] Suitably, a library in accordance with any aspect or embodiment of the invention comprises nucleic acids that encode a plurality of at least approximately 20,000, 50,000, 100,000, 200,000, 250,000, 300,000, 475,000 or 500,000 different such peptides. The library may also comprise nucleic acids that encode over 300,000 or 500,000 different such peptides. For example, in certain embodiments the library may comprise nucleic acids that encode for a plurality of at least 50,000 different such peptides, and wherein the amino acid sequence of each of at least 100 of such peptide is a sequence region of the amino acid sequence of at least 100 different naturally occurring proteins (or wherein, for clarity, in respect of each of the at least 100,000 different naturally occurring proteins, the library comprises one or more nucleic acids encoding for a peptide having an amino acid sequence being a sequence region of the amino acid sequence of such naturally occurring protein); in particular of such embodiments the library may comprise nucleic acids that encode for a plurality of at least 100,000 different such peptides, and wherein the amino acid sequence of each of at least 150 of such peptide is a sequence region of the amino acid sequence of at least 150 different naturally occurring proteins (or wherein, in respect of each of the at least 150 different naturally occurring proteins, the library comprises one or more nucleic acids encoding for a peptide having an amino acid sequence being a sequence region of the amino acid sequence of such naturally occurring protein). In another embodiment, the library may comprise nucleic acids that encode for a plurality of at least 10,000 different such peptides, and wherein the amino acid sequence of each of at least 1,000 of such peptides is a sequence region of the amino acid sequence of a different protein of such plurality of different naturally occurring proteins.
[0026] In one embodiment, the library may comprise nucleic acids that encode for a plurality of at least 200,000 different such peptides, and wherein the amino acid sequence of each of at least 20,000 of such peptide is a sequence region of the amino acid sequence of at least 20,000 different naturally occurring proteins; in particular of such embodiments the library may comprise nucleic acids that encode for a plurality of at least 300,000 different such peptides, and wherein the amino acid sequence of each of at least 25,000 of such peptide is a sequence region of the amino acid sequence of at least 25,000 different naturally occurring proteins. In one embodiment, the nucleic acids are present in the mixture in an amount that is proportional to the complexity and size of the genome or transcriptome of the organism of interest. In other embodiments, the number of different nucleic acids in a library in accordance with the invention may depend on the desired screening application and on the number of sequences that may be workable in a particular application. This may include a consideration of whether the library is for use as a primary or secondary screen, for example.
[0027] As used herein the term “different” in the context of the peptides encoded by the nucleic acids within the library of the invention means that any one peptide has at least one amino acid difference compared to any other peptide encoded within the library. In other words, each nucleic acid within the library encodes a unique peptide.
[0028] In one embodiment, a “naturally occurring protein” is one which has a sequence found in a reference proteome. Examples of reference proteomes and how to use information from reference proteomes are described herein. As used herein the term “different” in the context of the naturally occurring proteins means that any one such protein has at least one amino acid difference compared to any other such protein. In other words, each nucleic acid within the library encodes a unique peptide. Suitably, “different” naturally occurring proteins have an amino acid sequence identify that is less than about 98%, 95% or 92% sequence identity, such as less than about 95% or 90% sequence identity. In one suitable embodiment, “different” naturally occurring proteins have different entry numbers (or other identifier) of a database, such as having different UniProt identifiers. For example, the cyclin-dependent kinases with the UniProt (www.uniprot.org) identifiers P24941 and P11802 (human CDK2 and CDK4, respectively) are, in such an embodiment, “different” naturally occurring proteins.
[0029] Advantageously, each nucleic acid comprises a coding region of defined (or known) nucleic acid sequence encoding for a peptide. By “defined” (or “known”) nucleic acid sequence is meant that the sequence of substantially all (e.g. each) nucleic acid sequence within the library is defined (or known). In particular, the library is non-random i.e. it does not represent a collection of random genomic sequences (which may or may not express peptide sequences), even if the genome sequence as a whole may have been determined (e.g. known), but the library has been designed, starting from protein sequences and, optionally filtered to generate a subset of nucleic acids encoding peptides with particular predicted features, in particular with specific and defined amino acid sequence. Thus, advantageously, the identity of substantially all (e.g. each) of the sequences in the library will be defined (or known) such that a library in accordance with the invention may have an inventory (that is, e.g., comprising or consisting of a pre-designated or pre-designed collection of individual members of defined (or known) sequences), even if may not be known which specific sequence is in which specific member of the library. This allows the sequences therein to be readily identified. Such libraries may be designed to have a desired complexity and/or to filter out undesired sequences, as described herein.
[0030] In some embodiments the nucleic acids of the library are synthetic (e.g., they have been—at least initially—generated by chemical rather than biological processes). Thus, suitably, the library provides synthetic or non-natural nucleic acids (and/or comprises non-natural sequences of nucleic acids). Such nucleic acids are, suitably, designed according to any one of the methods as described herein and synthesised according to methods available to those skilled in the art, particularly those high volume/high throughput methods included those described elsewhere herein. Importantly, such synthesised nucleic acids comprise design features which distinguish them from naturally occurring nucleic acids. Such design features include, for example, use of codon frequency tables to generate the nucleic acids such that the sequence of nucleotides making up the codons within the nucleic acids encoding the peptides do not represent those codons which would be found at that position in the amino acid sequence of the naturally occurring protein. In addition, the nucleic acids for use in the libraries in accordance with the invention may comprise restriction sites which would not be present in the naturally occurring nucleic acid sequences and would generate peptide sequences comprising additional amino acids which would not occur in the naturally occurring protein sequence. Suitably, the nucleic acids (e.g., the sequences thereof) for use in the libraries in accordance with the invention may be generated using the design principles set out in the methods as described herein.
[0031] In one embodiment of the library in accordance with the invention, the library provides multiple nucleic acid sequences encoding multiple peptides derived from any one protein. That is, in respect of each of the different naturally occurring proteins the library comprises a plurality of (i.e., more than one) nucleic acids encoding for a peptide having an amino acid sequence being a sequence region of the amino acid sequence of such naturally occurring protein. Accordingly, with this meaning of such embodiment, the first aspect of the present invention may alternatively be stated (e.g., for clarity, as indicated above) as relating to a library of nucleic acids, each nucleic acid comprising a coding region of defined (or known) nucleic acid sequence encoding for a peptide having a length of between 25 and 110 amino acids, and having an amino acid sequence being a region of a sequence selected from the amino acid sequence of a naturally occurring protein of one or more organisms; wherein the library comprises nucleic acids that encode for a plurality of at least 10,000 different such peptides, and wherein in respect of each of the different naturally occurring proteins, the library comprises one or more nucleic acids encoding for a peptide having an amino acid sequence being a sequence region of the amino acid sequence of such naturally occurring protein.
[0032] For example, in one such embodiment at least about 1% of the naturally occurring proteins a plurality of the nucleic acids encodes for different peptides from the amino acid sequences of such naturally occurring proteins. Suitably, in respect of at least about 5%, 10%, 25% or 50% of the naturally occurring proteins, a plurality of the nucleic acids encodes for different peptides from the amino acid sequences of such naturally occurring proteins. In other embodiments, a plurality of the nucleic acids encodes for different peptides from at least about 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100% of the naturally occurring proteins. In a particular embodiment, a plurality of the nucleic acids encodes for different peptides from the amino acid sequences of between about 90% and 100% of such naturally occurring proteins. Suitably a “different peptide” is one that has a different amino acid, such as differing by one or more (e.g. between about two and ten, five and 20, 15 and 40 or 30 and 50, or more than 50) amino acids.
[0033] In another embodiment, the invention provides a library of (e.g. synthetic) nucleic acids, wherein the plurality of the nucleic acids encodes for different peptides, the amino acid sequences of which are sequence regions spaced along the amino acid sequence of the naturally occurring protein. Suitably this spacing is chosen so as to generate a library which encodes a workable number of peptides and may be varied according to the desired number of peptides represented by the library. By “workable number” is meant a suitable number which can be generated economically whilst providing a suitable number for use in a screening application or method of choice. For example, for primary cell-based selection screens, a “workable number” may be larger (say, 300,000, 500,000 or even millions) that for secondary screening or array-based or pull-down screening (using say, tens of thousands up to about 250,000). Suitably, an expression library of nucleic acids of the present invention may, suitably, be used at a complexity of between about 250,000 and 500,000 different peptides (such as about 300,000); and a library of peptides expressed therefrom may be used for solid-phase screening at a complexity of greater than 500,000, such as greater than 750,000 1,000,000, 1,500,000 or 2,000,000 (or more). In other embodiments, a “workable number” may be smaller than such numbers of peptides (such as, in those embodiments directed to the “focused” section of naturally occurring proteins described below). Suitably, in such embodiments, an expression library of nucleic acids of the present invention may be used at a complexity of between about 5,000 and 250,000 different peptides (such as at least about 10,000), for example between about 10,000 and 25,000, 20,000 and 50,000, 40,000 and 100,000 or 100,000 and 200,000 different peptides.
[0034] Accordingly, in one embodiment, the sequence regions are spaced by a window of amino acids apart, or by multiples of such window, along the amino acid sequence of the naturally occurring protein wherein, the window is between 1, 5, 10, 15, 20, 25, 30, 35, 40 or 45 and about 55 amino acids; in particular wherein, the window is between about 2 and 40 amino acids, more particularly wherein, the window is between about 5 and about 20 amino acids; most particularly wherein the window of spacing is about 8, 10, 12 or 15 amino acids. In a suitable embodiment, the window used to space the sequence regions is the same number of amino acids (or multiples thereof) between each of the sequence regions along the amino acid sequence of the naturally occurring protein (and optionally, for each of the other naturally occurring proteins used to form the sequences of the peptides encoded by the nucleic acids of the library. In one further embodiment, the library may contain sequence regions spaced by multiples of such windows as one or more of the intervening peptides/amino acid sequences may get dropped from the selection process in view of not conforming to one or more of the various filtering criteria.
[0035] Suitably, the library is designed to be a complex library. By a “complex library” is meant one which has a multitude of different proteins and peptides represented therein, in particular one comprising sequence (or structurally) diverse peptides such as those defined from evolutionary diverse species. “Complexity” is therefore considered in terms of the numbers of proteins and peptides. Advantageously, the library of the present invention provides a much higher degree of complexity than those libraries available in the prior art. In one embodiment the library comprises (synthetic) nucleic acids encoding at least 5,000 different peptides from at least 5,000 different proteins. In another embodiment, the library of (synthetic) nucleic acids in accordance with the invention comprises nucleic acids encoding for at least 100,000 (or 20,000 or 50,000) different peptides from at least 10,000 (or 2,000 or 5,000, respectively) different naturally occurring proteins. It will be appreciated that the number of different peptides encoded by the library in accordance with the invention may be upwards of at least 10,000, 20,000 50,000 or 100,000 different peptides encoded by at least 50, 75, 100 or 150 10,000 different naturally occurring proteins; the size of the library may be over at least 50,000, 100,000 or 250,000 peptides, for example. The number of different peptides and the number of different naturally occurring proteins from which they are derived may be varied according to the specific application. Accordingly, and as described above, the library may encode for at least approximately 5,000, 10,000, 50,000, 100,000, 200,000, 250,000, 300,000, 475,000 or 500,000 different such peptides, over 300,000 or 500,000 different such peptides (or, e.g. suitably for focused libraries, over 10,000 or 50,000 different such peptides); suitably wherein on average two or more (such as about 5, 8, 10 or 15) peptides are derived from the amino acid sequence of the same naturally occurring protein.
[0036] Given the complexity of certain embodiments of the library of the present invention—for example, those encoding for (or comprising) at least 10,000 (or 200,000 or 300,000) peptides from at least 1,000 or 10,000 (or 20,000 or 25,000, respectively) different naturally occurring proteins—the e.g. encoded peptides will in such embodiments, typically, represent those derived from a diverse selection of different naturally occurring proteins. Indeed, typically, the diverse selection of different naturally occurring proteins would (e.g. also or, optionally, only) comprise proteins that are non-secreted proteins and/or are not extracellular proteins, including those from a plurality of species. For example, the different naturally occurring proteins may comprise (e.g. also or, optionally, only) a set of proteins that include proteins other than (e.g. human and mouse) cytokines, chemokines, growth factors and their receptors (optionally, such other proteins as well as such cytokines, chemokines, growth factors and their receptors). In particular embodiments, the different naturally occurring proteins may comprise a set of proteins that include proteins that are cytoplasmic proteins (optionally, cytoplasmic protein as well as including non-cytoplasmic proteins such as also including secreted proteins and/or extracellular proteins).
[0037] In additional or alterative embodiments, a library of the present invention encodes for (or comprises) peptides that are not (previously) known to be—e.g., are not pre-selected to be—bioactive peptides, and/or could putatively modulate cellular responses by interacting with cell surface receptors.
[0038] In other embodiments of the library of the present invention—for example, those encoding for (or comprising) at least 50,000 (or 10,000 or 100,000) peptides from at least 100 (or 50 or 150, respectively) different naturally occurring proteins—the e.g. encoded peptides will in such embodiments, typically, represent those derived from a focused selection of different naturally occurring proteins. In such embodiment, the different naturally occurring proteins may be pre-selected from or a subset of a larger set of naturally occurring proteins (such as those from one or more reference proteomes) based on one more (e.g. pre-determined) criteria. In particular of such embodiments, all of the different naturally occurring proteins may fulfill such criteria, and each (e.g., all) of the (encoded) peptides of such a library is intended to have, or has, a sequence that is a sequence region of the amino acid sequence of a naturally occurring protein that fulfills such (e.g. pre-determined) criteria. One non-limiting example of such criteria can be that the naturally occurring proteins are those being secreted proteins and/or extracellular proteins, such as that (e.g. all of) the naturally occurring proteins may be cytokines, chemokines, growth factors and their receptors. Alternatively, such criteria may comprise that the naturally occurring proteins are not secreted proteins and/or are not extracellular proteins, such as that (e.g. all of) the naturally occurring proteins may not be cytokines, chemokines, growth factors and their receptors.
[0039] In alterative embodiments, criteria for (e.g., each and/or all of) the naturally occurring proteins from which the peptides encoded by (or comprised in) the library are derived, can include or consist of one or more of the following criteria; such protein/s is/are: [0040] From a subcellular compartment e.g. Cytoplasmic, nuclear, mitochondrial, cytoskeletal, or ribosomal [0041] One or more given enzymatic class. For example, a kinase, protease, esterase, or phosphatase; [0042] One or more given receptor type. For example, a G-coupled protein receptor or a nuclear hormone receptor; [0043] Membrane transport proteins and/or ion-channel proteins; [0044] Structural proteins; [0045] Transcription factors or DNA-binding proteins; [0046] DNA repair proteins. For example, a protein of the mismatch repair pathway; [0047] Involved in one or more (e.g. related or inter-related) cell-signaling/signal-transduction pathway. For example, the MAPK/ERK pathway, PI3K/Akt signaling, ErbB/HER signaling, mTOR signaling, NF-kappaB signaling or Jak/Stat (IL-6) receptor signaling; [0048] Interact (e.g., in-vivo, or as determined by laboratory procedures such as yeast 2-hybrid or affinity purification/mass spectrometry) with a given protein or at least one protein from a (e.g. functional) class of proteins. For example, interact with KRas or with a kinase (e.g., (ABL, BCL-ABL, SRC, KIT, PLK, CDKs, PLK, Aurora, MAPKs, JAKs, FLTs or EGFR); [0049] Associated with a given disease (e.g. hits from genome-wide association studies GWAS), such as cancer. For example, as BRCA1 and/or BRCA2 is associated with breast cancer, or as JAK2 is associated myeloproliferative neoplasms (Stadler et al 2010, J Clin Oncol 28:4255); [0050] Hits from functional screens e.g. CRISPR, RNAi, gene-trapping, mutagenesis, cDNA screens, PROTEINi screens.
[0051] In another embodiment, the invention provides a library of (e.g. synthetic) nucleic acids in accordance with the invention, wherein each nucleic acid encodes a different peptide. Suitably, the mean number of nucleic acids that encode a (e.g. different) peptide from the naturally occurring proteins is greater than 1; in particular between about 1.01 and 1.5 such nucleic acids (peptides) per such protein (such as about 1.02, 1.05, 1.1, 1.2, 1.3 or 1.4), or is at least about 10 (or 2 or 5) nucleic acids (peptides) per such protein, in particular wherein the mean is between about 5 and about 2,000 such nucleic acids (peptides) per such protein or is between about 5 and about 1,000 such nucleic acids (peptides) per such protein (or between about 100 and about 1,500, or between about 250 and about 1,000; in particular between about 5 and about 100 or about 5 and about 50) such nucleic acids (peptides) per such protein. In some embodiments, the mean number of nucleic acids may be up to at least 500 nucleic acids, although it will be appreciated that the number of nucleic acids encoding different peptides for any particular protein will depend on the size of the protein as well as the size of the window by which the amino acid sequences are spaced. In a related embodiment, the invention provides a library of (e.g. synthetic) nucleic acids in accordance with the invention, wherein 95% of the naturally occurring proteins represented therein are represented by between about 2 and about 20 (such as between about 3 and about 35 or 40) peptide sequences.
[0052] In another embodiment, there is provided a library of (e.g. synthetic) nucleic acids in accordance with the invention, wherein the amino acid sequence of the naturally occurring protein is one selected from the group of amino acids sequences of proteins comprised in a reference proteome; in particular wherein the amino acid sequence of the naturally occurring protein is one selected from the group of amino acids sequences of (e.g., non-redundant) proteins comprised in a reference proteome.
[0053] In another embodiment, the reference proteome is one or more of the reference proteomes selected from the group of reference proteomes listed in any of Table A and/or Table B herein, or any updated versions of the proteomes listed therein.
[0054] In another embodiment, the amino acid sequences of the plurality of encoded peptides are sequence regions selected from amino acid sequences of naturally occurring proteins (or polypeptide chains or domains thereof) with a known three-dimensional structure; in particular wherein the naturally occurring protein (or polypeptide chain or domain thereof) is comprised in the Protein Data Bank (https://www.wwpdb.org), and optionally that has a Pfam annotation (http://pfam.xfam.org). In another embodiment, the sequence region selected from the amino acid sequence of the protein does not include an ambiguous amino acid of such amino acid sequence comprised in the reference proteome or the Protein Data Bank.
[0055] Suitably, the organism or species from which the amino acid sequence of a naturally occurring protein is selected to generate the (synthetic) nucleic acid library in accordance with the invention is Homo sapiens.
[0056] In another embodiment, the different naturally occurring proteins used to generate the library of (e.g. synthetic) nucleic acids in accordance with the invention are naturally occurring proteins of a plurality of different organisms or species. Suitably, a plurality of different species is selected from the group of (micro)organism species listed in Table A; in particular wherein the plurality of different species comprises at least 2, 3 or 5 (micro)organism species (such as at least about 10, 20, 25, or 50) across at least 2 (such as from at least about 3 or 5) of the phyla listed in Table A.
[0057] In another embodiment, a plurality of different species is selected from the group of species listed in Table B, in particular wherein the plurality of different species comprises at least 2, 3, 5 or 10 (such as at least about 20, 50, 100, 200, 300 or over 400) species listed in Table B, across at least about 3, 5 or 5 (in particular, across at least 5 or 6) of the sections of such table described therein as: archaea, bacteria, fungi, invertebrates, plants, protozoa, mammals and non-mammalian vertebrates.
[0058] Suitably, the plurality of different organisms or species is at least 10, 20, 50, 100 (in particular) or 250 different organisms or species. In some embodiments, the plurality may include up to about 20, 50, 100, 250 or 500 different organisms or species. Accordingly, a high diversity within the library may be achieved.
[0059] In another embodiment, the different naturally occurring proteins used to generate the library of (e.g. synthetic) nucleic acids in accordance with the invention are naturally occurring proteins that are differentially expressed between two or more different cell populations (e.g. cell types) or tissue types. For example, the different naturally occurring proteins may be differentially expressed between a diseased and normal cell or tissue types; in particular wherein the different naturally occurring proteins are differentially expressed between human cancer cells and non-cancerous human cells, for example. In further embodiments, the different naturally occurring proteins are disease-specific; in particular wherein the different naturally occurring proteins are expressed by human cancer cells but not by non-cancerous human cells. In another embodiment, the different naturally occurring proteins may be differentially expressed between one cell population that has been infected by a pathogen or treated with a substance (such as a pathogenic substance or a drug) and a second cell population of the corresponding cell type that has not been so treated (or treated differently). For example, an inflammatory phenotype may be induced in a cell line by treatment with a pro-inflammatory substance such as phorbol myristate (PMA) and naturally occurring proteins that are differentially expressed in such treated population of cells compared to non-treated cells are considered. In another example differentially expressed naturally occurring proteins may be identified by comparison of protein expression between immune cells that have become exhausted (T cell exhaustion) compared to proficient immune cells (e.g. T cells).
[0060] In another embodiment, the library of (e.g. synthetic) nucleic acids in accordance with the invention is one in which the plurality of encoded peptides have diverse sequences; in particular wherein the plurality of encoded peptides differ in amino acid sequence from one another by at least 2 or 3 amino acids; in particular wherein the plurality of encoded peptides differ in amino acid sequence from one another by at least about 5, 8 or 10 amino acids. Suitably, the library of (synthetic) nucleic acids is one in which the diversity of the plurality of encoded peptides have a sequence similarity of less than about 90% or 80%; in particular have a sequence similarity of less than about 70%, 60% or 50%. Such sequence similarity may be determined using hierarchical clustering with CD-HIT (Fu et al 2012, Bioinformatics 28:3150; http://weizhongli-lab.org/cd-hit/). Suitable parameters for this are described in the Examples section herein.
[0061] In another embodiment the peptides encoded by the library in accordance with the invention are predicted not to contain disordered regions; in particular wherein the prediction is as determined by SLIDER (Super-fast predictor of proteins with long intrinsically disordered regions; Peng et al, 2014; Proteins: Structure, Function and Bioinformatics 82:145; http://biomine.cs.vcu.edu/servers/SLIDER) and/or DISEMBL (Linding et al 2003, Structure 11:1453; http://dis.embl.de). Suitable parameters for this are described in the Examples section herein.
[0062] In another embodiment, the peptides encoded by the library in accordance with the invention are predicted to have an isoelectric point (pI) of less than about 6 and greater than about 8. Suitable examples of using the “pI” function of “R Peptide package” are described in the Examples section, herein.
[0063] In another embodiment, at least about 30%, 40% or 50% of the amino acid sequences of the peptides encoded by the library in accordance with the invention are identical to a peptide in a different organism; in particular between about 30% and 70% of the amino acid sequences of the peptides encoded by the library in accordance with the invention are identical to a peptide in a different organism.
[0064] In a further embodiment, each nucleic acid within the library in accordance with the invention encodes for a peptide of the same length. It would be understood by the skilled person that this may include some limited variability. In other embodiments, the encoded peptide has a length of: between about 25 and about 100, 90, 85, 80, 75, 70, 65, 60, 55, 50 or 45; between about 30 and 110; between about 30 and about 100, 90, 85, 80, 75, 70, 65, 60, 55 or 50; between about 30 and about 100, 90, 85, 80, 75, 70, 65, 60 or 55; in particular wherein the encoded peptide has a length of between 30 and about 75; more particularly wherein the encoded peptide has a length of between about 35 and about 70 or between about 35 and about 50; and most particularly wherein the encoded peptide has a length of the encoded peptide that is between 35 and 60 amino acids, such as is 42, 43, 44, 45, 46, 47 or 48 amino acids in length. Suitably, the length of the peptides encoded by the library in accordance with the invention will be determined by practical considerations such as the maximum limit of the oligonucleotide synthesis technique used (and taking into account the additional features added, as described herein, for example). Suitably, in the library of (synthetic) nucleic acids in accordance with the invention, the coding region encoding for the peptide uses the human codon frequency table set forth in Table 1.1. However, alterative human codon frequency tables may be used or, and depending on the species of the expression system in which the nucleic acid library is intended to be expressed, codon frequency tables of other species may be used. In one embodiment, the most frequent human codon is used to encode amino acids of the peptide. Accordingly, at least a portion of the nucleic acid sequences will be not the natural genomic sequence. Such sequences may also be modified further. In further embodiments, an alternative human codon is used to encode one or more amino acids of the peptide.
[0065] Suitably, “undesirable sequences or sub-sequences” are excluded from the library in accordance with the invention. Such “undesirable sequences or sub-sequences” may include, for example, those sequences made from combinations of codons. Particular examples of such undesired sub-sequence include an internal Kozak sequence and/or a restriction enzyme site for a restriction enzyme intended to be used for the cloning of the resulting library, in each case generated from a combination of codons. Such undesirable sequences or sub-sequences can be avoided by using the next most commonly used (or another) codon in place of one or other of the codons in the combination. Thus, suitably, in the library of (synthetic) nucleic acids in accordance with the invention, the coding region does not contain a combination of codons that forms an internal Kozak sequence. The person of ordinary skill will understand the term “Kozak sequence” and such meaning can include a sequence of nucleotide bases identified by the notation “(gcc)gccRccAUGG”, where: (i) a lower-case letter denotes the most common base at a position where the base can nevertheless vary; (ii) upper-case letters indicate highly conserved bases, i.e. the “AUGG” sequence is constant or rarely, if ever, changes, with the exception being the IUPAC ambiguity code “R” which indicates that a purine (adenine or guanine) is always observed at this position (with adenine being believed to be more frequent); and (iii) the sequence in brackets “(gcc)” is of uncertain significance. In particular embodiments, a Kozak sequence is “CCATGG”.
[0066] In some embodiments of the library of nucleic acids of the invention, the following sequences are also undesirable sequences or subsequences: “GGATCC” “CTCGAG”, “GGGGGG”, “AAAAAA”, “TTTTTT”, “CCCCCC”, sequences that cause issues with oligonucleotide synthesis or sequencing or PCR amplification, hairpin sequences, an in-frame STOP codon (except at the terminus).
[0067] In another embodiment, each nucleic acid in the library in accordance with the invention further comprises one or more nucleic acid sequences 5′ and/or 3′ of the coding region that include at least one restriction enzyme recognition sequence; optionally with a linker nucleic acid sequence between the coding region and the restriction enzyme recognition sequence(s). Suitably, the coding region does not contain a combination of codons that forms the restriction enzyme recognition sequence(s) that is(are) included in the 5′ and/or 3′ nucleic acid sequence(s). As described above, this can be avoided by using the next most commonly used codon in place of one or other of the codons in the combination.
[0068] The nucleic acid library of the present invention (including also those embodiments where it is (e.g., initially) comprised by a synthetic nucleic acid library) may be amplified, propagated or otherwise maintained by non-chemical processes. For example, such library may be amplified by in-vitro enzymatic (e.g. biological) processes such as PCR or in-vitro transcription/translation; or may be replicated (and/or propagated/maintained) in-vivo processes such as being cloned into a vector which is replicated in a host cell (e.g., a bacterial or mammalian host cell).
[0069] In another embodiment, each nucleic acid in the library in accordance with the invention further comprises additional sequences to enable amplification of the nucleic acid sequence (suitably, in each case not within the coding region that encodes for the peptide, such as 5′ and/or 3′ of the coding region and, optionally, the restriction enzyme recognition sequence(s)); in particular wherein such amplification is by PCR amplification.
[0070] In another embodiment, each nucleic acid in the library in accordance with the invention is cloned into a vector. The term “vector” will be art recognized, and includes the meaning of a nucleic acid that can be used to propagate, produce, maintain or introduce a nucleic acid comprised within it in/into a cell, such as for expression of a peptide or polypeptide encoded by a sequence comprising said nucleic acid. One type of vector is a plasmid, which refers to a linear or circular double-stranded DNA molecule into which additional nucleic acid segments can be ligated. Another type of vector is a viral vector (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), wherein additional DNA segments can be introduced into the viral genome. Certain vectors are capable of autonomous replication in a cell, such as host cell, into which they are introduced (e.g., bacterial vectors comprising a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) integrate into the genome of a cell upon introduction into the cell and culturing under selective pressure, and thereby are replicated along with the genome. A vector can be used to direct the expression of a chosen peptide or polynucleotide in a cell; in particular a peptide encoded by a nucleic acid comprised in the library of the present invention. Suitably, when used to express a peptide of the present invention in a eukaryotic cell (such as a mammalian cell), the vector is a lentiviral vector, or is retroviral vector.
[0071] Suitably, each nucleic acid further comprises a start codon, a Kozak sequence, a stop codon and/or a nucleic acid sequence encoding a peptide tag, or wherein the vector comprises a start codon, a Kozak sequence, a stop codon and/or a nucleic acid sequence encoding a peptide tag operatively linked to the nucleic acid. Suitably, a peptide tag, if included, is one selected from the group consisting of: V4, FLAG, Strep/HA and GFP; in particular where the tag is a V4 tag or a FLAG tag.
[0072] In one embodiment, each nucleic acid is suitable for or capable of expressing a polypeptide comprising the encoded peptide.
[0073] In another embodiment, the polypeptide comprises the encoded peptide and further comprises an N-terminal methionine, one or more additional amino acids encoded by one or more restriction enzyme recognition sequence, and/or one or more peptide tags.
[0074] In another embodiment, the individual members (or subsets of members) of the library of (e.g. synthetic) nucleic acids in accordance with the invention are in a pooled format (or form). Suitably, a library of the present invention in “pooled format” (or “pooled form”) includes those where the individual members (or subset of members) thereof are in admixture with other members (or subsets); for example, a solution (or dried precipitate thereof) of such members contained in a single vessel, or a population of host cells containing recombinant vectors of the present invention.
[0075] Suitably, the individual members (or sub-sets of members) in the library in accordance with the invention are spatially separated. A “spatially separated” library can be considered as a library in which a plurality of members (or sub-sets of members) of the library are physically separated, suitably in an ordered manner, from each other. Examples of a spatially separated library include those where individual members (or sub-sets of members) are comprised in individual wells of one or more mictrotitre plates, are arrayed on a solid surface or are bound (in an ordered manner) to a silicon wafer. In another embodiment, individual members (or sub-sets of members) in the library in accordance with the invention are each individually addressable; that is they can be retrieved (e.g. without undue searching or screening) from the library. Suitable methods for addressing or interrogating the library in accordance with the invention may include Next Generation Sequencing (NGS), PCR etc. Also, when the library is present in a spatially separated format (or form), the individual members (or sub-sets of members) may be “individually addressable” by knowing the spatial location of the applicable individual member (or sub-set). In either of these embodiments, use of a computer program, data file or database (such as those utilising a computer-readable medium or data-processing system, of the invention) can facilitate the retrieval of individual members (or sub-sets of members) that are comprised in an individually addressable library of the invention.
[0076] Suitably, a library of the present invention is not generated from cDNA.
[0077] In another aspect, the invention provides a library of peptides encoded by the library of (e.g. synthetic) nucleic acids in accordance with the invention. Suitably, the peptides are synthetic or recombinant. In one embodiment, the individual members (or subsets of members) thereof are in a pooled format (or form). In another embodiment, the individual members (or subsets of members) thereof are spatially separate and or individually addressable.
[0078] In certain embodiments, any library of (synthetic) nucleic acids of the present invention may be comprised in an admixture with, may be an adjunct to (or otherwise combined with) or may be used together with, another library of nucleic acids that encode for peptides having a length of between about 25 and about 110 amino acids. For example, such other library may be one described in co-pending application PCT/GB2016/054038 (the contents of which are incorporated herein by reference); in particular, such a library that encodes small Open Reading Frames (sORFs) such as that encodes at least 500, 1000, 1500 or about 2000 human sORFs.
[0079] Accordingly: (1) any library of peptides of the present invention may also be comprised in an admixture with, may be an adjunct to (or otherwise combined with) or may be used together with, another library of peptides that is encoded by such other library of nucleic acids; and (2) the uses, methods and processes involving a nucleic acids or peptide library of the present invention, can also involve its use in admixture with, as an adjunct to (or otherwise combined with) or use together with such other library of nucleic acids or peptides (respectively). For example, Example 4 herein, describes a screen using both a “HuPEx” library of the present invention optionally with a human sORF library described in PCT/GB2016/054038.
[0080] In some embodiments, the library of peptides is not a T7 display library, or is not a phage display library, or is not a display library. In some embodiments, the library is not a plurality of peptides derived from a plurality of (e.g. human) pathogens, such as from a plurality of viruses, bacteria or fungi that are, for example pathogenic to humans.
[0081] In another aspect, there is provided a container or carrier comprising the library of (e.g. synthetic) nucleic acids in accordance with the invention and/or comprising the library of peptides in accordance with the invention. Suitable containers include a vessel, (such as an Eppendorf tube), a microtiter plate or a silicon carrier.
[0082] In another aspect, the invention also relates to a method of identifying at least one binding partner of a binding interaction between a peptide comprised in a library of the present invention to a target (in particular, to a protein target), the method comprising the steps of [0083] Exposing a peptide library of the invention to the target under conditions permitting binding between the target and at least one peptide of the library; and [0084] Identifying the binding peptide or the bound target.
[0085] In certain embodiments, the peptide library is exposed to the target by providing a library of nucleic acids of the invention in a form (e.g. in host cells) and under conditions such that the library of peptides is expressed by the library of nucleic acids.
[0086] In another aspect (or embodiment of the above), the invention provides a method to identify the target and/or peptide; including, for example, elution of the peptide/nucleic acid, selection for cells expressing the peptide followed by e.g. PCR and sequencing identification. The target may be identified by, for example, pull-down mass-spectrometry. Such methods are described elsewhere herein, in PCT/GB2016/054038 and/or WO2013/116903.
[0087] In a particular aspect, the invention also relates to a method of identifying a target protein that modulates a phenotype of a mammalian cell, said method comprising exposing a population of in vitro cultured mammalian cells capable of displaying said phenotype to a library of nucleic acids of the present invention (or a library of peptides of the present invention), identifying in said cell population an alteration in said phenotype following said exposure, selection of said cells undergoing the phenotypic change and identifying a peptide encoded by (or a peptide of) such library that alters the phenotype of the cell, providing said peptide and identifying the cellular protein that binds to said peptide, said cellular protein being a target protein that modulates the phenotype of the mammalian cell. Suitable methods and phenotypic screens are described, for example, in PCT/GB2016/054038, and the technical features described therein for such methods and screens, but using a library of the present invention, are incorporated herein by reference.
[0088] In certain embodiments, such method includes a further step of identifying a compound that binds to said target protein and displaces or blocks binding of said peptide. Such further step, thereby identifying a compound which binds to a target protein and displaces or blocks binding of said peptide wherein the compound modulates the phenotype of a mammalian cell.
[0089] Accordingly, in another particular aspect, the invention also relates to a method of identifying a compound which binds to a target protein and displaces or blocks binding of a peptide wherein the compound modulates a phenotype of a mammalian cell, said method comprising the steps: [0090] i. exposing a population of in vitro cultured mammalian cells capable of displaying said phenotype to a library of nucleic acids of the present invention or a library of peptides of the present invention; [0091] ii. identifying a cell in the population that displays an alteration in said phenotype following said exposure; [0092] iii. identifying a peptide encoded by (or of) such library that alters said phenotype of the cell; [0093] iv. identifying a cellular protein that binds to said peptide, said cellular protein being a target protein that modulates said phenotype of the mammalian cell; [0094] v. identifying a compound that binds to said target protein and displaces or blocks binding of said peptide.
[0095] In one other aspect, the invention relates to a use of: (a) a library of nucleic acids according to the present invention; and/or (b) a library of peptides according to the present invention, to identify a peptide that binds to a target (in particular, a protein target). In certain embodiments, the identified peptide modulates a phenotype of a mammalian cell.
[0096] In another other aspect, the invention relates to a use of: (a) a library of nucleic acids according to the present invention; and/or (b) a library of peptides according to the present invention, to identify a target (in particular, a protein target) that modulates a phenotype of a mammalian cell.
[0097] In yet another other aspect, the invention relates to a use of: (a) a library of nucleic acids according to the present invention; and/or (b) a library of peptides according to the present invention, to identify a compound which binds to a target (in particular, a protein target) and, optionally, that displaces or blocks binding of a peptide to the target. In certain embodiments, the peptide and/or the compound modulates a phenotype of a mammalian cell.
[0098] Suitably in such aspects, methodologies for performing phenotypic screens using libraries (or peptides) of the present invention can range from: (1) pathway-specific readouts that use heterologous reporters (for example GFP or Luciferase) to register either total protein levels, protein localisation or ultimate pathway activity at the level of gene transcription in live cells; (2) registering endogenous protein levels, or their localisation, using antibodies or other affinity reagents, or pathway-specific transcriptional outputs using qPCR or RNA-sequencing in fixed ‘non-living’ cells; (3) high-content, or ‘holistic’ based readouts in live cells that are capable of registering specific ‘destination’ phenotypic readouts of therapeutic relevance, such as differentiation, senescence and cell-death, all of which are coordinated and can be specifically modulated by a complex interplay of multiple cellular pathways. In some embodiments of the invention the assay readout method uses a GFP reporter, for instance as described in Kaizuka et al Molecular Cell 2016.
[0099] In a specific aspect of the invention that covers ‘holistic’ phenotypic assays, Synthetic Lethality screening is of particular importance. Synthetic Lethality screening is an approach in which targets, for instance cancer targets, and candidate therapeutics are sought that can selectively impact tumour cells versus normal cells by exploiting unpredictable secondary points of weakness, which can occur in tumour cells as they heavily rewire their signalling pathways to support unrestrained cell proliferation. Such screens therefore must be performed in live cells and in an unbiased fashion by suppressing or modulating genes (using CRISPR), mRNA (using RNAi), or protein, or protein conformation (using Protein-i) in the cell and then determining whether a consistent negative impact on the overall growth or survival of a tumour cell type occurs; preferably one that harbours a specific genetic alteration(s) that occurs in a tumour situation versus a normal cell type. These direct ‘holistic’ cell-viability output based screens are performed using either large panels of genetically characterised tumour cells and normal cells to gain correlative information on tumour genotype-dependent responses, or more efficiently using specifically-engineered cell lines that are isogenic for a chosen mutant versus normal genotype that exists in cancer cells versus normal cells, respectively.
[0100] Suitably, in certain embodiments of uses and method of the present invention—that involve the inventive libraries described herein—related to phenotypes related to the modulation of cell-signalling pathways; in particular uses or method that involve the identification of peptides (e.g., from the libraries of the present invention) which modulate cell-signalling pathways and the identification of protein targets and surface sites on such proteins that participate in signal transduction and may be useful as drug targets to modulate cell-signalling pathways, in particular pathways which are active in cancer cells.
[0101] A cell signalling pathway is, suitably, a series of interacting factors in a cell that transmit an intracellular signal within the cell in response to an extracellular stimulus at the cell surface and leading to changes in cell phenotype. Transmission of signals along a cell signalling pathway typically results in the activation of one or more transcription factors which alter gene expression. Preferred cell signalling pathways for uses, methods or screens related to the present invention display aberrant activity in disease models, for example activation, up-regulation or mis-regulation in diseased cells, such a cancer cells. For example, a pathway may be constitutively activated (i.e. permanently switched on) in a cancer cell, or inappropriately activated by an extracellular ligand, for example in an inflammatory cell in rheumatoid arthritis.
[0102] A functional cell signalling pathway is typically considered as a pathway that is intact and capable of transmitting signals, if the pathway is switched on or activated, for example by an appropriate extracellular stimulus. An active cell-signalling pathway is typically considered a pathway that has been switched on, for example by an appropriate extracellular stimulus and is actively transmitting signals.
[0103] Suitable cell signalling pathways include any signalling pathway that results in a transcriptional event in response to a signal received by a cell.
[0104] Cell signalling pathways for investigation as described herein may include cell-signalling pathways that may be activated or altered in cancer cells, such as Ras/Raf, 20 Hedgehog, Fas, Wnt, Akt, ERK, TGFβ, EGF, PDGF, Met, PI3K and Notch signalling pathways.
[0105] In yet another aspect, the invention relates to a computer-readable medium (for example, one for use in—e.g., one specifically adapted for use in—a screening method described herein) having information stored thereon comprising: (a) the nucleic acid sequences comprised in a library of nucleic acids of the present invention; and/or (b) the amino acid sequences of the peptides encoded by said nucleic acids.
[0106] In a related aspect, the invention relates to a data-processing system (for example, one for use in—e.g., one specifically adapted for use in—a screening method described herein) storing and/or processing information comprising: (a) the nucleic acid sequences comprised in a library of nucleic acids of the present invention; and/or (b) the amino acid sequences of the peptides encoded by said nucleic acids.
[0107] In view of the above, it will be appreciated that the present invention also relates to the following items:
Item 1: A library of nucleic acids as described in the first aspect of the invention, wherein the species of the organism is Homo sapiens.
Item 2: The library of nucleic acids according to item 1, wherein the different naturally occurring proteins are naturally occurring proteins of a plurality of organisms of different species.
Item 3: The library of nucleic acids according to item 2, wherein a plurality of different species is selected from the group of (micro) organism species listed in Table A; in particular wherein the plurality of different species comprises at least 20 (micro)organism species across at least 5 of the phyla listed in Table A.
Item 4: The library of nucleic acids according to item 2, wherein a plurality of different species is selected from the group of species listed in Table B, in particular wherein the plurality of different species comprises at least 50 of the species listed in Table B across at least 5 of the sections of Table B described therein as: archaea, bacteria, fungi, invertebrates, plants, protozoa, mammals and non-mammalian vertebrates.
Item 5: The library of nucleic acids according to any of items 2 to 4, wherein the plurality of different organisms is at least 100 different organisms.
Item 6: The library of nucleic acids according to any of items 1 to 4, wherein the different naturally occurring proteins are those that are differentially expressed between two or more different cell populations or tissue types.
Item 7: The library of nucleic acids according to item 6, wherein the different naturally occurring proteins are differentially expressed between a diseased and normal cell or tissue types; in particular wherein the different naturally occurring proteins are differentially expressed between human cancer cells and non-cancerous human cells.
Item 8: The library of nucleic acids according items 6 or 7, wherein the different naturally occurring proteins are disease-specific; in particular wherein the different naturally occurring proteins are expressed by human cancer cells but not by non-cancerous human cells.
Item 9: The library of nucleic acids according to any of items 1 to 8, wherein the plurality of encoded peptides have diverse sequences; in particular wherein the plurality of encoded peptides differ in amino acid sequence from one another by at least 2 or 3 amino acids; in particular wherein the plurality of encoded peptides differ in amino acid sequence from one another by at least about 5, 8 or 10 amino acids.
Item 10: The library of nucleic acids according to item 9, wherein the sequence similarity of the plurality of encoded peptides is less than about 80%.
Item 11: The library of nucleic acids according to any of items 1 to 10, wherein the peptides are predicted not to contain disordered regions.
Item 12: The library of nucleic acids according to any of items 1 to 11, wherein the peptides are predicted to have an isoelectric point (pI) of less than about 6 and greater than about 8.
Item 13: The library of nucleic acids according to any of items 1 to 12, wherein at least about 40% of the amino acid sequences of the peptide are identical to a peptide in a different organism.
Item 14: The library of nucleic acids according to any of items 1 to 13, wherein each nucleic acid encodes for a peptide of the same length.
Item 15: The library of nucleic acids according to any of items 1 to 14, wherein the encoded peptide has a length that is between 35 and 60 amino acids, such as is 42, 43, 44, 45, 46, 47 or 48 amino acids in length.
Item 16: The library of nucleic acids according to any of items 1 to 15, wherein the coding region encoding for the peptide uses the human codon frequency table set forth in Table 1.1.
Item 17: The library of nucleic acids of item 16, wherein the most frequent human codon is used to encode amino acids of the peptide.
Item 18: The library of nucleic acids of items 16 or 17, wherein an alternative human codon is used to encode one or more amino acids of the peptide.
Item 19: The library of nucleic acids according to any of items 1 to 18, wherein the coding region does not contain a combination of codons that forms an internal Kozak sequence; in particular wherein the Kozak sequence is ccatgg.
Item 20: The library of nucleic acids according to any of items 1 to 19, wherein each nucleic acid further comprises one or more nucleic acid sequences 5′ and/or 3′ of the coding region that include at least one restriction enzyme recognition sequence; optionally with a linker nucleic acid sequence between the coding region and the restriction enzyme recognition sequence(s).
Item 21: The library of nucleic acids according to item 20, wherein the coding region does not contain a combination of codons that forms the restriction enzyme recognition sequence(s) that is (are) included in the 5′ and/or 3′ nucleic acid sequence(s).
Item 22: The library of nucleic acids according to any of items 1 to 21, wherein each nucleic acid further comprises additional sequences to enable amplification of the nucleic acid sequence; in particular wherein such amplification is by PCR amplification.
Item 23: The library of nucleic acids according to any of items 1 to 22, wherein each nucleic acid is cloned into a vector.
Item 24: The library of nucleic acids according to any of items 1 to 23, wherein each nucleic acid further comprises a start codon, a Kozak sequence, a stop codon and/or a nucleic acid sequence encoding a peptide tag, or wherein the vector comprises a start codon, a Kozak sequence, a stop codon and/or a nucleic acid sequence encoding a peptide tag operatively linked to the nucleic acid.
Item 25: The library of nucleic acids of item 24, wherein each nucleic acid is suitable for or capable of expressing a polypeptide comprising the encoded peptide.
Item 26: The library of nucleic acids of item 25, wherein the polypeptide comprises the encoded peptide and further comprising an N-terminal methionine, one or more additional amino acids encoded by one or more restriction enzyme recognition sequence, and/or one or more peptide tags.
Item 27: The library of nucleic acids according to any of items 1 to 26, wherein the individual members thereof are in a pooled format.
Item 28: The library of nucleic acids according to any of items 1 to 27, wherein the individual members thereof are spatially separated.
Item 29: A library of peptides, encoded by the library of nucleic acids as described in another aspect of the invention, suitably according to any of items 1 to 28.
Item 30: The library of peptides of item 29, wherein the peptides are synthetic or recombinant.
Item 31: The library of peptides of item 29, wherein the individual members thereof are in a pooled format.
Item 32: The library of peptides of item 29, wherein the individual members thereof are spatially separated.
Item 33: A container or carrier comprising the library of nucleic acids as described in another aspect of the invention, suitably according to any of items 1 to 33.
Item 33a: A container or carrier comprising the library of peptides as described in another aspect of the invention, suitably according to any of items 30 to 32.
Item 34: The container or carrier of item 33 or 33a that is a microliter plate or a silicon carrier.
Item 35: A method of identifying at least one binding partner of a binding interaction between a peptide that is: (a) comprised in a library as described in another aspect of the invention, suitably according to item 29 to 32, or (b) is expressed by a library of nucleic acids as described in another aspect of the invention, suitably according to any of items 1 to 28, to a protein target; the method comprising the steps of: [0108] exposing the invention to the protein target under conditions permitting binding between the target and at least one peptide of or expressed by the library; and [0109] identifying the binding peptide or the bound target.
Item 36: A use of a library of nucleic acids as described in another aspect of the invention, suitably according to any of items 1 to 28, to identify a peptide that binds to a target protein; in particular wherein the peptide modulates a phenotype of a mammalian cell.
Item 37: A use of a library of nucleic acids as described in another aspect of the invention, suitably according to any of items 1 to 28, to identify a target protein that modulates a phenotype of a mammalian cell.
Item 38: A computer-readable medium having information stored thereon comprising: (a) the nucleic acid sequences comprised in a library of nucleic acids as described in another aspect of the invention, suitably according to any of items 1 to 28; and/or (b) the amino acid sequences of the peptides encoded by said nucleic acids.
Item 39: A data-processing system storing and/or processing information comprising: (a) the nucleic acid sequences comprised in a library of nucleic acids as described in another aspect of the invention, suitably according to any of items 1 to 28; and/or (b) the amino acid sequences of the peptides encoded by said nucleic acids.
[0110] In view of the above, it will be appreciated that the present invention also relates to the following clauses:
Clause 1: A library of nucleic acids, each nucleic acid comprising a coding region of defined nucleic acid sequence encoding for a peptide having a length of between 25 and 110 amino acids, and having an amino acid sequence being a region of a sequence selected from the amino acid sequence of a naturally occurring protein of one or more organisms; wherein the library comprises nucleic acids that encode for a plurality of at least 10,000 different such peptides, and wherein the amino acid sequence of each of at least 50 of such peptides is a sequence region of the amino acid sequence of a different protein of a plurality of different such naturally occurring proteins.
Clause 2: The library of nucleic acids of clause 1, wherein each of the plurality of different naturally occurring proteins fulfils one or more pre-determined criteria.
Clause 3: The library of nucleic acids of clause 2, wherein each of the plurality of naturally occurring proteins is associated with a given disease, such as cancer.
Clause 4: The library of nucleic acids of clause 3, wherein the disease is breast cancer.
Clause 5: The library of nucleic acids of clause 2, wherein each of the plurality of naturally occurring proteins is a cytoplasmic protein.
Clause 6: The library of nucleic acids of clause 5, wherein each of the plurality of naturally occurring proteins is a cytoplasmic kinase.
Clause 7: The library of nucleic acids of clause 2, wherein each of the plurality of naturally occurring proteins interacts with a given protein or at least one protein from a (functional) class of proteins.
Clause 8: The library of nucleic acids of clause 7, wherein each of the plurality of naturally occurring proteins interacts with KRas.
Clause 9: The library of nucleic acids of any one of clauses 1 to 8, wherein the library comprises nucleic acids that encode for a plurality of at least 50,000 different such peptides, and wherein the amino acid sequence of each of at least 100 of such peptide is a sequence region of the amino acid sequence of at least 100 different naturally occurring proteins; in particular wherein the library comprises nucleic acids that encode for a plurality of at least 100,000 different such peptides, and wherein the amino acid sequence of each of at least 150 of such peptide is a sequence region of the amino acid sequence of at least 150 different naturally occurring proteins.
Clause 10: The library of nucleic acids of any one of clauses 1 to 9, wherein the library comprises nucleic acids that encode for a plurality of at least 10,000 different such peptides, and wherein the amino acid sequence of each of at least 1,000 of such peptides is a sequence region of the amino acid sequence of a different protein of such plurality of different naturally occurring proteins.
Clause 11: The library of nucleic acids of any one of clauses 1 to 10, wherein the library comprises nucleic acids that encode for a plurality of at least 200,000 different such peptides, and wherein the amino acid sequence of each of at least 20,000 of such peptide is a sequence region of the amino acid sequence of at least 20,000 different naturally occurring proteins; in particular wherein the library comprises nucleic acids that encode for a plurality of at least 300,000 different such peptides, and wherein the amino acid sequence of each of at least 25,000 of such peptide is a sequence region of the amino acid sequence of at least 25,000 different naturally occurring proteins.
Clause 12: The library of nucleic acids of any one of clauses 1 or 11, wherein that in respect of at least about 1% of the naturally occurring proteins a plurality of the nucleic acids encodes for different peptides from the amino acid sequences of such naturally occurring proteins.
Clause 13: The library of nucleic acids of clause 12, wherein that in respect of at least about 50% of the naturally occurring proteins a plurality of the nucleic acids encodes for different peptides from the amino acid sequences of such naturally occurring proteins.
Clause 14: The library of nucleic acids of clause 13, wherein the plurality of the nucleic acids encodes for different peptides, and the amino acid sequences of which are sequence regions spaced along the amino acid sequence of the naturally occurring protein.
Clause 15: The library of nucleic acids of clause 14, wherein the sequence regions are spaced by a window of amino acids apart, or by multiples of such window, along the amino acid sequence of the naturally occurring protein wherein, the window is between 1 and about 55 amino acids; in particular wherein the window is between about 5 and about 20 amino acids; most particularly wherein the window of spacing is about 8, 10, 12 or 15 amino acids.
Clause 16: The library of nucleic acids of any one of clauses 1 to 14 comprising nucleic acids encoding for at least 100,000 different peptides from at least 10,000 different naturally occurring proteins.
Clause 17: The library of nucleic acids of any one of clauses 1 to 16, wherein each nucleic acid encodes a different peptide.
Clause 18: The library of nucleic acids of any one of clauses 1 to 17, wherein the mean number of nucleic acids that encode a different peptide from the naturally occurring proteins is greater than 1; in particular between about 1.01 and 1.5 such nucleic acids (peptides) per such protein.
Clause 19: The library of nucleic acids of clause 18, wherein the mean number of nucleic acids that encode a different peptide from the naturally occurring proteins is at least about 5 such nucleic acids (peptides) per such protein, in particular wherein the mean is between about 5 and about 2,000 such nucleic acids (peptides) per such protein or is between about 5 and about 1,000 nucleic acids (peptides) per such protein.
Clause 20: The library of nucleic acids of clause 19, wherein the mean number of nucleic acids that encode a different peptide from the naturally occurring proteins is between about 100 and about 1,500 such nucleic acids (peptides) per such protein or is between about 250 and about 1,000 such nucleic acids (peptides) per such protein.
Clause 21: The library of nucleic acids of claim 20, wherein the mean number of nucleic acids that encode a different peptide from the naturally occurring proteins is between about 5 and about 100 such nucleic acids (peptides) per such protein or is between about 5 and about 50 such nucleic acids (peptides) per such protein.
Clause 22: The library of nucleic acids of any one of clauses 1 to 21, wherein the amino acid sequence of the naturally occurring protein is one selected from the group of amino acids sequences of non-redundant proteins comprised in a reference proteome, suitably, the reference proteome is one or more of the reference proteomes selected from the group of reference proteomes listed in Table A and/or Table B, or an updated version of such reference proteome.
Clause 23: The library of nucleic acids of any one of clauses 1 to 22, wherein the amino acid sequences of the plurality of encoded peptides are sequence regions selected from amino acid sequences of naturally occurring proteins (or polypeptide chains or domains thereof) with a known three-dimensional structure; in particular wherein the naturally occurring protein (or polypeptide chain or domain thereof) is comprised in the Protein Data Bank, and optionally that has a Pfam annotation.
Clause 24: The library of nucleic acids of any one of clauses 22 to 23, wherein the sequence region selected from the amino acid sequence of the protein does not include an ambiguous amino acid of such amino acid sequence comprised in the reference proteome or the Protein Data Bank.
Clause 25: A library of peptides encoded by the library of nucleic acids of any one of clauses 1 to 24.
[0111] Suitably, the present invention is a library of nucleic acids, each nucleic acid comprising a coding region of defined nucleic acid sequence encoding for a peptide having a length of between 25 and 110 amino acids, and having an amino acid sequence being a region of a sequence selected from the amino acid sequence of a naturally occurring protein of one or more organisms; wherein the library comprises nucleic acids that encode for a plurality of at least 10,000 different such peptides, and wherein the amino acid sequence of each of at least 50 of such peptides is a sequence region of the amino acid sequence of a different protein of a plurality of different such naturally occurring proteins, and wherein the isoelectric point (pI) of each encoded amino acid sequence is greater than 7.4 or less than 6.0, and/or wherein the nucleic acid sequence does not contain the sequences “GGATCC”, and/or “CTCGAG”, and/or wherein the nucleic acid sequence does not contain the sequences “GGGGGG” and/or “AAAAAA” and/or “TTTTTT” and/or “CCCCCC” and/or wherein the nucleic acid sequence does not contain sequences that cause issues with oligonucleotide synthesis or sequencing or PCR amplification, and/or wherein the nucleic acid sequence does not contain a hairpin sequence, and/or wherein the nucleic acid sequence does not contain an in-frame STOP codon (except at the terminus) and/or wherein the nucleic acid sequence does not contain a KOZAK sequence (except at the start), i.e. does not contain an internal KOZAK sequence.
[0112] The terms “of the [present] invention”, “in accordance with the [present] invention” “according to the [present] invention” and the like, as used herein are intended to refer to all aspects and embodiments of the invention described and/or claimed herein.
[0113] As used herein, the term “comprising” is to be construed as encompassing both “including” and “consisting of”, both meanings being specifically intended, and hence individually disclosed embodiments in accordance with the present invention. Where used herein, “and/or” is to be taken as specific disclosure of each of the two specified features or components with or without the other. For example “A and/or B” is to be taken as specific disclosure of each of (i) A, (ii) B and (iii) A and B, just as if each is set out individually herein. In the context of the present invention, the terms “about” and “approximately” denote an interval of accuracy that the person skilled in the art will understand to still ensure the technical effect of the feature in question. The term typically indicates deviation from the indicated numerical value by ±20%, ±15%, ±10%, and for example ±5%. As will be appreciated by the person of ordinary skill, the specific such deviation for a numerical value for a given technical effect will depend on the nature of the technical effect. For example, a natural or biological technical effect may generally have a larger such deviation than one for a man-made or engineering technical effect. As will be appreciated by the person of ordinary skill, the specific such deviation for a numerical value for a given technical effect will depend on the nature of the technical effect. For example, a natural or biological technical effect may generally have a larger such deviation than one for a man-made or engineering technical effect. Where an indefinite or definite article is used when referring to a singular noun, e.g. “a”, “an” or “the”, this includes a plural of that noun unless something else is specifically stated.
[0114] It is to be understood that application of the teachings of the present invention to a specific problem or environment, and the inclusion of variations of the present invention or additional features thereto (such as further aspects and embodiments), will be within the capabilities of one having ordinary skill in the art in light of the teachings contained herein.
[0115] Unless context dictates otherwise, the descriptions and definitions of the features set out above are not limited to any particular aspect or embodiment of the invention and apply equally to all aspects and embodiments that are described.
[0116] All references, patents, and publications cited herein are hereby incorporated by reference in their entirety.
TABLE-US-00001 TABLE A Database source of reference proteomes of an evolutionary diverse set of microbes NCBI ID Species name Domain Phylum Class NC_000854.2 Aeropyrum pernix K1, Compl Gen Archaea Crenarchaeota Thermoprotei NC_002754.1 Sulfolobus solfataricus P2, Compl Gen Archaea Crenarchaeota Thermoprotei NC_000917.1 Archaeoglobus fulgidus DSM 4304, Compl Gen Archaea Euryarchaeota Archaeoglobi NC_006396.1 Haloarcula marismortui ATCC 43049 Chrom I, Archaea Euryarchaeota Halobacteria complete sequence NC_006397.1 Haloarcula marismortui ATCC 43049 Chrom II, Archaea Euryarchaeota Halobacteria complete sequence NC_006389.1 Haloarcula marismortui ATCC 43049 plasmid Archaea Euryarchaeota Halobacteria pNG100, complete sequence NC_006390.1 Haloarcula marismortui ATCC 43049 plasmid Archaea Euryarchaeota Halobacteria pNG200, complete sequence NC_006391.1 Haloarcula marismortui ATCC 43049 plasmid Archaea Euryarchaeota Halobacteria pNG300, complete sequence NC_006392.1 Haloarcula marismortui ATCC 43049 plasmid Archaea Euryarchaeota Halobacteria pNG400, complete sequence NC_006393.1 Haloarcula marismortui ATCC 43049 plasmid Archaea Euryarchaeota Halobacteria pNG500, complete sequence NC_006394.1 Haloarcula marismortui ATCC 43049 plasmid Archaea Euryarchaeota Halobacteria pNG600, complete sequence NC_006395.1 Haloarcula marismortui ATCC 43049 plasmid Archaea Euryarchaeota Halobacteria pNG700, complete sequence NC_001869.1 Halobacterium sp. NRC-1 plasmid pNRC100, Archaea Euryarchaeota Halobacteria complete sequence NC_002608.1 Halobacterium sp. NRC-1 plasmid pNRC200 Compl Archaea Euryarchaeota Halobacteria Gen NC_002607.1 Halobacterium sp. NRC-1, Compl Gen Archaea Euryarchaeota Halobacteria NC_001732.1 Methanocaldococcus jannaschii DSM 2661 plasmid Archaea Euryarchaeota Methanococci pDSM2661_1, complete sequence NC_000961.1 Pyrococcus horikoshii OT3 DNA, Compl Gen Archaea Euryarchaeota Thermococci NC_002689.2 Thermoplasma volcanium GSS1 DNA, Compl Gen Archaea Euryarchaeota Thermoplasmata NC_009525.1 Mycobacterium tuberculosis H37Ra, Compl Gen Bacteria Actinobacteria Actinobacteria NC_003155.5 Streptomyces avermitilis MA-4680 = NBRC 14893 Bacteria Actinobacteria Actinobacteria DNA, Compl Gen NC_004719.1 Streptomyces avermitilis MA-4680 = NBRC 14893 Bacteria Actinobacteria Actinobacteria plasmid SAP1 DNA, complete sequence NC_002935.2 Corynebacterium diphtheriae NCTC 13129, Compl Bacteria Actinobacteria Actinomycetales Gen NC_004663.1 Bacteroides thetaiotaomicron VPI-5482 Chrom, Bacteria Bacteroidetes Bacteroidia Compl Gen NC_004703.1 Bacteroides thetaiotaomicron VPI-5482 plasmid Bacteria Bacteroidetes Bacteroidia p5482, complete sequence NC_002932.3 Chlorobium tepidum TLS Chrom, Compl Gen Bacteria Chlorobi Chlorobia NC_001263.1 Deinococcus radiodurans R1 Chrom 1, complete Bacteria Deinococcus- Deinococci sequence Thermus NC_001264.1 Deinococcus radiodurans R1 Chrom 2, complete Bacteria Deinococcus- Deinococci sequence Thermus NC_000959.1 Deinococcus radiodurans R1 plasmid CP1, Bacteria Deinococcus- Deinococci complete sequence Thermus NC_000958.1 Deinococcus radiodurans R1 plasmid MP1, Bacteria Deinococcus- Deinococci complete sequence Thermus NC_001733.1 Methanocaldococcus jannaschii DSM 2661 plasmid Bacteria Euryarchaeota Methanococci pDSM2661_2, complete sequence NC_000909.1 Methanocaldococcus jannaschii DSM 2661, Compl Bacteria Euryarchaeota Methanococci Gen NC_005707.1 Bacillus cereus ATCC 10987 plasmid pBc10987, Bacteria Firmicutes Bacilli complete sequence NC_003909.8 Bacillus cereus ATCC 10987, Compl Gen Bacteria Firmicutes Bacilli NC_003210.1 Listeria monocytogenes EGD-e Chrom, Compl Gen Bacteria Firmicutes Bacilli NC_008226.1 Clostridioides difficile 630 plasmid pCD630, Bacteria Firmicutes Clostridia complete sequence NC_009089.1 Clostridioides difficile 630, Compl Gen Bacteria Firmicutes Clostridia NC_002696.2 Caulobacter crescentus CB15 Chrom, Compl Gen Bacteria Proteobacteria Alpha Proteobacteria NC_007493.1 Rhodobacter sphaeroides 2.4.1 Chrom 1, complete Bacteria Proteobacteria Alphaproteobacteria sequence NC_007494.1 Rhodobacter sphaeroides 2.4.1 Chrom 2, complete Bacteria Proteobacteria Alphaproteobacteria sequence NC_009007.1 Rhodobacter sphaeroides 2.4.1 plasmid A, partial Bacteria Proteobacteria Alphaproteobacteria sequence NC_007488.1 Rhodobacter sphaeroides 2.4.1 plasmid B, complete Bacteria Proteobacteria Alphaproteobacteria sequence NC_007489.1 Rhodobacter sphaeroides 2.4.1 plasmid C, complete Bacteria Proteobacteria Alphaproteobacteria sequence NC_007490.1 Rhodobacter sphaeroides 2.4.1 plasmid D, complete Bacteria Proteobacteria Alphaproteobacteria sequence NC_009008.1 Rhodobacter sphaeroides 2.4.1 plasmid E, partial Bacteria Proteobacteria Alphaproteobacteria sequence NC_008767.1 Neisseria meningitidis serogroup C FAM18 Compl Bacteria Proteobacteria Betaproteobacteria Gen NC_002937.3 Desulfovibrio vulgaris str. Hildenborough Chrom, Bacteria Proteobacteria Deltaproteobacteria Compl Gen NC_005863.1 Desulfovibrio vulgaris str. Hildenborough plasmid Bacteria Proteobacteria Deltaproteobacteria pDV, complete sequence NC_002939.5 Geobacter sulfurreducens PCA Chrom, Compl Gen Bacteria Proteobacteria Deltaproteobacteria NC_002163.1 Campylobacter jejuni subsp. jejuni NCTC 11168 = Bacteria Proteobacteria Epsilonproteobacteria ATCC 700819 Chrom, Compl Gen NC_000915.1 Helicobacter pylori 26695 Chrom, Compl Gen Bacteria Proteobacteria Epsilonproteobacteria NC_009085.1 Acinetobacter baumannii ATCC 17978 Chrom, Bacteria Proteobacteria Gammaproteobacteria Compl Gen NC_009083.1 Acinetobacter baumannii ATCC 17978 plasmid Bacteria Proteobacteria Gammaproteobacteria pAB1, complete sequence NC_009084.1 Acinetobacter baumannii ATCC 17978 plasmid Bacteria Proteobacteria Gammaproteobacteria pAB2, complete sequence NC_000907.1 Haemophilus influenzae Rd KW20 Chrom, Compl Bacteria Proteobacteria Gammaproteobacteria Gen NC_002942.5 Legionella pneumophila subsp. pneumophila str. Bacteria Proteobacteria Gammaproteobacteria Philadelphia 1 Chrom, Compl Gen NC_002516.2 Pseudomonas aeruginosa PAO1 Chrom, Compl Bacteria Proteobacteria Gammaproteobacteria Gen NC_002950.2 Porphyromonas gingivalis W83, Compl Gen Bacteria Proteobacteria Porphyromonas gingivalis NC_001318.1 Borrelia burgdorferi B31 Chrom, Compl Gen Bacteria Spirochaetes Spirochaetales NC_001903.1 Borrelia burgdorferi B31 plasmid cp26, complete Bacteria Spirochaetes Spirochaetales sequence NC_000948.1 Borrelia burgdorferi B31 plasmid cp32-1, complete Bacteria Spirochaetes Spirochaetales sequence NC_000949.1 Borrelia burgdorferi B31 plasmid cp32-3, complete Bacteria Spirochaetes Spirochaetales sequence NC_000950.1 Borrelia burgdorferi B31 plasmid cp32-4, complete Bacteria Spirochaetes Spirochaetales sequence NC_000951.1 Borrelia burgdorferi B31 plasmid cp32-6, complete Bacteria Spirochaetes Spirochaetales sequence NC_000952.1 Borrelia burgdorferi B31 plasmid cp32-7, complete Bacteria Spirochaetes Spirochaetales sequence NC_000953.1 Borrelia burgdorferi B31 plasmid cp32-8, complete Bacteria Spirochaetes Spirochaetales sequence NC_000954.1 Borrelia burgdorferi B31 plasmid cp32-9, complete Bacteria Spirochaetes Spirochaetales sequence NC_001849.2 Borrelia burgdorferi B31 plasmid lp17, complete Bacteria Spirochaetes Spirochaetales sequence NC_001851.2 Borrelia burgdorferi B31 plasmid lp28-1, complete Bacteria Spirochaetes Spirochaetales sequence NC_001852.1 Borrelia burgdorferi B31 plasmid lp28-2, complete Bacteria Spirochaetes Spirochaetales sequence NC_001853.1 Borrelia burgdorferi B31 plasmid lp28-3, complete Bacteria Spirochaetes Spirochaetales sequence NC_001855.1 Borrelia burgdorferi B31 plasmid lp36, complete Bacteria Spirochaetes Spirochaetales sequence NC_001857.2 Borrelia burgdorferi B31 plasmid lp54, complete Bacteria Spirochaetes Spirochaetales sequence NC_000956.1 Borrelia burgdorferi B31 plasmid lp56, complete Bacteria Spirochaetes Spirochaetales sequence NC_000853.1 Thermotoga maritima MSB8 Chrom, Compl Gen Bacteria Thermotogae Thermotogales
TABLE-US-00002 TABLE B Database source of reference proteomes of an evolutionary diverse set of species RefSeq assembly Assembly accession ID Species name level ftp path (ftp://ftp.ncbi.nlm.nih.gov/genomes/all/GCF/. . .) Archaea: GCF_000213215.1 Acidianus hospitalis W1 Compl Gen 000/213/215/GCF_000213215.1_ASM21321v1 GCF_000144915.1 Acidilobus saccharovorans Compl Gen 000/144/915/GCF_000144915.1_ASM14491v1 345-15 GCF_000025665.1 Aciduliprofundum boonei Compl Gen 000/025/665/GCF_000025665.1_ASM2566v1 T469 GCF_000327505.1 Aciduliprofundum sp. Compl Gen 000/327/505/GCF_000327505.1_ASM32750v1 MAR08-339 GCF_000008665.1 Archaeoglobus fulgidus DSM Compl Gen 000/008/665/GCF_000008665.1_ASM866v1 4304 GCF_000025285.1 Archaeoglobus profundus Compl Gen 000/025/285/GCF_000025285.1_ASM2528v1 DSM 5631 GCF_000385565.1 Archaeoglobus sulfaticallidus Compl Gen 000/385/565/GCF_000385565.1_ASM38556v1 PM70-1 GCF_000194625.1 Archaeoglobus veneficus Compl Gen 000/194/625/GCF_000194625.1_ASM19462v1 SNP6 GCF_000317795.1 Caldisphaera lagunensis DSM Compl Gen 000/317/795/GCF_000317795.1_ASM31779v1 15908 GCF_000018305.1 Caldivirga maquilingensis IC- Compl Gen 000/018/305/GCF_000018305.1_ASM1830v1 167 GCF_000019605.1 Candidatus Korarchaeum Compl Gen 000/019/605/GCF_000019605.1_ASM1960v1 cryptofilum OPF8 GCF_000404225.1 Candidatus Compl Gen 000/404/225/GCF_000404225.1_ASM40422v1 Methanomassiliicoccus intestinalis Issoire-Mx1 GCF_000300255.2 Candidatus Compl Gen 000/300/255/GCF_000300255.2_ASM30025v2 Methanomethylophilus alvus Mx1201 GCF_000800805.1 Candidatus Methanoplasma Compl Gen 000/800/805/GCF_000800805.1_ASM80080v1 termitum GCF_000812185.1 Candidatus Nitrosopelagicus Compl Gen 000/812/185/GCF_000812185.1_ASM81218v1 brevis GCF_000299395.1 Candidatus Nitrosopumilus Compl Gen 000/299/395/GCF_000299395.1_ASM29939v1 sp. AR2 GCF_000955905.1 Candidatus Nitrosotenuis Compl Gen 000/955/905/GCF_000955905.1_ASM95590v3 cloacae GCF_000231015.2 Desulfurococcus fermentans Compl Gen 000/231/015/GCF_000231015.2_ASM23101v3 DSM 16532 GCF_000020905.1 Desulfurococcus Compl Gen 000/020/905/GCF_000020905.1_ASM2090v1 kamchatkensis 1221n GCF_000186365.1 Desulfurococcus mucosus Compl Gen 000/186/365/GCF_000186365.1_ASM18636v1 DSM 2162 GCF_000025505.1 Ferroglobus placidus DSM Compl Gen 000/025/505/GCF_000025505.1_ASM2550v1 10642 GCF_000152265.2 Ferroplasma acidarmanus Compl Gen 000/152/265/GCF_000152265.2_ASM15226v2 fer1 GCF_000789255.1 Geoglobus acetivorans Compl Gen 000/789/255/GCF_000789255.1_ASM78925v1 GCF_001006045.1 Geoglobus ahangari Compl Gen 001/006/045/GCF_001006045.1_ASM100604v1 GCF_000196895.1 Halalkalicoccus jeotgali B3 Compl Gen 000/196/895/GCF_000196895.1_ASM19689v1 GCF_001305655.1 Halanaeroarchaeum Compl Gen 001/305/655/GCF_001305655.1_ASM130565v1 sulfurireducens GCF_000223905.1 Haloarcula hispanica ATCC Compl Gen 000/223/905/GCF_000223905.1_ASM22390v1 33960 GCF_001488575.1 Halobacterium hubeiense Compl Gen 001/488/575/GCF_001488575.1_Halobacterium.sub.—hubeiense_JI20-1 GCF_000069025.1 Halobacterium salinarum R1 Compl Gen 000/069/025/GCF_000069025.1_ASM6902v1 GCF_000230955.2 Halobacterium sp. DL1 Compl Gen 000/230/955/GCF_000230955.2_ASM23095v3 GCF_000306765.2 Haloferax mediterranei ATCC Compl Gen 000/306/765/GCF_000306765.2_ASM30676v2 33500 GCF_000025685.1 Haloferax volcanii DS2 Compl Gen 000/025/685/GCF_000025685.1_ASM2568v1 GCF_000172995.2 Halogeometricum Compl Gen 000/172/995/GCF_000172995.2_ASM17299v2 borinquense DSM 11551 GCF_000023965.1 Halomicrobium mukohataei Compl Gen 000/023/965/GCF_000023965.1_ASM2396v1 DSM 12286 GCF_000224475.1 halophilic archaeon DL31 Compl Gen 000/224/475/GCF_000224475.1_ASM22447v1 GCF_000217715.1 Halopiger xanaduensis SH-6 Compl Gen 000/217/715/GCF_000217715.1_ASM21771v1 GCF_000237865.1 Haloquadratum walsbyi C23 Compl Gen 000/237/865/GCF_000237865.1_ASM23786v1 GCF_000470655.1 Halorhabdus tiamatea Compl Gen 000/470/655/GCF_000470655.1_HATI1 SARL4B GCF_000023945.1 Halorhabdus utahensis DSM Compl Gen 000/023/945/GCF_000023945.1_ASM2394v1 12940 GCF_000022205.1 Halorubrum lacusprofundi Compl Gen 000/022/205/GCF_000022205.1_ASM2220v1 ATCC 49239 GCF_000517625.1 Halostagnicola larsenii XH-48 Compl Gen 000/517/625/GCF_000517625.1_ASM51762v1 GCF_000025325.1 Haloterrigena turkmenica Compl Gen 000/025/325/GCF_000025325.1_ASM2532v1 DSM 5511 GCF_000015145.1 Hyperthermus butylicus DSM Compl Gen 000/015/145/GCF_000015145.1_ASM1514v1 5456 GCF_000017945.1 Ignicoccus hospitalis KIN4/I Compl Gen 000/017/945/GCF_000017945.1_ASM1794v1 GCF_000204925.1 Metallosphaera cuprina Ar-4 Compl Gen 000/204/925/GCF_000204925.1_ASM20492v1 GCF_000016605.1 Metallosphaera sedula DSM Compl Gen 000/016/605/GCF_000016605.1_ASM1660v1 5348 GCF_000762265.1 Methanobacterium formicicum Compl Gen 000/762/265/GCF_000762265.1_ASM76226v1 GCF_000191585.1 Methanobacterium lacus Compl Gen 000/191/585/GCF_000191585.1_ASM19158v1 GCF_000214725.1 Methanobacterium paludis Compl Gen 000/214/725/GCF_000214725.1_ASM21472v1 GCF_000499765.1 Methanobacterium sp. MB1 Compl Gen 000/499/765/GCF_000499765.1_Methanobacterium GCF_001477655.1 Methanobrevibacter millerae Compl Gen 001/477/655/GCF_001477655.1_ASM147765v1 GCF_000024185.1 Methanobrevibacter Compl Gen 000/024/185/GCF_000024185.1_ASM2418v1 ruminantium M1 GCF_000016525.1 Methanobrevibacter smithii Compl Gen 000/016/525/GCF_000016525.1_ASM1652v1 ATCC 35061 GCF_000739065.1 Methanocaldococcus Compl Gen 000/739/065/GCF_000739065.1_ASM73906v1 bathoardescens GCF_000023985.1 Methanocaldococcus fervens Compl Gen 000/023/985/GCF_000023985.1_ASM2398v1 AG86 GCF_000092305.1 Methanocaldococcus infernus Compl Gen 000/092/305/GCF_000092305.1_ASM9230v1 ME GCF_000025525.1 Methanocaldococcus sp. Compl Gen 000/025/525/GCF_000025525.1_ASM2552v1 FS406-22 GCF_000024625.1 Methanocaldococcus Compl Gen 000/024/625/GCF_000024625.1_ASM2462v1 vulcanius M7 GCF_000063445.1 Methanocella arvoryzae Compl Gen 000/063/445/GCF_000063445.1_ASM6344v1 MRE50 GCF_000251105.1 Methanocella conradii HZ254 Compl Gen 000/251/105/GCF_000251105.1_ASM25110v1 GCF_000013725.1 Methanococcoides burtonii Compl Gen 000/013/725/GCF_000013725.1_ASM1372v1 DSM 6242 GCF_000970325.1 Methanococcoides Compl Gen 000/970/325/GCF_000970325.1_ASM97032v1 methylutens MM1 GCF_000017185.1 Methanococcus aeolicus Compl Gen 000/017/185/GCF_000017185.1_ASM1718v1 Nankai-3 GCF_000017225.1 Methanococcus maripaludis Compl Gen 000/017/225/GCF_000017225.1_ASM1722v1 C7 GCF_000220645.1 Methanococcus maripaludis Compl Gen 000/220/645/GCF_000220645.1_ASM22064v1 X1 GCF_000017165.1 Methanococcus vannielii SB Compl Gen 000/017/165/GCF_000017165.1_ASM1716v1 GCF_000006175.1 Methanococcus voltae A3 Compl Gen 000/006/175/GCF_000006175.1_ASM617v2 GCF_000015765.1 Methanocorpusculum Compl Gen 000/015/765/GCF_000015765.1_ASM1576v1 labreanum Z GCF_000304355.2 Methanoculleus bourgensis Compl Gen 000/304/355/GCF_000304355.2_Mb_MS2 MS2 GCF_000015825.1 Methanoculleus marisnigri Compl Gen 000/015/825/GCF_000015825.1_ASM1582v1 JR1 GCF_000196655.1 Methanohalobium Compl Gen 000/196/655/GCF_000196655.1_ASM19665v1 evestigatum Z-7303 GCF_000025865.1 Methanohalophilus mahii Compl Gen 000/025/865/GCF_000025865.1_ASM2586v1 DSM 5219 GCF_000147875.1 Methanolacinia petrolearia Compl Gen 000/147/875/GCF_000147875.1_ASM14787v1 DSM 11571 GCF_000306725.1 Methanolobus psychrophilus Compl Gen 000/306/725/GCF_000306725.1_ASM30672v1 R15 GCF_000328665.1 Methanomethylovorans Compl Gen 000/328/665/GCF_000328665.1_ASM32866v1 hollandica DSM 15978 GCF_000017625.1 Methanoregula boonei 6A8 Compl Gen 000/017/625/GCF_000017625.1_ASM1762v1 GCF_000327485.1 Methanoregula formicica Compl Gen 000/327/485/GCF_000327485.1_ASM32748v1 SMSP GCF_000204415.1 Methanosaeta concilii GP6 Compl Gen 000/204/415/GCF_000204415.1_ASM20441v1 GCF_000235565.1 Methanosaeta harundinacea Compl Gen 000/235/565/GCF_000235565.1_ASM23556v1 6Ac GCF_000217995.1 Methanosalsum zhilinae DSM Compl Gen 000/217/995/GCF_000217995.1_ASM21799v1 4017 GCF_000007345.1 Methanosarcina acetivorans Compl Gen 000/007/345/GCF_000007345.1_ASM734v1 C2A GCF_000970305.1 Methanosarcina barkeri 3 Compl Gen 000/970/305/GCF_000970305.1_ASM97030v1 GCF_000970025.1 Methanosarcina barkeri MS Compl Gen 000/970/025/GCF_000970025.1_ASM97002v1 GCF_000970285.1 Methanosarcina horonobensis Compl Gen 000/970/285/GCF_000970285.1_ASM97028v1 HB-1 = JCM 15518 GCF_000970265.1 Methanosarcina lacustris Z- Compl Gen 000/970/265/GCF_000970265.1_ASM97026v1 7289 GCF_000970205.1 Methanosarcina mazei S-6 Compl Gen 000/970/205/GCF_000970205.1_ASM97020v1 GCF_000970085.1 Methanosarcina siciliae T4/M Compl Gen 000/970/085/GCF_000970085.1_ASM97008v1 GCF_000970045.1 Methanosarcina sp. MTP4 Compl Gen 000/970/045/GCF_000970045.1_ASM97004v1 GCF_000969965.1 Methanosarcina sp. Compl Gen 000/969/965/GCF_000969965.1_ASM96996v1 WWM596 GCF_000969885.1 Methanosarcina thermophila Compl Gen 000/969/885/GCF_000969885.1_ASM96988v1 TM-1 GCF_000969905.1 Methanosarcina vacuolata Z- Compl Gen 000/969/905/GCF_000969905.1_ASM96990v1 761 GCF_000012545.1 Methanosphaera stadtmanae Compl Gen 000/012/545/GCF_000012545.1_ASM1254v1 DSM 3091 GCF_000021965.1 Methanosphaerula palustris Compl Gen 000/021/965/GCF_000021965.1_ASM2196v1 E1-9c GCF_000013445.1 Methanospirillum hungatei Compl Gen 000/013/445/GCF_000013445.1_ASM1344v1 JF-1 GCF_000145295.1 Methanothermobacter Compl Gen 000/145/295/GCF_000145295.1_ASM14529v1 marburgensis str. Marburg GCF_000008645.1 Methanothermobacter Compl Gen 000/008/645/GCF_000008645.1_ASM864v1 thermautotrophicus str. Delta H GCF_000179575.2 Methanothermococcus Compl Gen 000/179/575/GCF_000179575.2_ASM17957v2 okinawensis IH1 GCF_000166095.1 Methanothermus fervidus Compl Gen 000/166/095/GCF_000166095.1_ASM16609v1 DSM 2088 GCF_000214415.1 Methanotorris igneus Kol 5 Compl Gen 000/214/415/GCF_000214415.1_ASM21441v1 GCF_000025625.1 Natrialba magadii ATCC Compl Gen 000/025/625/GCF_000025625.1_ASM2562v1 43099 GCF_000230735.2 Natrinema pellirubrum DSM Compl Gen 000/230/735/GCF_000230735.2_ASM23073v3 15624 GCF_000230715.2 Natronobacterium gregoryi Compl Gen 000/230/715/GCF_000230715.2_ASM23071v3 SP2 GCF_000328685.1 Natronococcus occultus SP4 Compl Gen 000/328/685/GCF_000328685.1_ASM32868v1 GCF_000591055.1 Natronomonas moolapensis Compl Gen 000/591/055/GCF_000591055.1_ASM59105v1 8.8.11 GCF_000026045.1 Natronomonas pharaonis Compl Gen 000/026/045/GCF_000026045.1_ASM2604v1 DSM 2160 GCF_000725425.1 Palaeococcus pacificus Compl Gen 000/725/425/GCF_000725425.1_ASM72542v1 DY20341 GCF_000008265.1 Picrophilus torridus DSM Compl Gen 000/008/265/GCF_000008265.1_ASM826v1 9790 GCF_000015205.1 Pyrobaculum islandicum DSM Compl Gen 000/015/205/GCF_000015205.1_ASM1520v1 4184 GCF_000195935.2 Pyrococcus abyssi GE5 Compl Gen 000/195/935/GCF_000195935.2_ASM19593v1 GCF_000007305.1 Pyrococcus furiosus DSM Compl Gen 000/007/305/GCF_000007305.1_ASM730v1 3638 GCF_000011105.1 Pyrococcus horikoshii OT3 Compl Gen 000/011/105/GCF_000011105.1_ASM1110v1 GCF_000211475.1 Pyrococcus sp. NA2 Compl Gen 000/211/475/GCF_000211475.1_ASM21147v1 GCF_000263735.1 Pyrococcus sp. ST04 Compl Gen 000/263/735/GCF_000263735.1_ASM26373v1 GCF_000215995.1 Pyrococcus yayanosii CH1 Compl Gen 000/215/995/GCF_000215995.1_ASM21599v1 GCF_001412615.1 Pyrodictium delaneyi Compl Gen 001/412/615/GCF_001412615.1_ASM141261v1 GCF_000223395.1 Pyrolobus fumarii 1A Compl Gen 000/223/395/GCF_000223395.1_ASM22339v1 GCF_000403645.1 Salinarchaeum sp. Harcht- Compl Gen 000/403/645/GCF_000403645.1_ASM40364v1 Bsk1 GCF_000092465.1 Staphylothermus hellenicus Compl Gen 000/092/465/GCF_000092465.1_ASM9246v1 DSM 12710 GCF_000015945.1 Staphylothermus marinus F1 Compl Gen 000/015/945/GCF_000015945.1_ASM1594v1 GCF_000012285.1 Sulfolobus acidocaldarius Compl Gen 000/012/285/GCF_000012285.1_ASM1228v1 DSM 639 GCF_000022385.1 Sulfolobus islandicus Compl Gen 000/022/385/GCF_000022385.1_ASM2238v1 L.S.2.15 GCF_000007005.1 Sulfolobus solfataricus P2 Compl Gen 000/007/005/GCF_000007005.1_ASM700v1 GCF_000011205.1 Sulfolobus tokodaii str. 7 Compl Gen 000/011/205/GCF_000011205.1_ASM1120v1 GCF_000151105.2 Thermococcus barophilus MP Compl Gen 000/151/105/GCF_000151105.2_ASM15110v2 GCF_000265525.1 Thermococcus cleftensis Compl Gen 000/265/525/GCF_000265525.1_ASM26552v1 GCF_000769655.1 Thermococcus eurythermalis Compl Gen 000/769/655/GCF_000769655.1_ASM76965v1 GCF_000022365.1 Thermococcus Compl Gen 000/022/365/GCF_000022365.1_ASM2236v1 gammatolerans EJ3 GCF_000009965.1 Thermococcus kodakarensis Compl Gen 000/009/965/GCF_000009965.1_ASM996v1 KOD1 GCF_000246985.2 Thermococcus litoralis DSM Compl Gen 000/246/985/GCF_000246985.2_ASM24698v3 5473 GCF_000585495.1 Thermococcus nautili Compl Gen 000/585/495/GCF_000585495.1_ASM58549v1 GCF_000018365.1 Thermococcus onnurineus Compl Gen 000/018/365/GCF_000018365.1_ASM1836v1 NA1 GCF_000517445.1 Thermococcus paralvinellae Compl Gen 000/517/445/GCF_000517445.1_ASM51744v1 GCF_000022545.1 Thermococcus sibiricus MM Compl Gen 000/022/545/GCF_000022545.1_ASM2254v1 739 GCF_000151205.2 Thermococcus sp. AM4 Compl Gen 000/151/205/GCF_000151205.2_ASM15120v2 GCF_000813245.1 Thermofilum Compl Gen 000/813/245/GCF_000813245.1_ASM81324v1 carboxyditrophus 1505 GCF_000015225.1 Thermofilum pendens Hrk 5 Compl Gen 000/015/225/GCF_000015225.1_ASM1522v1 GCF_000993805.1 Thermofilum sp. 1807-2 Compl Gen 000/993/805/GCF_000993805.1_ASM99380v1 GCF_000264495.1 Thermogladius cellulolyticus Compl Gen 000/264/495/GCF_000264495.1_ASM26449v1 1633 GCF_000195915.1 Thermoplasma acidophilum Compl Gen 000/195/915/GCF_000195915.1_ASM19591v1 DSM 1728 GCF_000011185.1 Thermoplasma volcanium Compl Gen 000/011/185/GCF_000011185.1_ASM1118v1 GSS1 GCF_000350305.1 Thermoplasmatales archaeon Compl Gen 000/350/305/GCF_000350305.1_ASM35030v1 BRNA1 GCF_000253055.1 Thermoproteus tenax Kra 1 Compl Gen 000/253/055/GCF_000253055.1_ASM25305v1 GCF_000193375.1 Thermoproteus uzoniensis Compl Gen 000/193/375/GCF_000193375.1_ASM19337v1 768-20 GCF_000092185.1 Thermosphaera aggregans Compl Gen 000/092/185/GCF_000092185.1_ASM9218v1 DSM 11486 GCF_000148385.1 Vulcanisaeta distributa DSM Compl Gen 000/148/385/GCF_000148385.1_ASM14838v1 14429 GCF_000190315.1 Vulcanisaeta moutnovskia Compl Gen 000/190/315/GCF_000190315.1_ASM19031v1 768-28 Bacteria: GCF_000020965.1 Dictyoglomus thermophilum Compl Gen 000/020/965/GCF_000020965.1_ASM2096v1 H-6-12 GCF_001676785.2 Brachyspira hyodysenteriae Compl Gen 001/676/785/GCF_001676785.2_ASM167678v2 ATCC 27164 GCF_000017685.1 Leptospira biflexa serovar Compl Gen 000/017/685/GCF_000017685.1_ASM1768v1 Patoc strain ‘Patoc 1 (Paris)’ GCF_001399775.1 Thermus aquaticus Y51MC23 Compl Gen 001/399/775/GCF_001399775.1_ASM139977v1 GCF_000219605.1 Pseudomonas stutzeri Compl Gen 000/219/605/GCF_000219605.1_ASM21960v1 GCF_000021685.1 Thermomicrobium roseum Compl Gen 000/021/685/GCF_000021685.1_ASM2168v1 DSM 5159 GCF_000024405.1 Sebaldella termitidis ATCC Compl Gen 000/024/405/GCF_000024405.1_ASM2440v1 33386 GCF_000146505.1 Fibrobacter succinogenes Compl Gen 000/146/505/GCF_000146505.1_ASM14650v1 subsp. succinogenes S85 GCF_000158275.2 Fusobacterium nucleatum Compl Gen 000/158/275/GCF_000158275.2_ASM15827v2 subsp. animalis 7_1 GCF_000025305.1 Acidaminococcus fermentans Compl Gen 000/025/305/GCF_000025305.1_ASM2530v1 DSM 20731 GCF_000010785.1 Hydrogenobacter Compl Gen 000/010/785/GCF_000010785.1_ASM1078v1 thermophilus TK-6 GCF_000284095.1 Selenomonas ruminantium Compl Gen 000/284/095/GCF_000284095.1_ASM28409v1 subsp. lactilytica TAM6421 GCF_000317695.1 Anabaena cylindrica PCC Compl Gen 000/317/695/GCF_000317695.1_ASM31769v1 7122 GCF_000179635.2 Ruminococcus albus 7 = Compl Gen 000/179/635/GCF_000179635.2_ASM17963v2 DSM 20455 GCF_001543175.1 Aerococcus urinae Compl Gen 001/543/175/GCF_001543175.1_ASM154317v1 GCF_000953275.1 Clostridioides difficile Compl Gen 000/953/275/GCF_000953275.1_CD630DERM GCF_000145615.1 Thermoanaerobacterium Compl Gen 000/145/615/GCF_000145615.1_ASM14561v1 thermosaccharolyticum DSM 571 GCF_000013105.1 Moorella thermoacetica ATCC Compl Gen 000/013/105/GCF_000013105.1_ASM1310v1 39073 GCF_000270085.1 Erysipelothrix rhusiopathiae Compl Gen 000/270/085/GCF_000270085.1_ASM27008v1 str. Fujisawa GCF_000612055.1 Trueperella pyogenes Compl Gen 000/612/055/GCF_000612055.1_ASM61205v1 GCF_001729525.1 Brevibacterium linens Compl Gen 001/729/525/GCF_001729525.1_ASM172952v1 GCF_000734015.1 Thermodesulfobacterium Compl Gen 000/734/015/GCF_000734015.1_ASM73401v1 commune DSM 2178 GCF_000058485.1 Frankia alni ACN14a Compl Gen 000/058/485/GCF_000058485.1_ASM5848v1 GCF_000092645.1 Thermobispora bispora DSM Compl Gen 000/092/645/GCF_000092645.1_ASM9264v1 43833 GCF_000024385.1 Thermomonospora curvata Compl Gen 000/024/385/GCF_000024385.1_ASM2438v1 DSM 43183 GCF_000024985.1 Sphaerobacter thermophilus Compl Gen 000/024/985/GCF_000024985.1_ASM2498v1 DSM 20745 GCF_000269985.1 Kitasatospora setae KM-6054 Compl Gen 000/269/985/GCF_000269985.1_ASM26998v1 GCF_000008305.1 Mesoplasma florum L1 Compl Gen 000/008/305/GCF_000008305.1_ASM830v1 GCF_000021285.1 Thermosipho africanus Compl Gen 000/021/285/GCF_000021285.1_ASM2128v1 TCF52B GCF_000025205.1 Gardnerella vaginalis 409-05 Compl Gen 000/025/205/GCF_000025205.1_ASM2520v1 GCF_000009905.1 Symbiobacterium Compl Gen 000/009/905/GCF_000009905.1_ASM990v1 thermophilum IAM 14863 GCF_000015025.1 Acidothermus cellulolyticus Compl Gen 000/015/025/GCF_000015025.1_ASM1502v1 11B GCF_000144695.1 Acetohalobium arabaticum Compl Gen 000/144/695/GCF_000144695.1_ASM14469v1 DSM 5501 GCF_000024945.1 Veillonella parvula DSM 2008 Compl Gen 000/024/945/GCF_000024945.1_ASM2494v1 GCF_000022325.1 Caldicellulosiruptor bescii Compl Gen 000/022/325/GCF_000022325.1_ASM2232v1 DSM 6725 GCF_000020485.1 Halothermothrix orenii H 168 Compl Gen 000/020/485/GCF_000020485.1_ASM2048v1 GCF_000175575.2 Acidithiobacillus caldus ATCC Compl Gen 000/175/575/GCF_000175575.2_ASM17557v2 51756 GCF_000022565.1 Acidobacterium capsulatum Compl Gen 000/022/565/GCF_000022565.1_ASM2256v1 ATCC 51196 GCF_000247605.1 Acetobacterium woodii DSM Compl Gen 000/247/605/GCF_000247605.1_ASM24760v1 1030 GCF_000019165.1 Heliobacterium Compl Gen 000/019/165/GCF_000019165.1_ASM1916v1 modesticaldum Ice1 GCF_000020945.1 Coprothermobacter Compl Gen 000/020/945/GCF_000020945.1_ASM2094v1 proteolyticus DSM 5265 GCF_000619905.2 Nitrosospira briensis C-128 Compl Gen 000/619/905/GCF_000619905.2_ASM61990v2 GCF_000012745.1 Thiobacillus denitrificans Compl Gen 000/012/745/GCF_000012745.1_ASM1274v1 ATCC 25259 GCF_000661895.1 Rubrobacter radiotolerans Compl Gen 000/661/895/GCF_000661895.1_ASM66189v1 GCF_000328625.1 Halobacteroides halobius Compl Gen 000/328/625/GCF_000328625.1_ASM32862v1 DSM 5150 GCF_000024605.1 Ammonifex degensii KC4 Compl Gen 000/024/605/GCF_000024605.1_ASM2460v1 GCF_000145035.1 Butyrivibrio proteoclasticus Compl Gen 000/145/035/GCF_000145035.1_ASM14503v1 B316 GCF_000092125.1 Meiothermus silvanus DSM Compl Gen 000/092/125/GCF_000092125.1_ASM9212v1 9946 GCF_000024365.1 Nakamurella multipartita Compl Gen 000/024/365/GCF_000024365.1_ASM2436v1 DSM 44233 GCF_000023265.1 Acidimicrobium ferrooxidans Compl Gen 000/023/265/GCF_000023265.1_ASM2326v1 DSM 10331 GCF_000317125.1 Chroococcidiopsis thermalis Compl Gen 000/317/125/GCF_000317125.1_ASM31712v1 PCC 7203 GCF_000317025.1 Pleurocapsa sp. PCC 7327 Compl Gen 000/317/025/GCF_000317025.1_ASM31702v1 GCF_000816145.1 Pseudothermotoga hypogea Compl Gen 000/816/145/GCF_000816145.1_ASM81614v1 DSM 11164 = NBRC 106472 GCF_000024205.1 Desulfotomaculum Compl Gen 000/024/205/GCF_000024205.1_ASM2420v1 acetoxidans DSM 771 GCF_000011905.1 Dehalococcoides mccartyi Compl Gen 000/011/905/GCF_000011905.1_ASM1190v1 195 GCF_000008625.1 Aquifex aeolicus VF5 Compl Gen 000/008/625/GCF_000008625.1_ASM862v1 GCF_000191045.1 Desulfurobacterium Compl Gen 000/191/045/GCF_000191045.1_ASM19104v1 thermolithotrophum DSM 11699 GCF_000222305.1 Borreliella bissettii DN127 Compl Gen 000/222/305/GCF_000222305.1_ASM22230v1 GCF_000018605.1 Petrotoga mobilis SJ95 Compl Gen 000/018/605/GCF_000018605.1_ASM1860v1 GCF_000184705.1 Thermaerobacter Compl Gen 000/184/705/GCF_000184705.1_ASM18470v1 marianensis DSM 12885 GCF_000025885.1 Aminobacterium colombiense Compl Gen 000/025/885/GCF_000025885.1_ASM2588v1 DSM 12261 GCF_000317065.1 Pseudanabaena sp. PCC Compl Gen 000/317/065/GCF_000317065.1_ASM31706v1 7367 GCF_000237205.1 Simkania negevensis Z Compl Gen 000/237/205/GCF_000237205.1_ASM23720v1 GCF_000023885.1 Slackia heliotrinireducens Compl Gen 000/023/885/GCF_000023885.1_ASM2388v1 DSM 20476 GCF_000305935.1 Thermacetogenium phaeum Compl Gen 000/305/935/GCF_000305935.1_ASM30593v1 DSM 12270 GCF_000092405.1 Syntrophothermus Compl Gen 000/092/405/GCF_000092405.1_ASM9240v1 lipocalidus DSM 12680 GCF_000317575.1 Stanieria cyanosphaera PCC Compl Gen 000/317/575/GCF_000317575.1_ASM31757v1 7437 GCF_000328705.1 Saccharothrix espanaensis Compl Gen 000/328/705/GCF_000328705.1_ASM32870v1 DSM 44229 GCF_000025645.1 Thermoanaerobacter italicus Compl Gen 000/025/645/GCF_000025645.1_ASM2564v1 Ab9 GCF_000014965.1 Syntrophobacter Compl Gen 000/014/965/GCF_000014965.1_ASM1496v1 fumaroxidans MPOB GCF_000017805.1 Roseiflexus castenholzii DSM Compl Gen 000/017/805/GCF_000017805.1_ASM1780v1 13941 GCF_000012865.1 Carboxydothermus Compl Gen 000/012/865/GCF_000012865.1_ASM1286v1 hydrogenoformans Z-2901 GCF_000017305.1 Kineococcus radiotolerans Compl Gen 000/017/305/GCF_000017305.1_ASM1730v1 SRS30216 = ATCC BAA-149 GCF_000281175.1 Caldilinea aerophila DSM Compl Gen 000/281/175/GCF_000281175.1_ASM28117v1 14535 = NBRC 104270 GCF_000025605.1 Thermocrinis albus DSM Compl Gen 000/025/605/GCF_000025605.1_ASM2560v1 14484 GCF_000021945.1 Chloroflexus aggregans DSM Compl Gen 000/021/945/GCF_000021945.1_ASM2194v1 9485 GCF_000025005.1 Thermobaculum terrenum Compl Gen 000/025/005/GCF_000025005.1_ASM2500v1 ATCC BAA-798 GCF_000199675.1 Anaerolinea thermophila Compl Gen 000/199/675/GCF_000199675.1_ASM19967v1 UNI-1 GCF_000021025.1 Laribacter hongkongensis Compl Gen 000/021/025/GCF_000021025.1_ASM2102v1 HLHK9 GCF_000217795.1 Thermodesulfatator indicus Compl Gen 000/217/795/GCF_000217795.1_ASM21779v1 DSM 15286 GCF_000010305.1 Gemmatimonas aurantiaca Compl Gen 000/010/305/GCF_000010305.1_ASM1030v1 T-27 GCF_000299235.1 Leptospirillum ferriphilum Compl Gen 000/299/235/GCF_000299235.1_ASM29923v1 ML-04 GCF_000024345.1 Kribbella flavida DSM 17836 Compl Gen 000/024/345/GCF_000024345.1_ASM2434v1 GCF_000212395.1 Thermodesulfobium Compl Gen 000/212/395/GCF_000212395.1_ASM21239v1 narugense DSM 14796 GCF_000195335.1 Marinithermus Compl Gen 000/195/335/GCF_000195335.1_ASM19533v1 hydrothermalis DSM 14884 GCF_000754265.1 Candidatus Baumannia Compl Gen 000/754/265/GCF_000754265.1_ASM75426v1 cicadellinicola GCF_000183745.1 Oceanithermus profundus Compl Gen 000/183/745/GCF_000183745.1_ASM18374v1 DSM 14977 GCF_000025265.1 Conexibacter woesei DSM Compl Gen 000/025/265/GCF_000025265.1_ASM2526v1 14684 GCF_000194605.1 Fluviicola taffensis DSM Compl Gen 000/194/605/GCF_000194605.1_ASM19460v1 16823 GCF_000494755.1 Actinoplanes friuliensis DSM Compl Gen 000/494/755/GCF_000494755.1_ASM49475v1 7358 GCF_000016985.1 Alkaliphilus metalliredigens Compl Gen 000/016/985/GCF_000016985.1_ASM1698v1 QYMF GCF_000185805.1 Thermovibrio ammonificans Compl Gen 000/185/805/GCF_000185805.1_ASM18580v1 HB-1 GCF_000020225.1 Akkermansia muciniphila Compl Gen 000/020/225/GCF_000020225.1_ASM2022v1 ATCC BAA-835 GCF_000317495.1 Crinalium epipsammum PCC Compl Gen 000/317/495/GCF_000317495.1_ASM31749v1 9333 GCF_000021725.1 Nautilia profundicola AmH Compl Gen 000/021/725/GCF_000021725.1_ASM2172v1 GCF_000213255.1 Mahella australiensis 50-1 Compl Gen 000/213/255/GCF_000213255.1_ASM21325v1 BON GCF_000020505.1 Chlorobaculum parvum NCIB Compl Gen 000/020/505/GCF_000020505.1_ASM2050v1 8327 GCF_000024545.1 Stackebrandtia nassauensis Compl Gen 000/024/545/GCF_000024545.1_ASM2454v1 DSM 44728 GCF_000144645.1 Thermosediminibacter oceani Compl Gen 000/144/645/GCF_000144645.1_ASM14464v1 DSM 16646 GCF_001688625.1 Flavonifractor plautii Compl Gen 001/688/625/GCF_001688625.1_ASM168862v1 GCF_000024025.1 Catenulispora acidiphila DSM Compl Gen 000/024/025/GCF_000024025.1_ASM2402v1 44928 GCF_000021565.1 Persephonella marina EX-H1 Compl Gen 000/021/565/GCF_000021565.1_ASM2156v1 GCF_000021545.1 Sulfurihydrogenibium Compl Gen 000/021/545/GCF_000021545.1_ASM2154v1 azorense Az-Fu1 GCF_000024165.1 Candidatus Accumulibacter Compl Gen 000/024/165/GCF_000024165.1_ASM2416v1 phosphatis clade IIA str. UW-1 GCF_000092425.1 Truepera radiovictrix DSM Compl Gen 000/092/425/GCF_000092425.1_ASM9242v1 17093 GCF_000019905.1 Exiguobacterium sibiricum Compl Gen 000/019/905/GCF_000019905.1_ASM1990v1 255-15 GCF_000283575.1 Oscillibacter valericigenes Compl Gen 000/283/575/GCF_000283575.1_ASM28357v1 Sjm18-20 GCF_000023705.1 Methylotenera mobilis JLW8 Compl Gen 000/023/705/GCF_000023705.1_ASM2370v1 GCF_000271665.2 Pelosinus fermentans JBW45 Compl Gen 000/271/665/GCF_000271665.2_ASM27166v2 GCF_000145255.1 Gallionella capsiferriformans Compl Gen 000/145/255/GCF_000145255.1_ASM14525v1 ES-2 GCF_000020005.1 Natranaerobius thermophilus Compl Gen 000/020/005/GCF_000020005.1_ASM2000v1 JW/NM-WN-LF GCF_000020785.1 Hydrogenobaculum sp. Compl Gen 000/020/785/GCF_000020785.1_ASM2078v1 Y04AAS1 GCF_000265425.1 Terriglobus roseus DSM Compl Gen 000/265/425/GCF_000265425.1_ASM26542v1 18391 GCF_000020145.1 Elusimicrobium minutum Compl Gen 000/020/145/GCF_000020145.1_ASM2014v1 Pei191 GCF_000226295.1 Chloracidobacterium Compl Gen 000/226/295/GCF_000226295.1_ASM22629v1 thermophilum B GCF_000348785.1 Ilumatobacter coccineus Compl Gen 000/348/785/GCF_000348785.1_ASM34878v1 YM16-304 GCF_000306785.1 Modestobacter marinus Compl Gen 000/306/785/GCF_000306785.1_ASM30678v1 GCF_000183405.1 Calditerrivibrio nitroreducens Compl Gen 000/183/405/GCF_000183405.1_ASM18340v1 DSM 19672 GCF_000328765.2 Tepidanaerobacter Compl Gen 000/328/765/GCF_000328765.2_ASM32876v2 acetatoxydans Re1 GCF_000284115.1 Phycisphaera mikurensis Compl Gen 000/284/115/GCF_000284115.1_ASM28411v1 NBRC 102666 GCF_000025965.1 Aromatoleum aromaticum Compl Gen 000/025/965/GCF_000025965.1_ASM2596v1 EbN1 GCF_000143165.1 Dehalogenimonas Compl Gen 000/143/165/GCF_000143165.1_ASM14316v1 lykanthroporepellens BL-DC-9 GCF_000297055.2 Sulfuricella denitrificans Compl Gen 000/297/055/GCF_000297055.2_ASM29705v2 skB26 GCF_000166415.1 Halanaerobium Compl Gen 000/166/415/GCF_000166415.1_ASM16641v1 hydrogeniformans GCF_000284335.1 Caldisericum exile AZM16c01 Compl Gen 000/284/335/GCF_000284335.1_ASM28433v1 GCF_000007085.1 Caldanaerobacter Compl Gen 000/007/085/GCF_000007085.1_ASM708v1 subterraneus subsp. tengcongensis MB4 GCF_000177635.2 Desulfurispirillum indicum S5 Compl Gen 000/177/635/GCF_000177635.2_ASM17763v2 GCF_000178955.2 Granulicella mallensis Compl Gen 000/178/955/GCF_000178955.2_ASM17895v2 MP5ACTX8 GCF_000192745.1 Polymorphum gilvum Compl Gen 000/192/745/GCF_000192745.1_ASM19274v1 SL003B-26A1 GCF_000724625.1 Fimbriimonas ginsengisoli Compl Gen 000/724/625/GCF_000724625.1_ASM72462v1 Gsoil 348 GCF_000279145.1 Melioribacter roseus P3M-2 Compl Gen 000/279/145/GCF_000279145.1_ASM27914v1 GCF_000147715.2 Mesotoga prima Compl Gen 000/147/715/GCF_000147715.2_ASM14771v3 MesG1.Ag.4.2 GCF_001443605.1 bacterium L21-Spi-D4 Compl Gen 001/443/605/GCF_001443605.1_ASM144360v1 GCF_001007995.1 ‘Deinococcus soli’ Cha et al. Compl Gen 001/007/995/GCF_001007995.1_ASM100799v1 2014 GCF_000484535.1 Gloeobacter kilaueensis JS1 Compl Gen 000/484/535/GCF_000484535.1_ASM48453v1 GCF_000940805.1 Gynuella sunshinyii YC6258 Compl Gen 000/940/805/GCF_000940805.1_ASM94080v1 GCF_000828975.1 Burkholderiales bacterium Compl Gen 000/828/975/GCF_000828975.1_ASM82897v1 GJ-E10 GCF_000828655.1 Thermotoga caldifontis Compl Gen 000/828/655/GCF_000828655.1_ASM82865v1 AZM44c09 GCF_001281505.1 Lawsonella clevelandensis Compl Gen 001/281/505/GCF_001281505.1_ASM128150v1 GCF_001023575.1 Actinobacteria bacterium Compl Gen 001/023/575/GCF_001023575.1_ASM102357v1 IMCC26256 GCF_001507665.1 Deinococcus actinosderus Compl Gen 001/507/665/GCF_001507665.1_ASM150766v1 GCF_000952975.1 Peptoniphilus sp. ING2-D1G Compl Gen 000/952/975/GCF_000952975.1_D1G Fungi: GCF_000002945.1 Schizosaccharomyces pombe Chrom 000/002/945/GCF_000002945.1_ASM294v2 GCF_000315895.1 Millerozyma farinosa CBS Chrom 000/315/895/GCF_000315895.1_ASM31589v1 7064 GCF_000209165.1 Scheffersomyces stipitis CBS Chrom 000/209/165/GCF_000209165.1_ASM20916v1 6054 GCF_000146045.2 Saccharomyces cerevisiae Compl Gen 000/146/045/GCF_000146045.2_R64 S288c GCF_000243375.1 Torulaspora delbrueckii Chrom 000/243/375/GCF_000243375.1_ASM24337v1 GCF_000002525.2 Yarrowia lipolytica CLIB122 Chrom 000/002/525/GCF_000002525.2_ASM252v1 GCF_000026365.1 Zygosaccharomyces rouxii Chrom 000/026/365/GCF_000026365.1_ASM2636v1 GCF_000006445.2 Debaryomyces hansenii Chrom 000/006/445/GCF_000006445.2_ASM644v2 CBS767 GCF_000182925.2 Neurospora crassa OR74A Chrom 000/182/925/GCF_000182925.2_NC12 GCF_000091045.1 Cryptococcus neoformans Chrom 000/091/045/GCF_000091045.1_ASM9104v1 var. neoformans JEC21 GCF_000328475.2 Ustilago maydis 521 Chrom 000/328/475/GCF_000328475.2_Umaydis521_2.0 GCF_000182965.3 Candida albicans SC5314 Chrom 000/182/965/GCF_000182965.3_ASM18296v3 GCF_000002545.3 [Candida] glabrata Chrom 000/002/545/GCF_000002545.3_ASM254v2 GCF_000149955.1 Fusarium oxysporum f. sp. Chrom 000/149/955/GCF_000149955.1_ASM14995v2 lycopersici 4287 GCF_000240135.3 Fusarium graminearum PH-1 Chrom 000/240/135/GCF_000240135.3_ASM24013v3 GCF_000091225.1 Encephalitozoon cuniculi GB- Chrom 000/091/225/GCF_000091225.1_ASM9122v1 M1 GCF_000237345.1 Naumovozyma castellii CBS Chrom 000/237/345/GCF_000237345.1_ASM23734v1 4309 GCF_000227115.2 Naumovozyma dairenensis Chrom 000/227/115/GCF_000227115.2_ASM22711v2 CBS 421 GCF_000277815.2 Encephalitozoon hellem Chrom 000/277/815/GCF_000277815.2_ASM27781v3 ATCC 50504 GCF_000002515.2 Kluyveromyces lactis Compl Gen 000/002/515/GCF_000002515.2_ASM251v1 GCF_000091025.4 Eremothecium gossypii ATCC Compl Gen 000/091/025/GCF_000091025.4_ASM9102v4 10895 GCF_000226115.1 Thielavia terrestris NRRL Compl Gen 000/226/115/GCF_000226115.1_ASM22611v1 8126 GCF_000185945.1 Cryptococcus gattii WM276 Chrom 000/185/945/GCF_000185945.1_ASM18594v1 GCF_000026945.1 Candida dubliniensis CD36 Compl Gen 000/026/945/GCF_000026945.1_ASM2694v1 GCF_000235365.1 Eremothecium cymbalariae Chrom 000/235/365/GCF_000235365.1_ASM23536v1 DBVPG#7215 GCF_000146465.1 Encephalitozoon intestinalis Chrom 000/146/465/GCF_000146465.1_ASM14646v1 ATCC 50506 GCF_000226095.1 Thermothelomyces Compl Gen 000/226/095/GCF_000226095.1_ASM22609v1 thermophila ATCC 42464 GCF_001672515.1 Colletotrichum higginsianum Chrom 001/672/515/GCF_001672515.1_ASM167251v1 IMI 349063 GCF_000303195.2 Fusarium Chrom 000/303/195/GCF_000303195.2_FP7 pseudograminearum CS3096 GCF_000236905.1 Tetrapisispora phaffii CBS Chrom 000/236/905/GCF_000236905.1_ASM23690v1 4417 GCF_000149555.1 Fusarium verticillioides 7600 Chrom 000/149/555/GCF_000149555.1_ASM14955v1 GCF_000315875.1 Candida orthopsilosis Chrom 000/315/875/GCF_000315875.1_ASM31587v1 GCF_000002495.2 Magnaporthe oryzae 70-15 Chrom 000/002/495/GCF_000002495.2_MG8 GCF_000142805.1 Lachancea thermotolerans Chrom 000/142/805/GCF_000142805.1_ASM14280v1 CBS 6340 GCF_000304475.1 Kazachstania africana CBS Chrom 000/304/475/GCF_000304475.1_Ka_CBS2517 2517 GCF_000027005.1 Komagataella phaffii GS115 Chrom 000/027/005/GCF_000027005.1_ASM2700v1 GCF_000280035.1 Encephalitozoon romaleae Chrom 000/280/035/GCF_000280035.1_ASM28003v2 SJ-2008 GCF_000002655.1 Aspergillus fumigatus Af293 Chrom 000/002/655/GCF_000002655.1_ASM265v1 GCF_001640025.1 Sugiyamaella lignohabitans Compl Gen 001/640/025/GCF_001640025.1_ASM164002v2 GCF_000187245.1 Ogataea parapolymorpha Chrom 000/187/245/GCF_000187245.1_Hansenula_2 DL-1 GCF_000219625.1 Zymoseptoria tritici IPO323 Chrom 000/219/625/GCF_000219625.1_MYCGR_v2.0 GCF_000315915.1 Tetrapisispora blattae CBS Chrom 000/315/915/GCF_000315915.1_ASM31591v1 6284 GCF_001298625.1 Saccharomyces eubayanus Chrom 001/298/625/GCF_001298625.1_SEUB3.0 Invertebrates: GCF_000237925.1 Schistosoma mansoni Chrom 000/237/925/GCF_000237925.1_ASM23792v2 GCF_000004555.1 Caenorhabditis briggsae Chrom 000/004/555/GCF_000004555.1_ASM455v1 GCF_000002985.6 Caenorhabditis elegans Compl Gen 000/002/985/GCF_000002985.6_WBcel235 GCF_000002335.3 Tribolium castaneum Chrom 000/002/335/GCF_000002335.3_Tcas5.2 GCF_000005575.2 Anopheles gambiae str. PEST Chrom 000/005/575/GCF_000005575.2_AgamP3 GCF_000001215.4 Drosophila melanogaster Chrom 000/001/215/GCF_000001215.4_Release_6_plus_ISO1_MT GCF_000269505.1 Drosophila miranda Chrom 000/269/505/GCF_000269505.1_DroMir_2.2 GCF_000001765.3 Drosophila pseudoobscura Chrom 000/001/765/GCF_000001765.3_Dpse_3.0 pseudoobscura GCF_000754195.2 Drosophila simulans Chrom 000/754/195/GCF_000754195.2_ASM75419v2 GCF_000005975.2 Drosophila yakuba Chrom 000/005/975/GCF_000005975.2_dyak_caf1 GCF_000002325.3 Nasonia vitripennis Chrom 000/002/325/GCF_000002325.3_Nvit_2.1 GCF_000002195.4 Apis mellifera Chrom 000/002/195/GCF_000002195.4_Amel_4.5 GCF_000224145.2 Ciona intestinalis Chrom 000/224/145/GCF_000224145.2_KH GCF_001277935.1 Drosophila busckii Chrom 001/277/935/GCF_001277935.1_ASM127793v1 GCF_000214255.1 Bombus terrestris Chrom 000/214/255/GCF_000214255.1_Bter_1.0 Plants: GCF_000317415.1 Citrus sinensis Chrom 000/317/415/GCF_000317415.1_Csi_valencia_1.0 GCF_000987745.1 Gossypium hirsutum Chrom 000/987/745/GCF_000987745.1_ASM98774v1 GCF_000208745.1 Theobroma cacao Chrom 000/208/745/GCF_000208745.1_Criollo_cocoa_genome_V2 GCF_000004075.2 Cucumis sativus Chrom 000/004/075/GCF_000004075.2_ASM407v2 GCF_000002775.3 Populus trichocarpa Chrom 000/002/775/GCF_000002775.3_Poptr2_0 GCF_000001735.3 Arabidopsis thaliana Chrom 000/001/735/GCF_000001735.3_TAIR10 GCF_000686985.1 Brassica napus Chrom 000/686/985/GCF_000686985.1_Brassica.sub.—napus_assembly_v1.0 GCF_000309985.1 Brassica rapa Chrom 000/309/985/GCF_000309985.1_Brapa_1.0 GCF_000695525.1 Brassica oleracea var. Chrom 000/695/525/GCF_000695525.1_BOL oleracea GCF_000148765.1 Malus domestica Chrom 000/148/765/GCF_000148765.1_MalDomGD1.0 GCF_000340665.1 Cajanus cajan Chrom 000/340/665/GCF_000340665.1_C.cajan_V1.0 GCF_000331145.1 Cicer arietinum Chrom 000/331/145/GCF_000331145.1_ASM33114v1 GCF_000004515.4 Glycine max Chrom 000/004/515/GCF_000004515.4_Glycine.sub.—max_v2.0 GCF_001865875.1 Lupinus angustifolius Chrom 001/865/875/GCF_001865875.1_LupAngTanjil_v1.0 GCF_000219495.3 Medicago truncatula Chrom 000/219/495/GCF_000219495.3_MedtrA17_4.0 GCF_000499845.1 Phaseolus vulgaris Chrom 000/499/845/GCF_000499845.1_PhaVulg1_0 GCF_001190045.1 Vigna angularis Chrom 001/190/045/GCF_001190045.1_Vigan1.1 GCF_001625215.1 Daucus carota subsp. sativus Chrom 001/625/215/GCF_001625215.1_ASM162521v1 GCF_000710875.1 Capsicum annuum Chrom 000/710/875/GCF_000710875.1_Pepper_Zunla_1_Ref_v1.0 GCF_000188115.3 Solanum lycopersicum Chrom 000/188/115/GCF_000188115.3_SL2.50 GCF_000512975.1 Sesamum indicum Chrom 000/512/975/GCF_000512975.1_S.sub.—indicum_v1.0 GCF_001433935.1 Oryza sativa Japonica Group Chrom 001/433/935/GCF_001433935.1_IRGSP-1.0 GCF_000231095.1 Oryza brachyantha Chrom 000/231/095/GCF_000231095.1_Oryza.sub.—brachyantha.v1.4b GCF_000263155.2 Setaria italica Chrom 000/263/155/GCF_000263155.2_Setaria.sub.—italica_v2.0 GCF_000003195.2 Sorghum bicolor Chrom 000/003/195/GCF_000003195.2_Sorbi1 GCF_000005005.1 Zea mays Chrom 000/005/005/GCF_000005005.1_B73_RefGen_v3 GCF_001540865.1 Ananas comosus Chrom 001/540/865/GCF_001540865.1_ASM154086v1 GCF_000313855.2 Musa acuminata subsp. Chrom 000/313/855/GCF_000313855.2_ASM31385v2 malaccensis GCF_001876935.1 Asparagus officinalis Chrom 001/876/935/GCF_001876935.1_Aspof.V1 GCF_000005505.2 Brachypodium distachyon Chrom 000/005/505/GCF_000005505.2_Brachypodium.sub.—distachyon_v2.0 GCF_001406875.1 Solanum pennellii Chrom 001/406/875/GCF_001406875.1_SPENNV200 GCF_000612285.1 Gossypium arboreum Chrom 000/612/285/GCF_000612285.1_Gossypium.sub.—arboreum_v1.0 GCF_000327365.1 Gossypium raimondii Chrom 000/327/365/GCF_000327365.1_Graimondii2_0 GCF_000003745.3 Vitis vinifera Chrom 000/003/745/GCF_000003745.3_12X GCF_000091205.1 Cyanidioschyzon merolae Compl Gen 000/091/205/GCF_000091205.1_ASM9120v1 strain 10D GCF_001879085.1 Nicotiana attenuata Chrom 001/879/085/GCF_001879085.1_NIATTr2 GCF_000442705.1 Elaeis guineensis Chrom 000/442/705/GCF_000442705.1_EG5 GCF_000184155.1 Fragaria vesca subsp. vesca Chrom 000/184/155/GCF_000184155.1_FraVesHawaii_1.0 GCF_000214015.2 Ostreococcus tauri Chrom 000/214/015/GCF_000214015.2_version_050606 GCF_000633955.1 Camelina sativa Chrom 000/633/955/GCF_000633955.1_Cs GCF_000346735.1 Prunus mume Chrom 000/346/735/GCF_000346735.1_P.mume_V1.0 GCF_000741045.1 Vigna radiata var. radiata Chrom 000/741/045/GCF_000741045.1_Vradiata_ver6 GCF_000511025.2 Beta vulgaris subsp. vulgaris Chrom 000/511/025/GCF_000511025.2_RefBeet-1.2.2 GCF_000092065.1 Ostreococcus lucimarinus Compl Gen 000/092/065/GCF_000092065.1_ASM9206v1 CCE9901 GCF_000090985.2 Micromonas commoda Compl Gen 000/090/985/GCF_000090985.2_ASM9098v2 GCF_000826755.1 Ziziphus jujuba Chrom 000/826/755/GCF_000826755.1_ZizJuj_1.1 Protoza: GCF_000150955.2 Phaeodactylum tricornutum Chrom 000/150/955/GCF_000150955.2_ASM15095v2 CCAP 1055/1 GCF_000002845.2 Leishmania braziliensis Chrom 000/002/845/GCF_000002845.2_ASM284v2 MHOM/BR/75/M2904 GCF_000227135.1 Leishmania donovani Chrom 000/227/135/GCF_000227135.1_ASM22713v2 GCF_000002725.2 Leishmania major strain Compl Gen 000/002/725/GCF_000002725.2_ASM272v2 Friedlin GCF_000234665.1 Leishmania mexicana Chrom 000/234/665/GCF_000234665.1_ASM23466v4 MHOM/GT/2001/U1103 GCF_000002875.2 Leishmania infantum JPCM5 Chrom 000/002/875/GCF_000002875.2_ASM287v2 GCF_000755165.1 Leishmania panamensis Chrom 000/755/165/GCF_000755165.1_ASM75516v1 GCF_000210295.1 Trypanosoma brucei Chrom 000/210/295/GCF_000210295.1_ASM21029v1 gambiense DAL972 GCF_000165345.1 Cryptosporidium parvum Chrom 000/165/345/GCF_000165345.1_ASM16534v1 Iowa II GCF_000006565.2 Toxoplasma gondii ME49 Chrom 000/006/565/GCF_000006565.2_TGA4 GCF_900002335.2 Plasmodium chabaudi Chrom 900/002/335/GCF_900002335.2_PCHAS01 chabaudi GCF_000321355.1 Plasmodium cynomolgi strain Chrom 000/321/355/GCF_000321355.1_PcynB_1.0 B GCF_000002765.3 Plasmodium falciparum 3D7 Chrom 000/002/765/GCF_000002765.3_ASM276v1 GCF_000006355.1 Plasmodium knowlesi strain Chrom 000/006/355/GCF_000006355.1_ASM635v1 H GCF_001601855.1 Plasmodium reichenowi Chrom 001/601/855/GCF_001601855.1_ASM160185v1 GCF_000002415.2 Plasmodium vivax Chrom 000/002/415/GCF_000002415.2_ASM241v2 GCF_000165395.1 Babesia bovis Chrom 000/165/395/GCF_000165395.1_ASM16539v1 GCF_000981445.1 Babesia bigemina Chrom 000/981/445/GCF_000981445.1_Bbig001 GCF_000691945.1 Babesia microti strain RI Chrom 000/691/945/GCF_000691945.1_ASM69194v1 GCF_000342415.1 Theileria equi strain WA Chrom 000/342/415/GCF_000342415.1_JCVI-bewag-v1.1 GCF_000003225.2 Theileria annulata strain Chrom 000/003/225/GCF_000003225.2_ASM322v1 Ankara GCF_000165365.1 Theileria parva Chrom 000/165/365/GCF_000165365.1_ASM16536v1 GCF_000208865.1 Neospora caninum Liverpool Chrom 000/208/865/GCF_000208865.1_ASM20886v2 GCF_000149405.2 Thalassiosira pseudonana Chrom 000/149/405/GCF_000149405.2_ASM14940v2 CCMP1335 GCF_000004695.1 Dictyostelium discoideum Chrom 000/004/695/GCF_000004695.1_dicty_2.7 GCF_000740895.1 Theileria orientalis strain Compl Gen 000/740/895/GCF_000740895.1_ASM74089v1 Shintoku GCF_001680005.1 Plasmodium coatneyi Chrom 001/680/005/GCF_001680005.1_ASM168000v1 GCF_001602025.1 Plasmodium gaboni Chrom 001/602/025/GCF_001602025.1_ASM160202v1 Mammals: GCF_000002275.2 Ornithorhynchus anatinus Chrom 000/002/275/GCF_000002275.2_Ornithorhynchus.sub.—anatinus_5.0.1 GCF_000004665.1 Callithrix jacchus Chrom 000/004/665/GCF_000004665.1_Callithrix.sub.—jacchus-3.2 GCF_000364345.1 Macaca fascicularis Chrom 000/364/345/GCF_000364345.1_Macaca.sub.—fascicularis_5.0 GCF_000772875.2 Macaca mulatta Chrom 000/772/875/GCF_000772875.2_Mmul_8.0.1 GCF_000264685.2 Papio anubis Chrom 000/264/685/GCF_000264685.2_Panu_2.0 GCF_000151905.2 Gorilla gorilla gorilla Chrom 000/151/905/GCF_000151905.2_gorGor4 GCF_000258655.2 Pan paniscus Chrom 000/258/655/GCF_000258655.2_panpan1.1 GCF_000001515.7 Pan troglodytes Chrom 000/001/515/GCF_000001515.7_Pan_tro_3.0 GCF_000001545.4 Pongo abelii Chrom 000/001/545/GCF_000001545.4_P_pygmaeus_2.0.2 GCF_000001405.36 Homo sapiens Chrom 000/001/405/GCF_000001405.36_GRCh38.p10 GCF_000002285.3 Canis lupus familiaris Chrom 000/002/285/GCF_000002285.3_CanFam3.1 GCF_000181335.2 Felis catus Chrom 000/181/335/GCF_000181335.2_Felis.sub.—catus_8.0 GCF_000002305.2 Equus caballus Chrom 000/002/305/GCF_000002305.2_EquCab2.0 GCF_000003025.5 Sus scrofa Chrom 000/003/025/GCF_000003025.5_Sscrofa10.2 GCF_000003055.6 Bos taurus Chrom 000/003/055/GCF_000003055.6_Bos.sub.—taurus_UMD_3.1.1 GCF_000247795.1 Bos indicus Chrom 000/247/795/GCF_000247795.1_Bos.sub.—indicus_1.0 GCF_001704415.1 Capra hircus Chrom 001/704/415/GCF_001704415.1_ARS1 GCF_000298735.2 Ovis aries Chrom 000/298/735/GCF_000298735.2_Oar_v4.0 GCF_000003625.3 Oryctolagus cuniculus Chrom 000/003/625/GCF_000003625.3_OryCun2.0 GCF_000001635.25 Mus musculus Chrom 000/001/635/GCF_000001635.25_GRCm38.p5 GCF_000001895.5 Rattus norvegicus Chrom 000/001/895/GCF_000001895.5_Rnor_6.0 GCF_000002295.2 Monodelphis domestica Chrom 000/002/295/GCF_000002295.2_MonDom5 GCF_000409795.2 Chlorocebus sabaeus Chrom 000/409/795/GCF_000409795.2_Chlorocebus.sub.—sabeus_1.1 GCF_000146795.2 Nomascus leucogenys Chrom 000/146/795/GCF_000146795.2_Nleu_3.0 GCF_000317375.1 Microtus ochrogaster Chrom 000/317/375/GCF_000317375.1_MicOch1.0 Non-mammalian vertebrates: GCF_000242695.1 Lepisosteus oculatus Chrom 000/242/695/GCF_000242695.1_LepOcu1 GCF_000002035.5 Danio rerio Chrom 000/002/035/GCF_000002035.5_GRCz10 GCF_000951615.1 Cyprinus carpio Chrom 000/951/615/GCF_000951615.1_common_carp_genome GCF_001660625.1 Ictalurus punctatus Chrom 001/660/625/GCF_001660625.1_IpCoco_1.2 GCF_000721915.3 Esox lucius Chrom 000/721/915/GCF_000721915.3_Eluc_V3 GCF_000233375.1 Salmo salar Chrom 000/233/375/GCF_000233375.1_ICSASG_v2 GCF_000633615.1 Poecilia reticulata Chrom 000/633/615/GCF_000633615.1_Guppy_female_1.0_MT GCF_000313675.1 Oryzias latipes Chrom 000/313/675/GCF_000313675.1_ASM31367v1 GCF_001858045.1 Oreochromis niloticus Chrom 001/858/045/GCF_001858045.1_ASM185804v2 GCF_001663975.1 Xenopus laevis Chrom 001/663/975/GCF_001663975.1_Xenopus.sub.—laevis_v2 GCF_000004195.3 Xenopus tropicalis Chrom 000/004/195/GCF_000004195.3_Xenopus.sub.—tropicalis_v9.1 GCF_000241765.3 Chrysemys picta bellii Chrom 000/241/765/GCF_000241765.3_Chrysemys.sub.—picta.sub.—bellii-3.0.3 GCF_000002315.4 Gallus gallus Chrom 000/002/315/GCF_000002315.4_Gallus.sub.—gallus-5.0 GCF_000146605.2 Meleagris gallopavo Chrom 000/146/605/GCF_000146605.2_Turkey_5.0 GCF_001522545.2 Parus major Chrom 001/522/545/GCF_001522545.2_Parus.sub.—major1.1 GCF_000090745.1 Anolis carolinensis Chrom 000/090/745/GCF_000090745.1_AnoCar2.0 GCF_000180615.1 Takifugu rubripes Chrom 000/180/615/GCF_000180615.1_FUGU5 GCF_000151805.1 Taeniopygia guttata Chrom 000/151/805/GCF_000151805.1_Taeniopygia.sub.—guttata-3.2.4 GCF_000247815.1 Ficedula albicollis Chrom 000/247/815/GCF_000247815.1_FicAlb1.5 GCF_001577835.1 Coturnix japonica Chrom 001/577/835/GCF_001577835.1_Coturnix.sub.—japonica_2.0 GCF_001465895.1 Nothobranchius furzeri Chrom 001/465/895/GCF_001465895.1_Nfu_20140520 GCF_000523025.1 Cynoglossus semilaevis Chrom 000/523/025/GCF_000523025.1_Cse_v1.0
[0117] The examples show:
EXAMPLE 1: DESIGN OF A NUCLEIC ACID LIBRARY OF THE INVENTION THAT ENCODES SHORT PEPTIDES BASED ON AMINO ACID SEQUENCES OF PROTEINS COMPRISED IN THE HUMAN PROTEOME (“HUPEX”)
[0118] First, a single “mega protein” amino acid sequence was generated by concatenating the amino acid sequences of a plurality of individual proteins (in this case, all 21,018 such proteins) comprised in the reference proteome of Homo sapiens. Hence, such amino acid sequences can be considered to be of naturally occurring proteins; that is they occur naturally in humans. The reference proteome used (UP000005640_9606.fasta) was obtained from the EMBL-EBI web-based resource: “Reference proteomes—Primary proteome sets for the Quest For Orthologs” (http://www.ebi.ac.uk/reference_proteomes, accessed on 5 Feb. 2017), Release 2017_01 based on UniProt Release 2017_01.
[0119] Each join between the amino acid sequences of two concatenated proteins was marked by using a spacer symbol “_” such that (for example) two example proteins listed, in FASTA-format, in a human reference proteome:
TABLE-US-00003 >tr|A0A024R161|A0A024R161_HUMAN Guanine nucleotide-binding protein subunit gamma OS = Homo sapiens GN = DNAJC25-GNG10 PE = 3 SV = 1 MGAPLLSPGWGAGAAGRRWWMLLAPLLPALLLVRPAGALVEGLYCGTRD CYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQPGDEGPGRTPQSAE EAFLLVATAYETLKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREP RSCALL >tr|A0A075B6F4|A0A075B6F4_HUMAN T-cell receptor beta variable 21/OR9-2 (pseudogene) (Fragment) OS = Homo sapiens GN = TRBV21OR9-2 PE = 4 SV = 1 XRFLSEPTRCLRLLCCVALSFWGAASMDTKVTQRPRFLVKANEQKAKMD CVPIKRHSYVYWYHKTLEEELKFFIYFQNEETIQKAEIINERFSAQCPQ NSPCTLEIQSTESGDTARYFCANSK
[0120] would be concatenated to form a single amino acid sequence, with the region around the join shown below:
TABLE-US-00004 [...]LVGVPAGSNPFREPRSCALL_ XRFLSEPTRCLRLLCCVALS[...]
[0121] Second, a computer program selected all 46 amino acid-long regions that were spaced apart by a window of 10 amino acids from the “mega protein” amino acid sequence representing the plurality of proteins (in this case, all 21,018). However, in other embodiments, the computer program could be instructed to select amino acid regions having an alterative (predefined) length, for example any such length that is between 25 amino acids and 110 amino acids; and/or the computer program could be instructed to space such regions apart by an alterative (predefined) window, for example such a window of between about 2 and 40 amino acids. For example, a filing tiling of such a selection of 46 amino acid regions spaced by a 10 amino acid window from a concatenation of the first proteins above would generate the following amino acid sequences representing short peptides (only the first three such peptides sequences are shown):
TABLE-US-00005 Peptide 1: MGAPLLSPGWGAGAAGRRWWMLLAPLLPALLLVRPAGALVEGLYCG Peptide 2: GAGAAGRRWWMLLAPLLPALLLVRPAGALVEGLYCGTRDCYEVLGV Peptide 2: MLLAPLLPALLLVRPAGALVEGLYCGTRDCYEVLG[...]
[0122] Third, the resulting set of 46 amino acid-long peptide sequences where filtered by removing from the set any sequences with any one (or more) of the following features: [0123] (a) Any sequence having a length NOT equal to 46 amino acids (both, as a quality-control step for the computer program, and to remove any—short—sequences arising from the end of a protein sequence); [0124] (b) Any sequence comprising the spacer symbol (in this case, “_”) representing a join between the amino acid sequences of two proteins; [0125] (c) Any sequence comprising a symbol for an ambiguous amino acid (for example, “B”, “J”, “X” or “Z”; where in certain databases, such ambiguity codes can have the following meanings: B=D or N, J=I or L, X=unknown, Z=E or Q; as an example, the first 46 amino acid-long peptide sequence of the second protein shown above—as it starts with an “X”-would hence be removed from the set); and/or [0126] (d) Any sequence that is NOT unique (that is, any sequence that is 100% identical to any other sequence).
[0127] Fourth, the isoelectric point (pI) of each resulting peptide sequence remaining in the set was predicted using generally available pI-prediction software (in this case, the “pI” function of the “R peptide Package”; Osorio et al 2015, The R Journal. 7:4; https://cran.r-project.org/web/packages/Peptides/index.html; using the argument pKscale=“EMBOSS”). Any peptide having an amino acid sequence predicted to have a pI of between 6 and 8 was also removed from the set. The isoelectric point of a peptide is the pH at which the peptide would have no net charge, and can often precipitate out of a solution of such pH. Accordingly, peptides with a predicted pI of around physiological pH (e.g. 6 to 7.4 or 6 to 8) are, in some embodiments, excluded from the set, as they may be those more likely to have unfavourable properties under such conditions (e.g., by precipitating upon expression).
[0128] Fifth, the resulting set of amino acid sequences (after the filtering described in the third and second step) was subjected to a final filtering to positively select only those 46 amino acid sequences that showed 100% identity to an amino acid sequence present in the reference proteome of Mouse (Mus musculus; UP000000589_10090.fasta, obtained as described above).
[0129] As will now be understood by the person of ordinary skill, the final set of (46-long) amino acid sequences will be spaced apart along the naturally occurring protein(s) by a window of (in this case) 10 amino acids or multiples of 10 amino acids. This is because one or more intervening amino acid sequences may have been omitted from the final set because it did not conform to one or other of the various filtering criteria.
[0130] The final set of (46-long) amino acid sequences consisted, in this example, of about 300,000 individual sequences, with at least one such sequence representative of over 21,000 different proteins of the human proteome, and a mean of about 14.2 such sequences per protein and a standard deviation of 3.8 sequences (with 95% of the proteins will be represented by between 7.6 and 20.7 peptide sequences).
[0131] As will now be apparent to the person of ordinary skill, the final set of amino acid sequences of peptides that represent the proteome(s) used for the selection may be more or less than this number, and the distribution of the number of peptides for each of the proteins may also differ. Not only will the number and nature of the final set of amino acid sequences depend on the sequences of the plurality of proteins first concatenated (for example, the proteome of a single species used, or those of multiple species), but other factors can affect the final set. For example, the sequence regions initially selected may be shorter (or longer) than the 46 amino acids used herein, and/or spacing window may be shorter (or longer) than the 10 amino acids used herein. Furthermore, one or more of the filtering criteria described above may be omitted, or different filtering criteria may be applied instead or as well (examples of other filtering steps are described in other examples herein). Indeed, depending on the particular properties (such as size, diversity, coverage and/or solubility etc.) desired for a library of the present invention, and/or the method of its physical preparation (such as described below), and in particular the limitations in size, complexity or cost of the method used for its physical preparation, the person of ordinary skill will now have the ability to select only those amino acid sequences for peptides to form any particular library suitable for their needs.
[0132] Six, each 46 amino acid sequence was reverse translated using for each amino acid the most frequently used codon for such amino acid of the human codon frequency table shown in Table 1.1 below (Codon Usage Database; Nakamura et al, 2000, NAR 28:292; http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=9606&aa=1&style=N, accessed 4 Jun. 2017).
[0133] As will now be apparent to the person of ordinary skill, however, alterative human codon frequency tables may be used or, and depending on the species of the expression system in which the nucleic acid library is intended to be expressed, codon frequency tables of other species may be used.
TABLE-US-00006 TABLE 1.1 Human codon frequency table (codon | aa | fraction per codon per aa). UUU F 0.46 UCU S 0.19 UAU Y 0.44 UGU C 0.46 UUC F 0.54 UCC S 0.22 UAC Y 0.56 UGC C 0.54 UUA L 0.08 UCA S 0.15 UAA * 0.30 UGA * 0.47 UUG L 0.13 UCG S 0.05 UAG * 0.24 UGG W 1.00 CUU L 0.13 CCU P 0.29 CAU H 0.42 CGU R 0.08 CUC L 0.20 CCC P 0.32 CAC H 0.58 CGC R 0.18 CUA L 0.07 CCA P 0.28 CAA Q 0.27 CGA R 0.11 CUG L 0.40 CCG P 0.11 CAG Q 0.73 CGG R 0.20 AUU I 0.36 ACU T 0.25 AAU N 0.47 AGU S 0.15 AUC I 0.47 ACC T 0.36 AAC N 0.53 AGC S 0.24 AUA I 0.17 ACA T 0.28 AAA K 0.43 AGA R 0.21 AUG M 1.00 ACG T 0.11 AAG K 0.57 AGG R 0.21 GUU V 0.18 GCU A 0.27 GAU D 0.46 GGU G 0.16 GUC V 0.24 GCC A 0.40 GAC D 0.54 GGC G 0.34 GUA V 0.12 GCA A 0.23 GAA E 0.42 GGA G 0.25 GUG V 0.46 GCG A 0.11 GAG E 0.58 GGG G 0.25
[0134] Seven, the resulting nucleic acid sequences encoding for the peptides were then analysed for undesired sub-sequences resulting from combinations of codons. Particular examples of such undesired sub-sequence include an internal Kozak sequence and/or a restriction enzyme site for a restriction enzyme intended to be used for the cloning of the resulting library, in each case generated from a combination of codons. If an undesired sub-sequence was present in a nucleic acid sequence, then the next most commonly used codon was used in place of one or other of the codons in the combination such that undesired subsequence was no longer present in the nucleic acid sequence.
[0135] In this example, a Kozak sequence of “CCATGG” was deemed undesired, and any codon combinations in the nucleic acid sequences that formed such a sub-sequence were adapted to use a less frequent codon so that such sub-sequence was no longer present.
[0136] As the library of this example was to be cloned into expression vectors using certain restriction enzymes, any sub-sequences in nucleic acid sequences that were recognition sites for such restriction enzymes were also deemed undesirable. The restriction enzymes BamHI and XhoI were envisioned as restriction enzymes that may be sued in such cloning procedures, and hence any of the following sub-sequences (the respective recognition site for such restriction enzymes) were deemed undesirable: 5′GGATCC and 5′ CTCGAG. Any codon combinations in the nucleic acid sequences that formed such any sub-sequence that was such a (predefined) restriction enzymes recognition site were adapted to use a less frequent codon so that such sub-sequence was no longer present. As will be now apparent to the person of ordinary skill, depending on any restriction enzyme(s) planned to be used, the applicable sub-sequence consisting of a recognition site of such restriction enzyme(s) can be so removed by appropriate use of an alternative codon.
[0137] As will also be apparent to the person of ordinary skill, as the nucleic acid sequences were generated by reverse translation of the (naturally occurring) amino acid sequences, the resulting library of nucleic acid sequences will comprise nucleic acids sequences that themselves are non-natural, as codons will be used (and/or combinations or codons) that are not those used by the naturally occurring genomic sequence to code one or more particular amino acids at that position in the protein. Accordingly, the nucleic acid libraries of the present invention will comprise a plurality of non-natural nucleic acid sequences.
EXAMPLE 2: SYNTHESIS OF THE HUPEX NUCLEIC ACID LIBRARY OF THE INVENTION
[0138] First, each nucleic acid sequence in the library designed in Example 1 to encode for unique 46 amino acid long peptide “fragments” of naturally occurring human proteins was adapted with 5′ and 3′ sequences adapted to provide the sequence of an oligonucleotide enable cloning of the nucleic acid library and/or to enable expression of the peptide encoded therein.
[0139] In this example, the general structure of each resulting nucleic acid sequence of such oligonucleotide (with the 5′ and 3′ regions) was: [0140] Forward-amp_BamHI_Kozac_Gly_VARIABLE-REGION_Stop_XhoI_Reverse-amp,
[0141] where “Forward-amp” and “Reverse-amp” represent nucleic acid sequences chosen so that the resulting oligo could be amplified by PCR using appropriate primers; “BamHI” and “XhoI” represent nucleic acid sequences of the respective restriction enzyme's recognition site; “Kozak” represents a Kozak sequence (including a start codon); “Gly” represents a codon for a single glycine acid-linker; “Stop” represents a stop codon; and “VARIABLE-REGION” represents an individual 138 bp nucleic acid that encodes a given 46 amino acid long peptide (present in the set), from the library of nucleic acid designed in Example 1.
[0142] In this example, the forward and reverse amplification sequences, Kozak sequence and stop codon used is set forth in Table 2.1 below.
TABLE-US-00007 TABLE 2.1 Common sequences used in the HuPEx library. SEQ Feature Sequence (5′ to 3′) ID NO.: Forward amplification TGCCACCTGACGTCTAAGAA 1 Reverse amplification GCTCACTCAAAGGCGGTAAT 2 Kozak sequence CCATGG N/A Stop codon TAA N/A
[0143] Accordingly, a nucleic acid sequence of an indicative oligonucleotide resulting from such design and encoding for the following indicative 46 amino acid sequence (SEQ ID NO. 13) present in the set: [0144] LAQTACVVGR PGPHPTQFLA AKERTKSHVP SLLDADVEGQ SRDYTV,
[0145] has a complete nucleic acid sequence shown below (SEQ ID NO. 3), where the following features are marked as follows: 138 bp region coding for the above 46 amino acid sequence in bold; forward and reverse amplification sequences in lower case; restriction enzyme sites boxed, Kozak sequence double underlined; and “*” is indicated above the first base of the start and stop codons.
TABLE-US-00008 SEQ ID NO: 3: Nucleic acid sequence of an indicative oligonucleotide
[0146] As will now be apparent to the person or ordinary art, the nucleic acid sequence of the final oligonucleotides may be, for example, alternatively designed not to comprise a Kozak/start or stop codon(s). In this case, the Kozak/start and stop codon(s) can be provided by the host vector. Such a design (as demonstrated in other examples below) can allow the libraries to be produced in tagged format, by cloning them into a vector with, for example, a vector-encoded FLAG tag, N- or C-terminally to the encoded peptide.
[0147] In alternative embodiments, two versions of a library of the invention may be constructed: one with and one without a start codon. Such an embodiment can be useful as an internal reference for data analysis of screens using the library, as it would allow effects of the peptide from effects of the vector/construct itself (which should be identified as false positives) to be distinguished. For example, to distinguish those cases where particular sequences are amplified better by PCR, DNA sequences that attract some cellular machinery and cause indirect effects etc.
[0148] Second, the set of nucleic acid sequences of all approximately 300,000 oligonucleotides was used to chemically synthesis each of the oligonucleotides by conventional approaches.
[0149] In this case, the semi-pooled 10,000-well silicon chip-based oligonucleotide synthesis approach of Twist Bioscience (San Francisco, Calif.) was used to synthesise all approximately 300,000 oligonucleotides, and the oligonucleotides were therefore available in sub-pools each having a complexity of approximately 2,000 oligonucleotides. It should be noted here, that if each sub-pool-synthesised oligonucleotide where synthesised with a different combination of pairs of primer-pairs (for example, 45 different primer-pairs used in all combinations would provide 45*45=2025 different combinations), then it would then be possible to recover an *individual* sequence by conducting PCR with only using the applicable specific primer-pair combination. However, other synthetic oligonucleotide approaches could be used, such as array-based synthesis (e.g., Affymetrix) or in-situ synthesis printing (Agilent).
EXAMPLE 3: CLONING OF THE HUPEX NUCLEIC ACID LIBRARY OF THE INVENTION INTO EXPRESSION VECTORS
[0150] The set of approximately 300,000 oligonucleotides were (in pooled or sub-polled format) cloned into a lentiviral expression system briefly described as follows.
[0151] First, a pool of oligonucleotides was subjected to PCR amplification (by standard procedures and using the primers having the sequences 5′-TGCCACCTGACGTCTAAGAA-3 (SEQ ID NO. 4) and 5-ATTACCGCCTTTGAGTGAGC-3 (SEQ ID NO. 5), corresponding to the forward and reverse amplification sequences, respectively, in the oligonucleotides. Second, the resulting product was digested with the applicable restriction enzymes (in this case BamHI and XhoI) to provide sticky-ended constructs for cloning.
[0152] Third, the sticky-ended constructs were ligated into a sample of a BamHI/XhoI-digested lentiviral vector (for example, pMOST25). Sixty (60) base pairs of the cloning site of pMOST25 is shown below by SEQ ID NO. 6, and the resulting recombinant construct with a BamHI/XhoI-digested amplification product of the indicative oligonucleotide shown in Example 2, would have the sequence shown by SEQ ID NO. 7. BamHI and XhoI restriction sites are boxed; the Kozak sequence is double underlined; the first base of the start/stop codons marked above with a “*”; and the 138 bp region coding for the 46 amino acid sequence in bold.
TABLE-US-00009 SEQ ID NO. 6: 60bp of the cloning site of pMOST25 lentiviral vector.
[0153] Transformation/transfection of the recombinant vector into a host cell will enable propagation, expression and/or screening of the nucleic acid library of the invention. As will be apparent to the person of ordinary skill, the a nucleic acid library—after being amplified and/or propagated/maintained in host cells—may be considered to no longer be “synthetic”, as the nucleic acid molecules will, by then, have been enzymatically (either in-vitro or in-vivo) produced. However, such a nucleic acid library is still considered to be one of the present invention.
[0154] Expression of the construct shown in SEQ ID NO. 7 will result in the 48 amino acid peptide having a sequence as shown in SEQ ID NO. 8, where the sequence of the originally encoded 46 amino acid indicative peptide is shown in bold after the initial methionine and the linking glycine.
TABLE-US-00010 SEQ ID NO. 8: Indicative expressed peptide. MGLAQTACVV GRPGPHPTQF LAAKERTKSH VPSLLDADVE GQSRDYTV
[0155] As the person or ordinary skill we note, such expressed comprises N- and C-terminal amino acids corresponding to the 5′ and 3′ restriction enzyme recognition sites (and, in this case, a single linking Val). Accordingly, even though the original 46 amino acid sequence is a fragment of a naturally occurring protein, the resulting 52 amino acid expressed peptide is a non-natural. Accordingly, the libraries of the present invention will encode for a plurality of non-natural peptides.
[0156] The cloning of the library can be conducted in a pooled manner, or in a semi-polled manner. Furthermore, the resulting pooled/sub-pooled clones can be individually picked/arrayed using automated cell-sorting technologies, such as the QPix (Molecular Devices), FACS or single-cell dispensing (e.g. VIPS™ Cell Dispenser or Solentim Ltd, UK, or the Single Cell Printer—SCP—or Cytena GmbH, Germany).
EXAMPLE 4: PHENOTYPIC SCREENING WITH THE LENTIVIRAL-CLONED HUPEX LIBRARY
[0157] A HuPEx library, such as designed and constructed above, was used to screen for phenotypic alterations using the assay formats described above, either as pooled or arrayed libraries. Prior to such screen, the HuPEx library can, alternatively, be pooled with one or more other analogous libraries that expressed short peptides. For example, the HuPEx library can be screened in a pool together with a library that expresses human small Open Reading Frames (sORFs), such as the sORF library described in PCT/GB2016/054038 (in particular, in Example A) of PCT/GB2016/054038).
[0158] (1) Pooled 6-Thioguanine Resistance Screen
[0159] Resistance to the chemotherapeutic drug 6-thioguanine has been previously demonstrated to be a fairly strict selection system; with a narrow group of proteins being able to mediate the phenotype (see Wang et al 2014, Science 343:80). The inventors sought to use this system to demonstrate how a library of the present invention can be utilised in identifying phenotype-modulating proteins even under such stringent conditions.
[0160] HEK293 cells were transfected with the pooled HuPEx nucleic acid library, cloned into the lentiviral vector as above, which is designed to express a plurality of short-expressed-peptides (SEPs). Virus was harvested, titered, and a batch of KBM7 cells was infected with the SEP-expressing viruses. The library of virus-transduced KBM7 cells was subsequently exposed to a concentration of 6-thioguanine that was experimentally determined to kill 99.999% of KBM7 cells. Survivors, carrying inserts that express resistance-inducing SEPs, were isolated from the pool, expanded and genomic DNA was harvested. The inserts that express resistance-inducing SEPs were amplified using PCR and submitted to Next Generation Sequencing. After bioinformatics analysis of the data, SEPs that mediate the resistance to 6-thioguanine, and likely acting upon mismatch repair processes, were identified (
[0161] (2) Pooled PTEN Synthetic Lethality Screen
[0162] To find SEPs able to selectively inhibit proliferation or kill cells lacking the PTEN tumour suppressor, SEPs were screened in an isogenic cell model pair (MCF10A WT and MCF10A PTEN knockout).
[0163] As in (1) above, a pool of cells was infected with a library of HuPEx expressing SEPs. Cells were also infected with BugPEx and OmePEx libraries in a similar fashion. Under all conditions, the target cell lines, MCF10A and MCF10A PTEN KO, were infected in parallel. The cells were plated at low density in order to allow for cell growth over a period of five days. Samples from either cell population were then submitted to NGS as in (1). The relative abundances of SEP sequences in the wildtype-control control set (MCF10A) and the PTEN knockout set (MCF10A PTEN KO) were compared, and SEPs depleted in the knockout cells were identified (
[0164] Identified hits were then validated in the same models by repeating the primary assay with additional controls. Hits were considered validated if they showed a significant reduction of cell growth in MCF10A PTEN KO cells compared to MCF10A cells in three biological replicates.
EXAMPLE 5: DESIGN AND CONSTRUCTION OF A NUCLEIC ACID LIBRARY OF THE INVENTION THAT ENCODES SHORT PEPTIDES BASED ON AMINO ACID SEQUENCES OF PROTEINS COMPRISED IN THE PROTEOMES OF EVOLUTIONARY DIVERSE MICROBIOTA (“BUGPEX”)
[0165] A library of the invention was designed and constructed wherein the amino acid sequences of the source-proteins were those of naturally occurring proteins from a plurality of different species; in this example, the protein sequences comprised in the reference proteomes of an evolutionary diverse set of micro-organisms.
[0166] First, a mega protein amino acid sequence was generated as described in Example 1, but by using all the protein sequences comprised in the set of reference proteomes set out Table A. The second, third and fourth steps of Example 1 were conducted by analogy, to generate a filtered set of several hundred thousand unique 46 amino acid long sequences.
[0167] In this case however, the fifth step of Example 1 was replaced by an alternative filtering step to select, from such list of several hundred thousand amino acid sequences, 500,000 of such sequences that were predicted to be least likely to have a disordered segment. For example, the program DisEMBL (Linding et al 2003, Structure 11:1453; http://dis.embl.de) can be applied to consider and sort on the three intrinsically disordered protein parameters of loops/coils, hot-loops and Remark-465. The resulting number of amino acids present in a disordered stretch in a given peptide is counted, and such counts are ranked for each of the three parameters. The peptide sequences are then ranked by the mean of all three ranked-parameters so that peptides predicted to be highly disordered are ranked at the bottom of the list. Alternatively, peptides having a long disordered segment can be predicted using SLIDER (Super-fast predictor of proteins with long intrinsically disordered regions; Peng et al, 2014; Proteins: structure, Function and Bioinformatics 82:145; http://biomine.cs.vcu.edu/servers/SLIDER) using default parameters.
[0168] The resulting 600,000 amino acid sequences in the filtered set were reverse-translated as described to nucleic acid sequences in the sixth step of Example 1, with alterative codons used to avoid undesired codon-combinations as described by the seventh step in Example 1. With an estimated 80,000 naturally occurring proteins represented by such 600,000 peptides, this suggests a mean coverage of about 7.5 nucleic acids (peptides) per naturally occurring protein
[0169] For synthesis of oligonucleotides comprising these 600,000 nucleic acid sequences, the procedure described in Example 2 was followed except that in this case the general structure of the resulting oligonucleotide (with the 5′ and 3′ regions) was: [0170] Forward-amp BamHI_Val_VARIABLE-REGION_XhoI_Reverse-amp,
[0171] where “Val” represents a codon for a single valine amino acid-linker, and the other features are as described in Example 2, such that or an indicative 46 amino acid sequence (SEQ ID NO. 14) of: [0172] PRYLKGWLKD VVQLSLRRPS FRASRQRPII SLNERILEFN KRNITA,
[0173] the resulting oligonucleotide sequence has a complete nucleic acid sequence shown below (SEQ ID NO. 9), where the following features are marked as follows: 138 bp region coding for the above 46 amino acid sequence in bold; forward and reverse amplification sequences in lower case; restriction enzyme sites boxed.
TABLE-US-00011 SEQ ID NO. 9: Nucleic acid sequence of an indicative oligonucleotide
[0174] Note that in this case, the oligonucleotide does not comprise a Kozak/start or a stop codon, which in this example is provided by the expression vector into which the oligonucleotide is cloned, as described next.
[0175] The oligonucleotides were amplified and digested as described in first and second steps of Example 3. In this case, however, the resulting digest products were cloned into a sample of a BamHI/XhoI-digested lentiviral vector comprising a Kozak/start and stop codon (eg pMOST25A). Sixty (60) base pairs of the cloning site of pMOST25A is shown below by SEQ ID NO. 10, and the resulting recombinant construct with a BamHI/XhoI-digested amplification product of the indicative oligonucleotide shown in this Example 5, would have the sequence shown by SEQ ID NO. 11. BamHI and XhoI restriction sites are boxed; the first base of the start/stop codons marked above with a “*”; and the 138 bp region coding for the 46 amino acid sequence in bold.
TABLE-US-00012 SEQ ID NO. 10: 60bp of the cloning site of pMOST25A lentiviral vector.
[0176] Expression of the construct shown in SEQ ID NO. 11 will result in the 52 amino acid peptide having a sequence as shown in SEQ ID NO. 12, where the sequence of the originally encoded 46 amino acid indicative peptide is shown in bold after the initial methionine, the two amino acids encoded by the BamHI site and the linking valine, followed by the two amino acids encoded by the XhoI site. [0177] SEQ ID NO. 12: Indicative expressed peptide. [0178] MGSVPRYLKG WLKDVVQLSL RRPSFRASRQ RPIISLNERI LEFNKRNITA LE
EXAMPLE 6: DESIGN AND CONSTRUCTION OF A NUCLEIC ACID LIBRARY OF THE INVENTION THAT ENCODES SHORT PEPTIDES BASED ON AMINO ACID SEQUENCES OF PROTEINS COMPRISED IN THE PROTEOMES OF EVOLUTIONARILY DIVERSE ORGANISMS (“OMEPEX”)
[0179] Another library of the invention was designed and constructed wherein the amino acid sequences of the source-proteins were those of naturally occurring proteins comprised in the reference proteomes of a yet more evolutionary diverse set of species, including a number of species from each of those being: archaea; bacteria, fungi, invertebrates, plants, protozoa, mammals and non-mammalian vertebrates.
[0180] First, a mega protein amino acid sequence was generated as described in Example 1, but by using all the protein sequences comprised in 467 reference proteomes set out Table B. The second and third steps of Example 1 were conducted by analogy, to generate a pre-filtered set of over 1 million unique 46 amino acid long sequences.
[0181] This set of pre-filtered sequences were subjected to hierarchical clustering using iterative runs of CD-HIT (Fu et al 2012, Bioinformatics 28:3150; http://weizhongli-lab.org/cd-hit/) with more stringent thresholds to obtain maximum diversity in the resulting peptides, described briefly as follows: Three rounds of clustering were performed; a first round used an 80% sequence similarity threshold parameter (“-c 0.8”; example command: cdhit -i peptides.faa -o peptides 0.8. faa -c 0.8 -T 0 -M 32000 -n 5); a second round, using the output of the first round, used a 60% sequence similarity threshold (“-c 0.6”); and a third and final run, using the output of the second round, used a sequence similarity threshold of 50% (“-c 0.5”).
[0182] The isoelectric point (pI) of each resulting peptide sequence remaining was predicted, and any having a predicted pI of between 6 and 8 was also removed from the set, as described in step four of Example 1.
[0183] Analogously to as described in Example 2, the resulting set of amino acid sequences were further filtered to remove those predicted to have intrinsically disordered regions. In this case however, the top 475,000 sequences (ie, those least predicted to comprise intrinsically disordered regions) were selected to form a first set of unique 46 amino acid sequences.
[0184] Separately, a second set of 25,000 unique 46 amino acid sequences were generated using the procedure described above in this Example 6, except that the amino acid sequences of the naturally occurring proteins first concatenated were those proteins having a known three-dimensional structure. In this case, about 10,150 polypeptide chains present in Protein Data Bank (https://www.wwpdb.org, on 5 Feb. 2017) and that had a Pfam annotation (http://pfam.xfam.org, version 30.0).
[0185] The first and second sets of amino acid sequences were combined, and 500,000 oligonucleotides, each encoding a separate of the amino acid sequences, was designed (having the same general structure) and synthesises as described in Example 5. The resulting synthesised oligonucleotides were PCR amplified, BamHI/XhoI digested and cloned into pMOST25A as described in Example 5 to form an expression library of the invention.
EXAMPLE 7 [PROPHETIC]: DESIGN AND CONSTRUCTION OF A NUCLEIC ACID LIBRARY OF THE INVENTION THAT ENCODES SHORT PEPTIDES BASED ON DIFFERENTIALLY EXPRESSED PROTEINS (“DIFFPEX”)
[0186] In this example, a query of a gene-expression database (e.g. the EMBL-EBI Expression Atlas; Geen http://www.ebi.ac.uk/gxa/home/) is conducted to identify a sub-set of genes in the proteome that are differentially expressed between two tissue types. For example, the 5,000 most differentially expressed proteins between a human melanoma cell line (or patient sample) and a comparable but non-cancerous human cell line are identified by such a query.
[0187] The reference amino acid sequences of this set of 5,000 proteins are used to generate a filtered set of over 20,000 unique 46 amino acid sequences and over 20,000 oligonucleotides, each encoding a separate of the amino acid sequences, are designed (having the same general structure), synthesises and cloned into pMOST25A as described in Example 5; except that in this case: (1) the window spacing along each protein's amino acid sequence is less than 10 amino acids so as to increase the density of tiling of the amino acid sequences across the sequence of these naturally occurring proteins; and (2) the SLIDER program (for prediction and filtering out of unstructured regions) is not used.
EXAMPLE 8 [PROPHETIC]: GENERATION OF PEPTIDE LIBRARIES ENCODED BY NUCLEIC ACID LIBRARIES OF THE INVENTION
[0188] A library of peptides of the invention (eg, one encoded by a nucleic acid library of the invention) is generated as follows.
[0189] First, the amplified and BamHI/XhoI-digested oligonucleotides of Example 7 are, instead, cloned into a CIS display construct (Odegrip et al 2003; PNAS 101:2806), having the general design: [0190] Promoter_NUCLEIC_ACID LIBRARY_repA_CIS_ori
[0191] CIS display exploits the ability of a DNA replication initiator protein (RepA) to bind exclusively to the template DNA from which it has been expressed, a property called cis-activity. The peptide library is created by ligation of a nucleic acid of the invention to a DNA fragment that encodes RepA. After in vitro transcription and translation, a pool of protein-DNA complexes is formed where each protein is stably associated with the DNA that encodes it. These complexes are amenable to the affinity selection of ligands to targets of interest.
[0192] CIS display, exploits the high-fidelity cis-activity that is exhibited by a group of bacterial plasmid DNA-replication initiation proteins typified by RepA of the R1 plasmid (Nikoletti et al 1988, J. Bacteriol. 170:1311). In this context, cis-activity refers to the property of the RepA family of proteins to bind exclusively to the template DNA from which they have been expressed. R1 plasmid replication is initiated through the binding of RepA to the plasmid origin of replication (ori). Ori is separated from the RepA-coding sequence by a DNA element termed CIS. This element is thought to be critical in controlling the cis-activity of RepA (Masai & Arai 1988, Nucleic Acids Res. 16:6493). The consensus model for cis-activity is that the CIS element, which contains a rho-dependent transcriptional terminator, causes the host RNA polymerase to stall. This delay allows nascent RepA polypeptide emerging from translating ribosomes to bind transiently to CIS, which in turn directs the protein to bind to the adjacent on site (Praszkier & Pittard 1999, J Bacteriol. 181:2765).
[0193] By genetically fusing peptide libraries to the N-terminus of the RepA protein, we can achieve a direct linkage of peptides to the DNA molecules that encode them; thus, the link between genotype to phenotype that is the common feature of display technologies is established.
[0194] The peptide library is generated by in-vitro transcription and translation using an E. coli lysate system as described by Odegrip et al (2003), and solid phase selection for peptides (and hence the DNA sequence encoding them) that bind to immobilised target can be conducted (e.g., by one or more rounds of selection) also as described by Odegrip et al (2003).
EXAMPLE 9: PHENOTYPIC SCREENING WITH THE LENTIVIRAL-CLONED HUPEX LIBRARY, AND IDENTIFICATION OF SEP-BINDING TARGETS
[0195] Using a phenotypic screen, the inventors were able to identify short-expressed-peptides (SEPs) from the HuPEx library described above that increased the survival of HeLa cells treated with methylnitronitrosoguanidine (MNNG), an inducer of cell death via parthanatos. Parthanatos, is a PARP-1 dependent form of programmed cell death (Yu et al, 2006; PNAS 103: 2653) that plays a role in neuronal cell death and is associated with diseases including Parkinson's disease, stroke, heart attack and diabetes.
[0196] HEK293 cells were transfected with the pooled HuPEx nucleic acid library, cloned into the lentiviral vector as above, which is designed to express a plurality of SEPs. Virus was harvested, titered, and a batch of HeLa cells was infected with the SEP-expressing viruses and selected for 8 days. The library of virus-transduced HeLa cells was then exposed (“DO” time point) to a near-lethal dose (6.7 uM) of MNNG. This dose was established as the maximum dose where co-incubation with the PARP-1 inhibitor olarparib was still able to rescue HeLa cells from parthanatos/cell-death.
[0197] Genomic DNA was extracted from a control aliquot of such HeLa cells without MNNG treatment at DO, and large-scale amplicon DNA sequencing was performed to determine the relative abundance of HuPEx SEP-coding nucleic acids, and again from a second aliquot of such HeLa cells after culture for 8 days (“D8”) in the presence of 6.7 uM MNNG (
[0198] Of a predicted 300,000 different SEP-coding inserts represented in the HuPEx library, almost 288,000 were represented at least one member (as found by amplicon DNA sequencing) at DO; and by showing a significant increase in relative abundance at D8, at least 72 SEPs were identified from the HuPEx library as increasing the survival of HeLa cells in the presence of MNNG (
[0199] Of these SEPs, a number were determined to be fragments of naturally occurring proteins that were associated with detoxification mechanisms. For example, a KEGG-pathway analysis (http://www.kegg.jp/kegg/pathway.html) determined that certain of such SEPs were fragments of naturally occurring proteins involved in “chemical carcinogenesis” and “metabolism of xenobiotics by cytochrome p450).
[0200] Certain of the identified SEPs were used as a “bait” in yeast 2-hybrid screening technology (against a human cDNA library as prey) to identify the protein target(s) that the HuPEX SEP would bind to in HeLa cells.
EXAMPLE 10: PHENOTYPIC SCREENING WITH THE LENTIVIRAL-CLONED BUGPEX AND OMEPEX LIBRARIES
[0201] The BugPEx and the OmePEx libraries were screened in a phenotypic screen of parthanatos, analogously to as described in Example 9, to identify SEPs expressed from each of these libraries that showed increased relative abundance at D8 compared to DO, and hence were able to increase the survival of HeLa cells in the presence of the parthanatos-inducing MNNG.
[0202] Of a predicted 600,000 different SEP-coding inserts represented in the BugPEx library, almost 510,000 were represented at least one member (as found by amplicon DNA sequencing) at DO; and by showing a significant increase in relative abundance at D8, at least 58 SEPs were identified from the BugPEx library as increasing the survival of HeLa cells in the presence of MNNG (
[0203] Of a predicted 500,000 different SEP-coding inserts represented in the OmePEx library, almost 490,000 were represented at least one member (as found by amplicon DNA sequencing) at DO; and by showing a significant increase in their relative abundance at D8, at least 64 SEPs were identified from the OmePEx library as increasing the survival of HeLa cells in the presence of MNNG (
EXAMPLE 11: PHENOTYPIC SCREENING WITH THE LENTIVIRAL-CLONED-PEX LIBRARIES
[0204] Using a phenotypic screen, the inventors were able to identify a short-expressed-peptide (SEP) from the combined HuPEx (HPX), BugPEx (BPX) & OmePEx (OPX) libraries described above that decreased GFP-LC3 in HEK293FT cells engineered to express GFP-LC3/RFP-LC3DG Autophagic Flux Reporter (AFR cells, Kaizuka et al. Molecular Cell 2016).
[0205] HEK293FT cells were transfected with the pooled HuPEx, BugPEx & OmePEx nucleic libraries, cloned into the lentiviral vector as described herein, for example pMOST25a as shown in SEQ ID No. 10, which is designed to express a plurality of SEPs. Virus was harvested, titered, and a batch of HEK293FT-AFR cells was infected with the SEP-expressing viruses and selected for 4 days and SEP expressing cells were then expanded for a further 2 days without selection. The library of virus-transduced HEK293FT-AFR cells were then assessed by flow cytometry, SEP transduced HEK293FT-AFR cells enriched in the low GFP-LC3 gate, compared to unsorted controls, were flow-sorted and peptide sequences were amplified and sent to NGS analysis i.e. amplicon DNA sequencing as described in the previous example.
[0206] SEPs sequences identified as being enriched in low GFP-LC3 gate were cloned into suitable lenti-viral expression and SEP-expressing virus generated in HEK293FT cells. Each SEP-expression virus population was individually assessed by flow cytometry in conditions described above. Each SEP expressing population was assessed in comparison to control-SEP expressing populations or uninfected HEK293FT-AFR cells treated with Torin1, an inducer of Autophagic Flux (