SOUTHERN GREEN STINK BUG PHEROMONE SYNTHESIS ENZYMES AND USES THEREOF
20210388335 · 2021-12-16
Inventors
Cpc classification
C12N9/1205
CHEMISTRY; METALLURGY
C12P5/007
CHEMISTRY; METALLURGY
A01N27/00
HUMAN NECESSITIES
C12N15/8243
CHEMISTRY; METALLURGY
Y02A40/146
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12N9/1085
CHEMISTRY; METALLURGY
International classification
Abstract
Described herein are engineered polynucleotides and vectors capable of encoding one or more engineered southern green stink bug pheromone synthesis enzymes. Also described herein are engineered southern green stink bug pheromone synthesis enzymes. Also described herein are methods of making modified plants capable of expressing one or more southern green stink bug pheromone synthesis enzymes.
Claims
1. An engineered polynucleotide comprising: one or more polynucleotides that each have a sequence that is 69-100% identical to SEQ ID NO: 1.
2. An engineered polynucleotide comprising: one or more polynucleotides that each have a sequence that is 90-100% identical to SEQ ID NO: 2.
3. An engineered polynucleotide that encodes a polypeptide having a sequence that is about 55-100% identical to SEQ ID NO: 4.
4. The engineered polynucleotide of claim 3, wherein the polypeptide has a sequence that is 69-100% identical to SEQ ID NO: 1.
5. An engineered polynucleotide that encodes a polypeptide having a sequence that is about 93-100% identical to SEQ ID NO: 5.
6. The engineered polynucleotide of claim 5, wherein the polypeptide has a sequence that is 69-100% identical to SEQ ID NO: 2.
7. An engineered polynucleotide capable of encoding 2 or more of the following: (a) a polypeptide having a sequence that is about 55-100% identical to SEQ ID NO: 4; (b) a polypeptide having a sequence that is about 93-100% identical to SEQ ID NO: 5; and; (c) a polypeptide having a sequence that is 70-100% identical to any one of SEQ ID NOs: 6-79.
8. An engineered polynucleotide comprising: an engineered polynucleotide of claim 1, an engineered polynucleotide of claim 2, or both; and an engineered polynucleotide that encodes a polypeptide having a sequence that is 70-100% identical to any one of SEQ ID NOs: 6-79.
9. A vector comprising: one or more engineered polynucleotides of any one or more of claims 1-8.
10. The vector of claim 9, wherein the one or more engineered polynucleotides are operably coupled to a regulatory element.
11. A cell comprising: an engineered polynucleotide as in any of claims 1-8; a vector, wherein the vector comprises an engineered polynucleotide as in any of claims 1-8; or both.
12. The cell of claim 11, wherein the cell is a plant cell.
13. The cell of claim 11, wherein the plant cell is from a plant species suitable for use as a trap crop for management of the southern green stink bug.
14. The cell of any of claims 11-13, wherein the cell is capable of producing a southern green stink bug pheromone, a southern green stink bug pheromone intermediate, or both.
15. A cell comprising a vector as in any one of claims 9-10.
16. The cell of claim 15, wherein the cell is a plant cell.
17. The cell of claim 16, wherein the plant cell is from a plant species suitable for use as a trap crop for management of the southern green stink bug.
18. The cell of any of claims 15-17, wherein the cell is capable of producing a southern green stink bug pheromone, a southern green stink bug pheromone intermediate, or both.
19. A genetically modified plant comprising: (a) an engineered polynucleotide as in any one of claims 1-8, (b) a vector as in any of claims 9-10, (c) a cell as in any one of claims 11-18, (d) an enzyme having a sequence that is 55-100% identical to SEQ ID NO: 4, (e) an enzyme having a sequence that is 93-100% identical to SEQ ID NO: 5, (f) an enzyme having a sequence that is 70-100% identical to any one of SEQ ID NOs: 6-79, or (g) any combination thereof.
20. The genetically modified plant of claim 19, wherein the plant is a species suitable for use as a trap crop for management of the southern green stink bug.
21. A method of managing southern green stink bug infestation of a desired crop, the method comprising: planting a genetically modified plant as in any of claims 19-20.
22. The method of claim 21, wherein the genetically modified plant is planted in a location next to or near the desired crop.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0017] Further aspects of the present disclosure will be readily appreciated upon review of the detailed description of its various embodiments, described below, when taken in conjunction with the accompanying drawings.
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
DETAILED DESCRIPTION
[0032] Before the present disclosure is described in greater detail, it is to be understood that this disclosure is not limited to particular embodiments described, and as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting.
[0033] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure, the preferred methods and materials are now described.
[0034] All publications and patents cited in this specification are cited to disclose and describe the methods and/or materials in connection with which the publications are cited. All such publications and patents are herein incorporated by references as if each individual publication or patent were specifically and individually indicated to be incorporated by reference. Such incorporation by reference is expressly limited to the methods and/or materials described in the cited publications and patents and does not extend to any lexicographical definitions from the cited publications and patents. Any lexicographical definition in the publications and patents cited that is not also expressly repeated in the instant application should not be treated as such and should not be read as defining any terms appearing in the accompanying claims. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present disclosure is not entitled to antedate such publication by virtue of prior disclosure. Further, the dates of publication provided could be different from the actual publication dates that may need to be independently confirmed.
[0035] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present disclosure. Any recited method can be carried out in the order of events recited or in any other order that is logically possible.
[0036] Where a range is expressed, a further aspect includes from the one particular value and/or to the other particular value. Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the disclosure. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure. For example, where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure, e.g. the phrase “x to y” includes the range from ‘x’ to ‘y’ as well as the range greater than ‘x’ and less than ‘y’. The range can also be expressed as an upper limit, e.g. ‘about x, y, z, or less' and should be interpreted to include the specific ranges of ‘about x’, ‘about y’, and ‘about z’ as well as the ranges of ‘less than x’, less than y’, and ‘less than z’. Likewise, the phrase ‘about x, y, z, or greater’ should be interpreted to include the specific ranges of ‘about x’, ‘about y’, and ‘about z’ as well as the ranges of ‘greater than x’, greater than y’, and ‘greater than z’. In addition, the phrase “about ‘x’ to ‘y’”, where ‘x’ and ‘y’ are numerical values, includes “about ‘x’ to about ‘y’”.
[0037] It should be noted that ratios, concentrations, amounts, and other numerical data can be expressed herein in a range format. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint. It is also understood that there are a number of values disclosed herein, and that each value is also herein disclosed as “about” that particular value in addition to the value itself. For example, if the value “10” is disclosed, then “about 10” is also disclosed. Ranges can be expressed herein as from “about” one particular value, and/or to “about” another particular value. Similarly, when values are expressed as approximations, by use of the antecedent “about,” it will be understood that the particular value forms a further aspect. For example, if the value “about 10” is disclosed, then “10” is also disclosed.
[0038] It is to be understood that such a range format is used for convenience and brevity, and thus, should be interpreted in a flexible manner to include not only the numerical values explicitly recited as the limits of the range, but also to include all the individual numerical values or sub-ranges encompassed within that range as if each numerical value and sub-range is explicitly recited. To illustrate, a numerical range of “about 0.1% to 5%” should be interpreted to include not only the explicitly recited values of about 0.1% to about 5%, but also include individual values (e.g., about 1%, about 2%, about 3%, and about 4%) and the sub-ranges (e.g., about 0.5% to about 1.1%; about 5% to about 2.4%; about 0.5% to about 3.2%, and about 0.5% to about 4.4%, and other possible sub-ranges) within the indicated range.
[0039] As used in the specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise.
[0040] As used herein, “about,” “approximately,” “substantially,” and the like, when used in connection with a numerical variable, can generally refers to the value of the variable and to all values of the variable that are within the experimental error (e.g., within the 95% confidence interval for the mean) or within +/−10% of the indicated value, whichever is greater. As used herein, the terms “about,” “approximate,” “at or about,” and “substantially” can mean that the amount or value in question can be the exact value or a value that provides equivalent results or effects as recited in the claims or taught herein. That is, it is understood that amounts, sizes, formulations, parameters, and other quantities and characteristics are not and need not be exact, but may be approximate and/or larger or smaller, as desired, reflecting tolerances, conversion factors, rounding off, measurement error and the like, and other factors known to those of skill in the art such that equivalent results or effects are obtained. In some circumstances, the value that provides equivalent results or effects cannot be reasonably determined. In general, an amount, size, formulation, parameter or other quantity or characteristic is “about,” “approximate,” or “at or about” whether or not expressly stated to be such. It is understood that where “about,” “approximate,” or “at or about” is used before a quantitative value, the parameter also includes the specific quantitative value itself, unless specifically stated otherwise.
[0041] Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains. Definitions of common terms and techniques in molecular biology may be found in Molecular Cloning: A Laboratory Manual, 2.sub.nd edition (1989) (Sambrook, Fritsch, and Maniatis); Molecular Cloning: A Laboratory Manual, 4.sub.th edition (2012) (Green and Sambrook); Current Protocols in Molecular Biology (1987) (F. M. Ausubel et al. eds.); the series Methods in Enzymology (Academic Press, Inc.): PCR 2: A Practical Approach (1995) (M. J. MacPherson, B. D. Hames, and G. R. Taylor eds.): Antibodies, A Laboratory Manual (1988) (Harlow and Lane, eds.): Antibodies A Laboraotry Manual, 2.sub.nd edition 2013 (E. A. Greenfield ed.); Animal Cell Culture (1987) (R. I. Freshney, ed.); Benjamin Lewin, Genes IX, published by Jones and Bartlet, 2008 (ISBN 0763752223); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0632021829); Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 9780471185710); Singleton et al., Dictionary of Microbiology and Molecular Biology 2nd ed., J. Wiley & Sons (New York, N.Y. 1994), March, Advanced Organic Chemistry Reactions, Mechanisms and Structure 4th ed., John Wiley & Sons (New York, N.Y. 1992); and Marten H. Hofker and Jan van Deursen, Transgenic Mouse Methods and Protocols, 2.sub.nd edition (2011).
[0042] Embodiments of the present disclosure will employ, unless otherwise indicated, techniques of molecular biology, microbiology, organic chemistry, biochemistry, physiology, cell biology, plant biology, and the like, which are within the skill of the art. Such techniques are explained fully in the literature.
[0043] Before the embodiments of the present disclosure are described in detail, it is to be understood that, unless otherwise indicated, the present disclosure is not limited to particular materials, reagents, reaction materials, manufacturing processes, or the like, as such can vary. It is also to be understood that the terminology used herein is for purposes of describing particular embodiments only, and is not intended to be limiting. It is also possible in the present disclosure that steps can be executed in different sequence where this is logically possible unless the context clearly dictates otherwise.
Definitions
[0044] As used herein, “attached” can refer to covalent or non-covalent interaction between two or more molecules. Non-covalent interactions can include ionic bonds, electrostatic interactions, van der Walls forces, dipole-dipole interactions, dipole-induced-dipole interactions, London dispersion forces, hydrogen bonding, halogen bonding, electromagnetic interactions, π-π interactions, cation-π interactions, anion-π interactions, polar π-interactions, and hydrophobic effects.
[0045] As used herein, “cDNA” refers to a DNA sequence that is complementary to a RNA transcript in a cell. It is a man-made molecule. Typically, cDNA is made in vitro by an enzyme called reverse-transcriptase using RNA transcripts as templates.
[0046] As used herein with reference to the relationship between DNA, cDNA, cRNA, RNA, protein/peptides, and the like “corresponding to” or “encoding” (used interchangeably herein) refers to the underlying biological relationship between these different molecules. As such, one of skill in the art would understand that operatively “corresponding to” can direct them to determine the possible underlying and/or resulting sequences of other molecules given the sequence of any other molecule which has a similar biological relationship with these molecules. For example, from a DNA sequence an RNA sequence can be determined and from an RNA sequence a cDNA sequence can be determined.
[0047] As used herein, “deoxyribonucleic acid (DNA)” and “ribonucleic acid (RNA)” can generally refer to any polyribonucleotide or polydeoxribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA. RNA can be in the form of non-coding RNA such as tRNA (transfer RNA), snRNA (small nuclear RNA), rRNA (ribosomal RNA), anti-sense RNA, RNAi (RNA interference construct), siRNA (short interfering RNA), microRNA (miRNA), or ribozymes, aptamers, guide RNA (gRNA) or coding mRNA (messenger RNA).
[0048] As used herein, “differentially expressed,” refers to the differential production of RNA, including but not limited to mRNA, tRNA, miRNA, siRNA, snRNA, and piRNA transcribed from a gene or regulatory region of a genome or the protein product encoded by a gene as compared to the level of production of RNA or protein by the same gene or regulator region in a normal or a control cell. In another context, “differentially expressed,” also refers to nucleotide sequences or proteins in a cell or tissue which have different temporal and/or spatial expression profiles as compared to a normal or control cell.
[0049] As used herein, “expression” refers to the process by which polynucleotides are transcribed into RNA transcripts. In the context of mRNA and other translated RNA species, “expression” also refers to the process or processes by which the transcribed RNA is subsequently translated into peptides, polypeptides, or proteins. In some instances, “expression” can also be a reflection of the stability of a given RNA. For example, when one measures RNA, depending on the method of detection and/or quantification of the RNA as well as other techniques used in conjunction with RNA detection and/or quantification, it can be that increased/decreased RNA transcript levels are the result of increased/decreased transcription and/or increased/decreased stability and/or degradation of the RNA transcript. One of ordinary skill in the art will appreciate these techniques and the relation “expression” in these various contexts to the underlying biological mechanisms.
[0050] As used herein, “gene” can refer to a hereditary unit corresponding to a sequence of DNA that occupies a specific location on a chromosome and that contains the genetic instruction for a characteristic(s) or trait(s) in an organism. The term gene can refer to translated and/or untranslated regions of a genome. “Gene” can refer to the specific sequence of DNA that is transcribed into an RNA transcript that can be translated into a polypeptide or be a catalytic RNA molecule, including but not limited to, tRNA, siRNA, piRNA, miRNA, long-non-coding RNA and shRNA.
[0051] As used herein, “modulate” broadly denotes a qualitative and/or quantitative alteration, change or variation in that which is being modulated. Where modulation can be assessed quantitatively—for example, where modulation comprises or consists of a change in a quantifiable variable such as a quantifiable property of a cell or where a quantifiable variable provides a suitable surrogate for the modulation—modulation specifically encompasses both increase (e.g., activation) or decrease (e.g., inhibition) in the measured variable. The term encompasses any extent of such modulation, e.g., any extent of such increase or decrease, and may more particularly refer to statistically significant increase or decrease in the measured variable. By means of example, in aspects modulation may encompass an increase in the value of the measured variable by about 10 to 500 percent or more. In aspects, modulation can encompass an increase in the value of at least 10%, 20%, 30%, 40%, 50%, 75%, 100%, 150%, 200%, 250%, 300%, 400% to 500% or more, compared to a reference situation or suitable control without said modulation. In aspects, modulation may encompass a decrease or reduction in the value of the measured variable by about 5 to about 100%. In some aspects, the decrease can be about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% to about 100%, compared to a reference situation or suitable control without said modulation. In aspects, modulation may be specific or selective, hence, one or more desired phenotypic aspects of a cell or cell population may be modulated without substantially altering other (unintended, undesired) phenotypic aspect(s).
[0052] The term “molecular weight”, as used herein, can generally refer to the mass or average mass of a material. If a polymer or oligomer, the molecular weight can refer to the relative average chain length or relative chain mass of the bulk polymer. In practice, the molecular weight of polymers and oligomers can be estimated or characterized in various ways including gel permeation chromatography (GPC) or capillary viscometry. GPC molecular weights are reported as the weight-average molecular weight (Mw) as opposed to the number-average molecular weight (Mn). Capillary viscometry provides estimates of molecular weight as the inherent viscosity determined from a dilute polymer solution using a particular set of concentration, temperature, and solvent conditions.
[0053] The term “nanoparticle” as used herein includes a nanoscale deposit of a homogenous or heterogeneous material. Nanoparticles may be regular or irregular in shape and may be formed from a plurality of co-deposited particles that form a composite nanoscale particle. Nanoparticles may be generally spherical in shape or have a composite shape formed from a plurality of co-deposited generally spherical particles. Exemplary shapes for the nanoparticles include, but are not limited to, spherical, rod, elliptical, cylindrical, disc, and the like. In some embodiments, the nanoparticles have a substantially spherical shape.
[0054] As used herein, “nucleic acid,” “nucleotide sequence,” and “polynucleotide” can be used interchangeably herein and can generally refer to a string of at least two base-sugar-phosphate combinations and refers to, among others, single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. In addition, polynucleotide as used herein can refer to triple-stranded regions comprising RNA or DNA or both RNA and DNA. The strands in such regions can be from the same molecule or from different molecules. The regions may include all of one or more of the molecules, but more typically involve only a region of some of the molecules. One of the molecules of a triple-helical region often is an oligonucleotide. “Polynucleotide” and “nucleic acids” also encompasses such chemically, enzymatically or metabolically modified forms of polynucleotides, as well as the chemical forms of DNA and RNA characteristic of viruses and cells, including simple and complex cells, inter alia. For instance, the term polynucleotide as used herein can include DNAs or RNAs as described herein that contain one or more modified bases. Thus, DNAs or RNAs including unusual bases, such as inosine, or modified bases, such as tritylated bases, to name just two examples, are polynucleotides as the term is used herein. “Polynucleotide”, “nucleotide sequences” and “nucleic acids” also includes PNAs (peptide nucleic acids), phosphorothioates, and other variants of the phosphate backbone of native nucleic acids. Natural nucleic acids have a phosphate backbone, artificial nucleic acids can contain other types of backbones, but contain the same bases. Thus, DNAs or RNAs with backbones modified for stability or for other reasons are “nucleic acids” or “polynucleotides” as that term is intended herein. As used herein, “nucleic acid sequence” and “oligonucleotide” also encompasses a nucleic acid and polynucleotide as defined elsewhere herein.
[0055] As used interchangeably herein, “operatively linked” and “operably linked” in the context of recombinant or engineered polynucleotide molecules (e.g. DNA and RNA) vectors, and the like refers to the regulatory and other sequences useful for expression, stabilization, replication, and the like of the coding and transcribed non-coding sequences of a nucleic acid that are placed in the nucleic acid molecule in the appropriate positions relative to the coding sequence so as to effect expression or other characteristic of the coding sequence or transcribed non-coding sequence. This same term can be applied to the arrangement of coding sequences, non-coding and/or transcription control elements (e.g. promoters, enhancers, and termination elements), and/or selectable markers in an expression vector. “Operatively linked” can also refer to an indirect attachment (i.e. not a direct fusion) of two or more polynucleotide sequences or polypeptides to each other via a linking molecule (also referred to herein as a linker).
[0056] As used herein, “organism”, “host”, and “subject” refers to any living entity comprised of at least one cell. A living organism can be as simple as, for example, a single isolated eukaryotic cell or cultured cell or cell line, or as complex as a mammal, including a human being, and animals (e.g., vertebrates, amphibians, fish, mammals, e.g., cats, dogs, horses, pigs, cows, sheep, rodents, rabbits, squirrels, bears, primates (e.g., chimpanzees, gorillas, and humans).
[0057] As used herein, “overexpressed” or “overexpression” refers to an increased expression level of an RNA and/or protein product encoded by a gene as compared to the level of expression of the RNA or protein product in a normal or control cell. The amount of increased expression as compared to a normal or control cell can be about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.2, 2.4, 2.6, 2.8, 3.0, 3.3, 3.6, 3.9, 4.0, 4.4, 4.8, 5.0, 5.5, 6, 6.5, 7, 7.5, 8.0, 8.5, 9, 9.5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 0, 90, 100 fold or more greater than the normal or control cell.
[0058] As used herein, “polypeptides” or “proteins” refers to amino acid residue sequences. Those sequences are written left to right in the direction from the amino to the carboxy terminus. In accordance with standard nomenclature, amino acid residue sequences are denominated by either a three letter or a single letter code as indicated as follows: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic Acid (Asp, D), Cysteine (Cys, C), Glutamine (Gln, Q), Glutamic Acid (Glu, E), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V). “Protein” and “Polypeptide” can refer to a molecule composed of one or more chains of amino acids in a specific order. The term protein is used interchangeable with “polypeptide.” The order is determined by the base sequence of nucleotides in the gene coding for the protein. Proteins can be required for the structure, function, and regulation of the body's cells, tissues, and organs.
[0059] As used herein, “promoter” includes all sequences capable of driving transcription of a coding or a non-coding sequence. In particular, the term “promoter” as used herein refers to a DNA sequence generally described as the 5′ regulator region of a gene, located proximal to the start codon. The transcription of an adjacent coding sequence(s) is initiated at the promoter region. The term “promoter” also includes fragments of a promoter that are functional in initiating transcription of the gene.
[0060] As used herein, the term “recombinant” or “engineered” can generally refer to a non-naturally occurring nucleic acid, nucleic acid construct, or polypeptide. Such non-naturally occurring nucleic acids may include natural nucleic acids that have been modified, for example that have deletions, substitutions, inversions, insertions, etc., and/or combinations of nucleic acid sequences of different origin that are joined using molecular biology technologies (e.g., a nucleic acid sequences encoding a fusion protein (e.g., a protein or polypeptide formed from the combination of two different proteins or protein fragments), the combination of a nucleic acid encoding a polypeptide to a promoter sequence, where the coding sequence and promoter sequence are from different sources or otherwise do not typically occur together naturally (e.g., a nucleic acid and a constitutive promoter), etc. Recombinant or engineered can also refer to the polypeptide encoded by the recombinant nucleic acid. Non-naturally occurring nucleic acids or polypeptides include nucleic acids and polypeptides modified by man.
[0061] As used herein, “substantially pure” can mean an object species is the predominant species present (i.e., on a molar basis it is more abundant than any other individual species in the composition), and preferably a substantially purified fraction is a composition wherein the object species comprises about 50 percent of all species present. Generally, a substantially pure composition will comprise more than about 80 percent of all species present in the composition, more preferably more than about 85%, 90%, 95%, and 99%. Most preferably, the object species is purified to essential homogeneity (contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single species.
[0062] As used herein, the terms “weight percent,” “wt %,” and “wt. %,” which can be used interchangeably, indicate the percent by weight of a given component based on the total weight of a composition of which it is a component, unless otherwise specified. That is, unless otherwise specified, all wt % values are based on the total weight of the composition. It should be understood that the sum of wt % values for all components in a disclosed composition or formulation are equal to 100. Alternatively, if the wt % value is based on the total weight of a subset of components in a composition, it should be understood that the sum of wt % values the specified components in the disclosed composition or formulation are equal to 100.
DISCUSSION
[0063] The southern green stink bug poses a threat to many agriculturally important corps grown throughout the tropical and subtropical regions of the world. Stink bugs are in the family Pentatomidae and adults can be recognized by their shield-shape, five-segmented antennae, and their malodorus scent. The southern green stink bug, Nezara viridula (not to be confused with the green stink bug, Chinavia halaris) is a highly polyphagous feeder and attacks many important food crops. Generally, the southern green stink bug can be found in the tropical and subtropical regions of Europe, Asia, Africa, and the Americas. In South America, it has expanded its range to Paraguay, south Argentina, and into Brazil, tracking the expanding soybean and other agriculture production in these regions. In North America, the Southern Green stink bug can be found in the southeastern United States, from Virginia to Florida in the east, Ohio and Arkansas in the Midwest, and to Texas in the Southwest. It has also established in Hawaii and California.
[0064] The southern green stink bug is most prevalent during the periods of October through December and again in March through April. The southern green stink bug has piercing-sucking mouthparts that help it feed on all plant parts. However, the southern green stink bug appears to prefer growing shoots and developing fruits. Attacked shoots usually wither, or in extreme cases, may die. The damage on fruit from the punctures is hard brownish or black spots, which affect the fruit's edible qualities and market value. Growth of attacked young fruit may be slowed and/or the young fruit may wither and be dropped from the plant. In addition to the physical damage caused directly by the southern green stink bug to the plant, the southern green stink bug can also facilitate the transmission of various diseases between plants, such as tomato bacterial spot.
[0065] The southern green stink bug poses a threat to many agriculturally important corps grown throughout the tropical and subtropical regions of the world. Current methods to control southern green stink bug populations include biological control (e.g. wasps and flies that transmit parasites to the southern green stink bug) and chemical control. The southern green stink bug is also developing resistance to insecticides used to control them. Given the need to find alternatives to chemical control of pests in agriculture, there exists a need for alternative methods for control of pests, such as the southern green stink bug, in agriculture.
[0066] Trap crops are crops that are planted to attract insect pests from another crop, especially one in which the pest fail to survive or reproduce or can be sacrificed to destroy the pests and/or offspring to reduce the population. Trap crops can be planted in an area, usually a small area, adjacent to the cash crops. Trap crops must be intercepted by the stink bug prior to their movement to the cash crop. Currently, the use of trap crops is not widely used or accepted for control of the southern green stink bug, which may be due to a variety of reasons such as a strong “edge effect” behavior when moving through landscape, a dislike of crossing open areas where they are more exposed to natural enemies, and a preference for type of plant and plant part that varies with life stage. Further, trap crops are not effective if planted interspersed as it will draw the southern green stink bug to the center of the field where they would not naturally bother. In short, correctly placing the trap crop for optimal stink bug control is challenging. As such there exists a need to improve trap crops, particularly for control of the southern green stink bug.
[0067] Insects communicate with pheromones of diverse chemical structure and composition (Müller and Buchbauer. 2011. Flavour Frag J 26:357-377; Stokl and Steiger. 2017. Curr Opp Insct Sci 24:36-42). Many insect pheromones are derived from fatty acids while others arise from terpene (isoprenoid), amino acid, or alkaloid precursors (Blomquist and Vogt. 2003. PNAS 113:2922-2927; Jurenka. 2004. Insect pheromone biosynthesis. In: Schulz (ed.) Chemistry of pheromones and other Semiochemicals I, Vol. 239. Topics in current Chemistry. pp 97-131; Tillman et al. 1999; Yew and Chung. 2015. Prog Lipid Res. 59:88-105). Several studies over the past decades have investigated whether the biosynthesis of insect pheromones depends on the sequestration and conversion of dietary host plant precursors or may occur de novo (Blomquist and Vogt. 2003. PNAS 113:2922-2927; Tillman et al. 1999. Insect Biochem Mol Biol. 29:481-514). Terpenes are released by insects for attraction, aggregation, dispersal, or as trail pheromones (Bartelt et al. 2001. J. Chem Ecol. 27:2397-2423; Brown et al. 2006. J. Cehm Ecol. 32:2489-2499; Dewhirst et al. 2010. Aphid pheromones. In: Litwack G. (ed) Vitamins and hormones: pheromones, vol 83. Academic Press, pp 551-574; Sillam-Dusses et al. 2009. J. Insct Physiol 55:751-757). All terpene specialized metabolites are derived from the 5-carbon diphosphate building block isopentenyl diphosphate (IPP) and its allylic isomer dimethylallyl diphosphate (DMAPP) (Tholl. 2015. Adv. Biochem Eng-Biotechnol. 148:63-106). Conjugation of DMAPP with one or several units of IPP by enzymes called isoprenyl diphosphate synthases (IDSs) results in the formation of cis- or trans-isoprenyl diphosphate intermediates such as medium size 10-carbon geranyl diphosphate (GPP) or 15-carbon (E,E)-farnesyl diphosphate (FPP). In plants and microbes these di-phosphates are converted by terpene synthases (TPSs) to monoterpenes (C10) or sesquiterpenes (C15), respectively, in a carbocation-dependent reaction (Chen et al. 2011. Plant J. 66:212-229; Christianson. 2017. Chem Rev. 117-11570-11648; Degenhardt et al. 2009. Phytochemistry. 70:1621-1637; Dickschat. 2016. Nat Prod Rep. 33:87-110). Insects synthesize isoprenyl diphosphates such as (E,E)-FPP as a precursor of juvenile hormones (Noriega. 2014. Juvenile hormone biosynthesis in insects: what is new, what do we know, and what questions remain? ISRN Zoology 967361). Consequently, FPP synthases or bi-functional GPP/FPP synthases have been identified from a larger number of insects (e.g. Cusson et al. 2006. Proteins. 65:742-758; Ma et al. 2010. Insect Biochem. Mol. Biol. 40:552-561; Sen et al. 2007. Insect Biochem Mol. Biol. 37:819-828; Taban et al. 2009. Arch Insect Biochem Physiol. 71:88-104; Vandermoten et al. 2008. FEBS Lett. 582:1928-1934). Moreover, GPP and FPP synthases have been implicated with providing the pre-cursors of defensive monoterpenoids in leaf beetles and alarm pheromones in aphids (Frick et al. 2013. PNAS. 110:56-61; Lewis et al. 2008. Insect Mol Biol. 17:437-443). However, in most cases insects have been assumed to lack the ability to convert prenyl diphosphate intermediates to terpenes by activity of TPS enzymes because of the absence of plant or microbial type TPS genes in insect genomes.
[0068] Only a single study of the bark beetle Ips pini (Coleoptera: Curculionidae) by Gilg and co-workers (Gilg et al. 2009. Naturwissenschaften 96:731-735) suggested that the monoterpene myrcene, a precursor of the aggregation pheromone ipsdienol, is synthesized de novo from IPP and DMAPP in a reaction catalyzed by a bi-functional IDS/TPS enzyme. This enzyme first produces GPP as an enzymatic intermediate and subsequently converts it to the monoterpene product (Gilg et al. 2005. PNAS 102:9769-9765 and Gilg et al. 2009. Naturwissenschaften 96:731-735). Recently, a similar biosynthetic route has been detected for the formation of sesquiterpene aggregation pheromones in the striped flea beetle Phyllotreta striolata (Coleoptera: Chrysomelidae) (Beran et al. 2016. PNAS. 113:2922-2927) supporting the notion of a TPS-mediated biosynthesis of terpene pheromones in beetles. A family of nine P. striolata IDS-type genes was found, of which four encode functionally active recombinant sesqui-TPSs. Of those, PsTPS1 produces a blend of sesquiterpene olefins similar to that released by male P. striolata with (6R,7S)-himachala-9,11-diene as a main compound (Beran et al. 2016. PNAS. 113:2922-2927 and Beran et al. 2016. J Chem Ecol. 42:748-755). Interestingly, PsTPS1 requires a (Z,E)-FPP isomer as substrate, which is made from GPP and IPP by an enzyme with cis-IDS activity.
[0069] Whether the ability of IDS proteins to function as TPS enzymes has emerged throughout insect evolution is largely unknown despite the common occurrence of terpenes as pheromones or defensive compounds in different insect lineages. Among the true bugs (Hemiptera), stink bugs (Pentatomidae) release sesquiterpene sex or aggregation pheromones with a bisabolane chemical backbone (Weber et al. 2018. CRC Press, Boca Raton, pp 677-725). For example, the harlequin bug M. histrionica, a crucifer specialist, releases a mixture of (3S,6S,7R,10S) and (3S,6S,7R,10R) stereo-isomers of 10,11-epoxy-1-bisabolen-3-ol as a male-specific aggregation pheromone named murgantiol (Khrimian et al. 2014. J Chem Ecol 40:1260-1268; Weber et al. 2014. J Chem Ecol. 40:1251-1259; Zahn et al. 2008. J Chem Ecol 34:238-251). An IDS-type TPS, which produces (1S,6S,7R)-1,10-bisaboladien-1-ol (sesquipiperitol) from (E,E)-FPP as the presumed natural precursor of murgantiol in harlequin bugs has been described (Lancaster et al. 2018. PNAS 1150: 115: E8534-E8641).
[0070] The Southern green stink bug Nezara viridula is a generalist crop pest worldwide that attacks over 30 plant families (Capinera. 2001. Handbook of vegetable pests. Academic Press. San Diego) and can cause heavy crop damage on cotton, soybean, tomato, and other vegetable crops (Esquivel et al. 2018. In: McPherson (ed) Invasive stink bugs and related species (Pentatomoidea): biology, higher systematics, Semiochemistry, and management. CRC Press, Boca Raton. pp 351-423; Greene et al. 1999. J Econ Entomol 92:941-944). The sex pheromone of N. viridula was first identified in 1987 as a mixture of trans-/cis-(Z)-α-bisabolene epoxides (Aldrich et al. 1987. J Exp. Zool. 244:171-175 and Harris and Todd. 1980. Entomol Exp Appl. 27:117-126), which is released from unicellular glands at the ventral abdomen of mature males (Cribb et al. 2006. J Morphol 267: 831-840). Several ecotypes producing different ratios of the two pheromone isomers have been described (Aldrich et al. 1987. J Exp. Zool. 244:171-175; Baker et al. 1987. J Chem Soc Chem Commun: 414-416; Brezot et al. 1993. J Chem Ecol. 20:3133-3147). Since N. viridula feeds on a variety of different host plants, several of which are not known to accumulate bisabolenes, it was hypothesized that it produces its pheromone de novo, similar to M. histrionica (the harlequin stink bug). However, there is no significant homology with the IDS-type TPS identified in harlequin bugs to known enzymes in the known pheromone pathway of the southern green stink bug.
[0071] With that said, described herein are engineered Southern green stink bug pheromone synthesis enzymes and systems thereof that can be capable of producing (E,E)-FPP and converting (E,E)-FPP to (Z)-alpha-bisabolene, which can serve as a precursor of trans-/cis-(Z)-alpha-bisabolene epoxide. Also described herein are engineered polynucleotides and vectors capable of expressing one or more of the engineered Southern green stink bug pheromones described herein. Also described herein are genetically modified cells and/or plants that can express one or more of these engineered Southern green stink bug pheromone synthesis enzymes, polynucleotides, enzymes, and/or vectors. Other compositions, compounds, methods, features, and advantages of the present disclosure will be or become apparent to one having ordinary skill in the art upon examination of the following drawings, detailed description, and examples. It is intended that all such additional compositions, compounds, methods, features, and advantages be included within this description, and be within the scope of the present disclosure.
[0072] Engineered N. viridula Terpene Pheromone Synthesis Polynucleotides, Vectors, Enzymes, and Systems Thereof
[0073] All pentatomid pheromones are produced by the male stink bug and are either sex or aggregation pheromones. Many are terpenes with a biasobolene-based chemical backbone. Since the pheromone of N. viridula was first identified as a mixture of trans/-cis-(Z)-alpha-bisabolene epoxide, several ecotypes producing different ratios of these two components have been identified. The production of the N. viridula terpene pheromones relies on a linear reaction scheme involving multiple enzymes which produce various intermediates (see e.g.
[0074] Isoprenyl diphosphate synthases (IDS) are enzymes that combine two or more C5 isoprenyl diphosphate subunits in a head-to-tail condensation reaction to form the diphosphate precursors used by terpene synthase (TPS) to form over 55,000 terpenes known to date. With respect to terpene pheromones, a common question in this area is whether the insect (e.g. southern green stink bug) derives the precursors to the pheromones from the host plants on which they feed or if they are made by the insect de novo. As is discussed and demonstrated elsewhere herein, the Southern green stink bug produces them de novo. Also described and demonstrated herein are various aspects of engineered N. viridula enzymes and polypeptides that can be involved and capable of producing terpene pheromones of N. viridula. In some aspects, at least one of the enzymes is an IDS-like TPS N. viridula protein that can be capable of synthesizing the precursor (Z)-alpha-bisabolene (see e.g.
[0075] Enzymes and Systems Thereof
[0076] As shown in e.g.
[0077] The enzymes can be used alone to catalyze a step in the process of southern green stink bug pheromone productions. Where an intermediate is produced, the intermediate can then be supplied to a new reaction with an enzyme present in the following step of the process. In some aspects, one or more of the NvFPPS, NvTPS, and P450 enzymes can be included in a reaction to produce the southern green stink bug pheromones or an intermediate in the synthesis scheme. Where two or more enzymes of different types (e.g. NvFPPS., NvTPS and/or, P450) are included, an enzyme system is created. An enzyme system can include (a) one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 etc.) different NvFPPS enzymes, with enzymes having different polypeptide sequences being considered different enzymes in this context; (b) one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 etc.) different NvTPS enzymes, with enzymes having different polypeptide sequences being considered different enzymes in this context; and/or (c) one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 etc.) different P450 enzymes, with enzymes having different polypeptide sequences being considered different enzymes in this context.
[0078] One or more of the enzyme(s) described herein can be contained in, expressed in, and/or otherwise produced by a cell. In some aspects, one or more enzymes can be produced by a cell and subsequently harvested by a suitable technique. Suitable cell-based protein production techniques are generally known in the art. Various vectors to facilitate cell-based expression are discussed in greater detail elsewhere herein. The enzymes described herein can also be made in a cell-free system. See e.g. Lee and Kim. 2018. FEMS Microbiol. Lett. 1:365(17). As described in greater detail elsewhere herein, the enzymes can be used to produce southern green stink bug pheromones, in vivo, ex vivo, and in vitro.
TABLE-US-00001 >NezVir_CYP4G227/1-562 SEQ ID NO: 6 MSISAATPVISVPSAVLSATSVFYFLLVPALVLWYVYWRMSRRHMIELASKIPGPPGLPILGN ALQFTGSSHDIFERVYSYSFEYKDVTRVWIGPRLVIFLVDPRDVELILSSHVYIDKSREYRFF RPWLGNGLLISSGPKWRAHRKLIAPTFHLNVLKSFIDLFNANSRHVIKKLEKELGKEFDCHD YMSEATVEILLETAMGVSKKTQDQSGYDYAMAVMKMCDILHLRHTKFWLRPDSIFNLTKYG KIQENLLATIHGLTRKVIKRKKADFAKGIRGSTAEVPKELQTKNYESKVEQKATVEGLSYGQS AGLKDDLDVDDNDIGEKKRMAFLDLMIEASQNGVVINDEEIKEQVDTIMFEGHDTTAAGSSF FLCMMGVHQHIQDRVIQELDEIFGDSDRPATFADTLEMKYLERCLMETLRLYPPVPIIAREM KEDLKLASGDYTIPAGATVVIGTFKLHRKPEIYPNPNKFDPDNFLPERTANRHYYAFVPFSA GPRSCVGRKYAMLKLKILLSTILRNYRVYSDVKEEDFKLQADIILKRSDGFRIRLEPRKRAAK A >NezVir_CYP4G228/1-554 SEQ ID NO: 7 FGSSVNNKKMIAVFTFLIVTAATLYYIKWRSERKRLYELAEKIPGPELLPLASKAFSILKNHNT LLKYIYDLSFIPEYQNVAKLWLGSRLVVGLVHPKDVEIILSSNVHLKKSQEYKLFEPWFGNGL LISSGETWRHQRKMIAPTFHLNILKRFMDEFNRNSQRVIERMRKENGKMFDCHDYMSEIMV ETLIETVMGVKQESQNRECFSYAHSVMDLCDILHTRHTRPWYRPEYLFKLTNMSKEWDRN LQNIFNLTNRVFNTKKEDCIKNKSKESTMTKEDVKEETKVETKIETHSDEKFSYGQAAGLKD DLDDDNEIGEKKRLPFLESLIDRSQNGDKLTDQDIIDQVNTIMFEGHDTTAAGSSFFLCVMG DRQDIQAKCIEEIDSIFGDSDRPVTFQDTIEMKYLERCIMETLRLFPPVPLIARELEQDVQLMS ENILLPKGCAVVIGTFKLHRRADIYVDPDNFDPDRFLPENAVNRHYYSFVPFSAGPRSCVGR KYAMLKLKILLANILRNFRVKQGKPMKDWQLQADIILKRSDKFEITLEPRRVQKVC-------- >NezVir_CYP4G229/1-550 SEQ ID NO: 8 MDSQELDHSELRSRLYSISSLILPIFILLYVGWRLANKRFIELAEKIPGPPGLPIIGNALELRGT PNEIFENLYSKSEIYPDVARVWAGPRLLVFLTNPADIEIVLSSHDHLDKSAEYDFLRPWLGN GLLVSTGEKWRSHRKIIAPTFHLNVLRSFMERFNRNSKKTLERLAKEGDNEFDIHDYMSEFT VEVLIETVMGVKKENEGRSCFDYAQAVMKLCDIVHLRHTKFYLRPDLVFYSSKYGSEQKSL LSVIHGLTEKVLKVKKAQFENKIQDKHQETAEKEVLKETSESKEGFSYGQASGLKDDLDVED IGEKKRNAFLESILERAANNDSINDKEVKEQLDTIMFEGHDTTAAASSFFLCMMAAHPDIQQ KCYEEIMRVLGDSDRDITFNDILEMKYLERCLMETLRLYPPVPIIARQPKKEFKLASKNLIIPA NCTVVIGIIKLHRRADIYPNPEKFDPDNFLPEKSASRHYYSFIPFSAGPRSCVGRKYAMLKLK TILASTLRAFYVKPGYTEEEWKLKADIILKRADGFRIKLEPRKETNTKN------------ >NezVir_CYP4G230/1-532 SEQ ID NO: 9 MDLLTFFGAVLTAAIAGYGAFWYSRRRLYELAAKIPGPTSLPLLGTLSEFSGGAHMVFENMV KKCHEYGDVIKFWIGPRLLVFLADPADIELILSSHVHIDKAPEYQFFQPWLGDGLLISTGNKW RNHRKLIAPTFHLNILKSFIPLFNSNSRGVATKLKKEVGKEFDCHDYMSEATVEILLETAMGV NKKTQESGYEYAMAVMKMCDILHLRQTKLWLRPNIIFYLTSLGKLQDKLLNIIHSLTKKVLKIR MEEYKNNGSKLPGNVTFVTGDDGKIQVEGDFSFGHSKGIKDDLDEDIGEKKRLAFLDLLIDA SQGGKLTDEEIQNQVDTIMFEGHDTTAAASSFFLCEMAARPDIQEKCIEELNKIFGDSDRPV TFEDTLEMKYIERCLMETLRMYPPVPVIARELQHELKLASRDLVIPAKCTVIVATFKLHRKENI YPNPNVFDPDNFLPERSASRHYYSYVPFSAGPRSCVGRKYAMLKLKVLIATILRKYKVLPGK KEADWKLQGDIILKRTDGFGIRVEPRTSSV------------------------------ >NezVir_CYP4G231/1-551 SEQ ID NO: 10 STIKSSLDRRQEQHSEGGMDILGIDSILVAGLTAAIAAYGYFWFSRRRLYELASKIPGPAGYP FIGNALRFIGGADTLFKNVFSRTLEYGDWKMWVGPRLLVFLTNPADIELILSSHVHIDKAPE YRLFEPWLGDGLLISTGEKWRNHRKLIAPTFHLNVLKSFIPTFNSNSVDVVKKLKQDVGREF DAHDYMSEATVEILLETAMGVNKKTQKNGYEYAMAVMGLSNILHLRHTKLWLRPDFIFNMT SLSKLQEKLLNVIHSLTRKVFNIRMDEYKKNGSKIISTTPEDNAKVQAEGDYAFGHSKGIKDD LDDEIGEKKRMAFLDLLIDASQGGGKLTSEEIQHQIDTIMFEGHDTTAAGSSFFLAMMAARP DIQEKCVEEVKRIFGDSNRPVTFQDTLEMKYIERCLMETLRMYPPVPIIARELKQELKLASCD LTIPAHCTVVVNTFMLHRKPDIYSSPNYFDPDNFLPEKSASRHYYSYIPFSAGPRSCVGRKY AVLKLKVMLATILRNYRILPGKKEKDWKLQGDIILKRADGFPLVMEPRAIKV----------- >NezVir_CYP4EK4/1-537 SEQ ID NO: 11 MAEVTSFDVFSSSYLPQSKRVYKSPCRNLLPVNSEMVRLFKLQKVLSSAISALSDVISCLYS WTRFYWMVSRLPGLPLTHSYKQWEGFQSKYNALNTLVKWREKYKTFHKVYISFLPVIFAYS PELIQELLSKKQKHNDKGKVYHTLLPLLGDGLITSKGEKWFAHRRMLTPAFHSNILESFFETF KSETNTYINSLKDSELTKGYGDICPHTRRLTLKFICETAMGFSELADCKEAEAVIKSMHKLEEI ATLRVIHPWLLSDSIFKMSALYKELNENKKILHNFSNTLIKRRKSILKKRLRNPYLEVHKRKEIF LDQLILQQLQGIKITDEDIRDQVNTFMFAGHNTTQLAINYCIYLFGRYKDVQETAHNELEEIFN DSNREPTLDDLRNMEYLDRCIKEALRLYPSVPIIARKLTEDQPIGKHILPKDTDCFIIPYVTHR NPEQFPNPEVFDPDNFLPERINNRHPYSYIPFSAGPRNCIGKRFANIAEKTVLSWILREFKIE SKLKQEDLKLIPSTVLIPSGGLQVKLTPRKC------------------------- >NezVir_CYP4GW2/1-528 SEQ ID NO: 12 MMDKPSVMEELLAECIIYWLFILGIIVSSVVALHYYLSKRRYYQLARKIPAPPGLPIIGHAFNIL MGTEEAFRNVWNTMSDCDVCKLWLGTRLFVFIKNPADIELVLNSRIHLCKPSESNLLKTCLG DGINTVSGCQWKSYRQLIAPMFQWSQTFQPILRNYSRILDDRLLKNVGKDIDCYNYMSDAV MELLLISIFGENTDTEESKKYFEAIQKLKEIIRYRQNKFWLHPDLIFNLTKYSKLQKDLLRIINRF TRQAIKNRKRALMEQGYGWPKNGYFEDQNGNIEHNNNITTCLKEGDRSPSLLELMMEVSH NGTTLMDSEIQNQVDALVLEGLDTTALTGSFFLGVMADRPDIQERCAIELSQIFGDSDRQVT FEDTLQMKYLERCLMETLRIHPPVPFITRELQQELRLASTCLTIPANSTLMVDVKKLHMNEEL YSSPDVFDPDNFLLEKCVSRHYYSFIPFSAGPRSCVGTKYSMLSLKVLLSSILRKYKIFPSSG QESASMMTKDTRRTERFVIKMEHRKR--------------------------------- >NezVir_CYP4GX1/1-546 SEQ ID NO: 13 MFRMTDWTSDLQTVAFFAAVVPLLYYVYWRIANRRLLQLAAKIPGPPGLPLLGNLLEFTGSP TEIFEKLVEKSYQYEDVIKVWFGPRLFVFLTNPVDIEVLLTSTEHIEKSVEYDFMKPWLGDGL LISSGQKWFTHRKVIAQTFHLNILRSFLGKFNENAKKLVKYFEDETGNEFDCRRYMCKYTAE TLIDTVMGADKDQLGFESPVYSGATTKLCELVHLRHTKLHFRSDLLFNSTKHGFEHKKFVSL VHDFSAKVIKFKKSQRELLKPSPFIEKFDDIRKEDKSLTHYEKSTGISYGQSSGLKDDLDNEV IGRKKKCAFLDTLLEKEANREVFSMKDVQDQIDTLMFEGHDTTAGVSSMFLCLMATNLDVQ AKCVEELEKIFGDSDRDVTFEDTYEMKYLERCVMETLRIYSPVPVIARNLKKELTLVTNNITL PVSTTVIVAIFKLHRREDLYPNSEKFNPDNFIQEKTAARSFYSFIPFSAGPRSCVGRKYAILKL KVVLSTILRNYQITTSCPMESWKLQADITLKRTDGFKIKLIPRKNA >NezVir_CYP4GY1/1-494 SEQ ID NO: 14 AAIAIVLILLSIIITLLISRVIRDLFKLKGIPGPWELPFLAELRMILLPFTVLYPVLQKYIEDYGGVC AIYRTGRVYVMLSEPETVEPVLSSYNHIKKGDYDYAFLRPWLRDGLLLSDGSKWRNRRKLL TPAFHFKILEDGMKCLTEKSEEITEKLLATKGEPTDLEDIIRSSTLGAILETAMGVPSSDANGY QQHQQEYQSKIKGITESIMRRYYRLWKHIESLYRLSSEGKEFFNDVNRLQLFTKKVIKDRKQ LYLIERDSKPGDKKSKIKPFLDCLIELNVSTPGAISEDGIAEEVDTFMFEGHDTTASALNSALF LLANNPIEQEKAAEEQMEIFGDDNRVPSTHDLNKMEYLDMVIKEVLRLYPSVPIITRSLTEDL KINESITVPAGCIAAIMPYFVHRSAKHWDNPEEFRPERFDTGISRHPFSFIPFSAGPRNCIGQ KFAMMEMKTMLSAILRKCKLEPVTTSFEIIPTWLKSDQPILIKVLPRK >NezVir_CYP4GY2/1-483 SEQ ID NO: 15 MFEALYAVVVVFLVGLILKKWWDQKIPGPRGLPIMGIALELAQIPPRDIFAKIDSLRQTYSGIF EMKIMTDSYVMLTDPESVEPLLSSSKHIKKGIFDYKFWRLFLGDGLLLSDGAKWHHRRKVLT PTFHFKILEDAMTSLVKNAQSLTEQFLDTEGKPTDVGNIIRSSTLKVICETAMGVKLNTDDET QNKYVEAVKRIPEAIILRYLKFWLHSDFVYNLTKDGRNFKKDLNLAHSFTKKIISERRMLYKN QKADNSENKSKKKAFLDCLLEMGEALTDQDICEEVDTFMFEGHDTTSANLVFSLFLLANHP EEQEKVVEELIEIFGETDRPPTLSDLAKMNYLEMVIKESLRLYPSVPLISRSLTEDLKLGADVII PAGYTAVVAPFLVHRSKTHWENPEEFRPERFMPGTPRHPFAFIPFSAGPRNCIGQKFAMM ELKTMLSSVLRKCKLEAVTKEVNILPTGIIKSEETILMKIYKRNL >NezVir_CYP4GZ9/1-458 SEQ ID NO: 16 MWMMVAVILCLICVLLVLFVGYLAIYWKPSRLPGPRGLPYFGIAFSMIGITSKDIIHHLMKWFE EYGDIFEFQILGQKYVFVTDPQLLQPILSSNTNITKGRFEYSFFRPMFNDGLIISDGDKWRTR RKLLTPSFHFKILETSIESVGRNTEEFVSHLLKSNGKATEIEDHIYLLTFKIICETAMGVKLNTV DNQQNEYIKASKICHDSTVYRYLRIWLFPDFIYRLCKVGKTFFKCLDVIHNFADQVIKSRKEL FIAEKNDFTNKDSKRKAKNTFLDNLLELDDSNPGLFTKSDIREEVDTFMIAGHNPTAAALKFL HFLLANHPDVQEKVHDEQVEIYGDDKRTPTAQDLHKMIYLEMVIKETLRLYPSIPLYSRLLDK DLQIDEKTIIPAGCNVAVFNYCVHRSKKHWDNPEEFVPERFVPGIERHPYSFIPFSAGPRNCI GQKYAMMELKTIMP >NezVir_CYP4GZ10/1-502 SEQ ID NO: 17 MIVIWGLSCVLMVVFVRFLVKNWKPSMLPGPRGFPYFGAAFSVVGISSKDIIPLIIKWCDEYG KMFGVKMLGANYVFVSEPELVKPLLTSSINITKGRFEYSFLKLIFNDGLIVSDGEKWRSNRRL LTPSFHNKILKSSVETVGRNAEEFVSQLLASDGKPIDIEDTTHLLTLKIICETAMGVKLNTKDK QQNEYVKASRICHDTLVYRYLRFWLFPDFIFRRSDVGKRFIKSLKLIHEVADQVIKKRKELYIA EKNESKNEDSRKKERNAFLDNLLELVDSNPDLFNESNIREEVDTFLIAGHNPSAATLKFLHFI LANRPDVQEKLYDEQVDIFGDSKRMTTAQDLEKMTYLKMVINETLRLYPTIPLYSRCLKEDL LIDEKTIIPAGHTVAVFTYAVHRSKKHWDNPEEFIPERFAPGIEIHPFSFLPFSAGPRNCIGQK YAMMELKIIISTLVRQCWLEPVTTSVSLDYGITLNPVEPIIVKAIPRNGTRRMIPERNS >NezVir_CYP4GZ11/1-501 SEQ ID NO: 18 MMSITLGLICVLLLVLASFYRKPSTLPGPRGLPYFGNVWLYMIGRSSKDIIPFLKYFVNYYGNI FELQIFGMNYVFGSEAELVKPILTSHTNITKGRFEWSFFKPMFRDGVIISEGEKWRTRRKILE PSFHFKILKRSIESVARYAEEYVSNLLNSEGKPTEIEDMIYLLTLKIICETAMGVKLNTEDRQQ NEYVKASKLCHDGAVYRFFKLWLYPDFIYRRSNAGKTFFRSVDIIHDFATQVIRNRKELFIAE KTGSNNQDSTKKEKNAFLDNLLELDDSNPGLFTESDIEEEVSTFMIAGHNPSAATLKFLHFV LANRPDVQEKLYDEQMEIFGNDKRIPTGQDLQKMIYLEMVIKETLRLYPIVPFQSRLLEEDLQ IDENTIIPAGHHFVVVSFSIHRSKKHWDNPEEFIPERFAPGNIINPFSFIPFSAGPRSCIGQKY AMMEMKTIMSTVVRQCWLEPVTTSITLDYGIILKSAEPIIVKAFPRNENQRINYKRNN >NezVir_CYP4GZ12/1-490 SEQ ID NO: 19 MMLMCLLAALCGFLTLRLWRRRPRGPPGPPAIPYFGQAFRLLSIAERDILPLFKEWFDTYGS VVQVEMLGNVYVLLSEPESLEPVLSSSVHISKGYWEYLFFRPWLNDGLLLSTGDKWRLRRK LLTPSFHFKILESFLGGISKNSETYVESILESGGKPLDIQEPIRMATLKIICETAMGVTLSTDNE EQNAFITAIKDASEGIVLRYLTFWLYSDFIYRRSEFGKKFYNSIDTLQSFSKKVIRRRKQLYQS EKSDVGEGNKSRRKAFLDLLLEVEDSNPGLFTEADIQEEVDTFMFEGHDTVSAAIIFSHFLLA NHPNVQEKAFKEQDGIFGNDDRPASMQDLQRMTYLEMVIKETLRLYPSVPFHSRKLYQDL RIDDNTWPAGQSVGILTFYIHRSTRHWDDPELFIPERFDPEISRHPFSYIPFSAGPRNCIGQ KLAMMEIKTLLSTVLRNCILEPVTKSVDPVASVIIRNLDPIILKVVPRPRAA >NezVir_CYP4HB9/1-489 SEQ ID NO: 20 MLLLLLSLALLFIVWWKSIPSSKFREAGSTIPGPKAYPVVGNLFNFKLTGPSALKHWERYTKI YGNTFRIWIGPHLQIFTIEPDDIQTIFSSKMSTKSNSYKALESWLGTGLLISNGNLWHQRRKAI TPTFHFKILESFVPIFYKCGIILVNCLKEKVGKVPFDITPYMSNCALDVVAETAMGTEVKAQTN PHDEYPKSVLRMTKLLADKMYNPYWNLLEPIYTLLGKKKEETDLLKLLSTFPLELLKRKENE KNNHPSSRENGENKNIAFLELLVRIKETKNPAFKSEQDIKDEVVTFMFEGHDTSSMALVYTF WLLGLHSEIQEALFQEVSQTLVGKIPSMEDYHKMDLLNRVLKESLRLYSPVPLVSRMITEEIV LPGSGYRLPAGTQVVVSMYSLHRRADLFPEPEKFNPDRFLEPIKHPFAYVPFAAGPRNCIG QKFVMLELKVIVSLVVLNFEIHSSNKNLKLTRDILLRCLNGPNVSLTLRK >NezVir_CYP4HB10/1-493 SEQ ID NO: 21 MDFFLYLSAILAVLLIWLLFPNRMSRMARKIPGPRALPIFGNIFNFIVIGPKAPECWKKQMETY GNTFRVWLGPQLHVFMVDPEDIKAILSSQSLLTKSESYKTLVPWLKTGLLVSTGKLWQMRR KAITPTFHFKILDEFVPIFYKCSKILLDCIKDKVGQEPFLITGFMSNCALDTIAETAMGTELKAQ TNPQSEYPTSILRMTTVLVERVANPLLGMEPLYTLSGRRKVESDLLKILFSLPREVIRGKKYF KSNRKNITPSDEAFGIKKKTAFLELLLEMKENNAPAFQTDKDVQDEVITFMFEGHDTTTMAL TYTTWLLGMHPDEQEKLYQEVSSILEGKAEPSMEDYSKMEYLERVIKESLRLYPPVPIIGRE AIEDVLLPSSGFLIPKGTQITIIIYALHRREDLFPDAEKFNPDRFLEQQKHPYAFLPFSAGPRN CIGQKFAMLELKVMISNLVLHYKIKSKKDMILNPEMLLRSENGPYISITPRN >NezVir_CYP4HB11/1-477 SEQ ID NO: 22 WLLTPEKRLREMGNKIPGPTPYPLVGNIFNFNIFGIKALDDWKYCMNKYGRTFRFWLGPQL HIFITEPEDIQMLLSSQTLITKSEAYYTLESWLGSGLLVSTGELWQRRRKAITPTFHFKILDEF VPTFNKCANTLVKILKDKVSKGFFPLTDFMSHCALDAVAETAMGTEIKAQTNPIGEYPSSVV KMTTTLMEKIGNPLLGMEPLYTMSGRRTREDHLLNILFSLPLEVIRKKENEKNSPTDSSPTE EAFGVKKKTAFLEYLLKMKRDNVPAFQTEKDIKDEVMTFMFEGHDTTTMALTFAVWLLGLH QDIQEELYREVSGILVGQEPTMEDYQKMTYLERVLKETIRLYPSVPIVARKATQDVVLPSCG YTVPKGAHLDVIILALQRREDLFTDPDKFNPDRYFEPQKHPYAYIPFSAGPRNCIGQKFAML DMKVIVSNLVLNYKIESDEDIIVSPEMILRTKKGPNIRLISRN >NezVir_CYP4HB12/1-494 SEQ ID NO: 23 MYMILITLALGAFMIWWLFRPEKRLREMGNKIPGPKAYPIVGNIFNFNLYGINGPKDWKECIE KYGPTFRVWLGPQLHIIIAEPEDIQALSSKTLITKSDAYSALQPWLGTGLLLSTGELWQRRRK AITPTFHFKILDQFVPTFSKCANTLLKVLKDKVGKGFFPLTHIISDCALDSVAETVMGTELNAM TNPIGEYPTAIERMTLLLMEKIKNPLLGMEPHYTLSGRRKKEKHLLNILFSLPLEVIRKKEIENI DVRDDSDASGDAVLGVKRKAALLELLLKMKRDKVPAFQTEKDVKDEVITFMFEGHDTTTSS LTFAIWILGKHQDVQEEVYREVSEILVGQEPTYEDFQKMTYLDRVLKESMRLYPAVPIVARQ ATHDWLPHNGYTIPKGAYLNVMIYPLHRREDLFPDSEKFNPDRHLKPHKHAYAYIPFSAGP RNCIGQKFAMLNMKVIISSLLLSYKIESNDDLIVYPELLLRTKKGPYIRLTPRN >NezVir_CYP4HB13/1-518 SEQ ID NO: 24 PLLKQCSIFILARDHYISHSKSRMEFLLLSLALGAFILWWMFSSPKRLRELGNRFPGPRTYPI VGNIFNFQIIGPNAPQCWSNFSKKYGYTMRFWLGPELHIFVSEPDDMQMILSSQTLITKSTS YKLLDSWLGMGLLLSTGNLWQMRRKAITPTFHFKILEKFIPTFNKCANTLVNCLKDKADKGY FNIIDYMSNCALDAIAETAMGTEIKAQTNPLEKYPRSLSRMTKYLIERVRNPLLSMEPIYTLSG RRKEEAKHLDVLFSLPLEVLEKKKNEKINTLNETEPLEEDYGAKKKTAFLEMLLEMKQKNIP GFRSDKDIKDEVMTFMFEGHDTTTTVLSYTIWLIGMHPDIQEELYKDLKEITEDSELTIDVYH KMHYLERIIKESLRLYPPVPAFGRLATQDIVLPTSGYVIPAGAQVDLVVYLLHRREDLFPEPE KFNPDRFLEPAKHPFAYIPFSAGPRNCIGQKFAMLDLKAIISHVVLNYKIESDSNLEVNPEML LRTSKGPNVKLTARNQ >NezVir_CYP4HC1/1-511 SEQ ID NO: 25 MDMSVVIWIIVMGVGWAWPYLLLGIVLLLIYKFYNSRSFKLLSAIPSTNAPRFIGHTLDFLTMH PSNILSFMLQLFDKNKTNKNVMAIWTGPFCFVYLRTLPDIEKLLSDNQQLRKSINYIYLEPWL GQGLINSDGTIWQRHRKMITPSFHFKILEGFLEIMNSKLDIFSEVLEKKVGNGYFDIEPLIANY SLDVITETAMSTNVDAQRTNSEFIDCIKSLTEVIIIRSVRIMYFFQPIFNLSPYKNQESKSINYV NKYIAKILENKRTEAKNIKKDENVENDIGAKEKLALLDMLLQLQFSNAKITDKEIYDEVNTFMF AGHDTVSSALSFVIYNLAVHQDVQEKVYAEVMEVLGDSKPTYQSLMNFKYLERVIKETMRL YPSVPYIGRRLKKDMPITDGHIVPKDSDVAVFIYDHHRNPENFPDPEKFDPDRFLPENIAKR HPYAYIPFSAGSRNCIGQKFAMMEQLATVSHLLRQFRISIEPGFVMKPISHIVLRPNVEGVRI KLTKR >NezVir_CYP4HD1/1-469 SEQ ID NO: 26 MLILFGILLTALFLLRFFCRHFNYYKLALRLPYAKKAPLIGHALNLWVDKDELLDKILEIIGEPD NKRSIQEHGVLAVWIGPMAIVLVHDLQDIEQILTSRDLTRKSYQYKFFEPWLGQGLFTASGP HWYSHRKLITPAFHFKILEKFIPIFNANIDIYLRKLDEKVGKGSFNIENYIAYLSLDIIAETAMDA KINAQKEESPYAQKVKDMTETILLRGCRLLYYSDVIFSLSSLGRRQKRSKRFIDNFINDLVKR KKEERNRIQLTKNNKNNSEIDEKERVALMDVLLETQNRSSHFTDKDILDEVNTFMFGGHDTI TSCINFTLYLLSKHPTIQEEVLREIESVIGEEKFTLSNLQQLKYLERVIKESLRILPVGPFMQRA AEKDIKLRSGYVLPAGCTIIMMIYALHRNPEYFPNPEQFDPDRFLPENCLNRHPYAYLPFSA GPRNCIGQKFALLEMKAIIAATIR >NezVir_CYP4KC1/1-522 SEQ ID NO: 27 GQNDRGAPTLYRPPAAQSFATSLPEDMIILVLLAIVVVLFVYLLSPDAKTRKCGQQIPGPKP WPLIGNLFDMELGHKGVKTYNGFQAKYGHVIRYWLGSKLAVLLSDADDAEVLFRDTQNLG KADVYKFMHPWLGTGLLTSTGHKWFQRRKAITPTFHFKVLDQFIEVFERKSTILVECLKSMA NGQSFDIHPFVSRYSLDVICETAMGTSVDAQNNIESEYFNAIRTVADCIVTRILKFWLHPNFIY RFSRLSKQHDAALRWHGFSKKVISEQDRLNNKEQLHNDKESDTGMKKRTAFLKLLIEMKR QQNGAFTSEDDIREEVDTFMFEGFDTTASAISFAIYEFGRHPNIQETAYHEVRDAFAGETAL TIECLNNLKYLERFIKEVLRLYPSVPMIAREICKDIKIPSGYLIPAGSIATVVIGGIHRNKKYYKN PDKFDPDRFLPENMVNRHPYSYVPFSAGSRNCIGQKFAMLEMKASLSHILLNYEIGTTEESK YGMLLTLQSFNGQNVWLKPRRTA >NezVir_CYP6HK6/1-496 SEQ ID NO: 28 MLAIILVVLAAYAFYQYSVWTFDYWKKRKVPHPPPVPLFGNIKEVVLMKQYPGHCHQQIYK MYPNEKFVGLYQLRMPSLLIRDPSLVKQCLIKDFDHFFDRGFHTDEEREPLTGHLVSLTGTR WKLLRTKLTPVFSSGKIKQMFPLLLDCSDQLRDFIKTQMGGKEGVLEMREVTARFTTDVIGT VAFGLQFESMSGDSVFRQMGKRALQPTVAGALAKAMRCFTPKLFDLLKMRTFPEEINSFFT NVVSETMKQRTEANYGRNDFLQLMMQLRDASGADIAKNDIELNDQVIAAQAFVFFLAGFET SSTTLSYCLYELAKNRQCQEAVFNEIQEVMKKHGELSYEAVSDMIYLEQVLLETMRMYPPV GNLCRVCTKPYRIPGTDIQLDEGVSLVIPVFALHHDPELYPDPESFIPERFTDKELQKAPYYL PFGGGPRICIGQRFAMIEMKLALLRLLENYTFSLSSKTPPELPVEPKSFIMAPIGGIWLNLNA RS >NezVir_CYP6LV26/1-492 SEQ ID NO: 29 KYYVSVYDLWEKRGIPYYPSTFPFGCSYQILTHSRFPGYIHDEMYKKLAPNPMFGLFVMRV PMLQIRDPDLIQLILTKEFSHFRERMFIKISEKDVLNQHLFNLDGERWRALRLKLTPTFTSGK MKAMFPLFLNCAEAFDSLILSKIGCDVDVKDLIGRLMTDIICSCAFGLDSNTIKEPDHKLRQIG AQVFKMNFMDKVKIAILQAMPKLANKIEARFTPKETEDYIVKLVENTIEYREKNNIKRNDFLDL LIQLKNKGTVGDDLKDEIEEQKCQPFELTIGLMAAQCFVFLVAGFETSSSVQSFCLYELAINQ DIQTRVKKEIDEKIEKHGGLTYQAVKEMEYLDMVISETMRKYPTLPILMRYCSKSITTPYGYKI EAGDTIIIPVWSLHHDPEYYPNPEKFDPERFSPQNMESINPYTYLPFGEGPRMCIGMRFGKL QTKVGLITILRNCRVEPCAATKIPLVIGPSPMLTIPKDPIELKLVPRSSSS >NezVir_CYP6LV27/1-510 SEQ ID NO: 30 MLTILIGLLIPLWLFYKYYVSVYNFWESRGIASEPGRFPFGNKLQLVTMNKSQALVIDKMYKK FESQPYFGFYVLRSALLVVKDPEIIRLIMAKDFSHFRDRFPARVFTSKEDKLQHHLFNLGGE KWRALRIKLTPTFTSGKLKGMFPLFIACAEDLSKMLISQIDKPVNVKDITACYTTDTVCNCVF GWENNSINEKENKMRKLGQTVLEISKTVLLKRMLRNIFPGIAKLLKLRIVSNEIEDSLIKMVGD TIAYREANGIKRNDFLDLLIQLKNKGSVEDDVKKNGNDTTAEPVEMDLGMLTAQCFVFFVAG FETSSSVQSYCLYELALNPEIQKKLREEINATINKHGGITYQAIQEMEYLDMWSETMRMYPT LPALNRHCTKDYTTPSGQKIKKGDDIIIPLYSLQRDEKYFPEPKKFDPERFSKTNKYKINPFTY MPFGEGPRNCIGSRFGLIQTKVGLITILKNYEVCKTEETQVPLEFRGSGVIAMTKGPITLKLS PKPSDY >NezVir_CYP6LV28/1-500 SEQ ID NO: 31 MLVGWIIVGLLWLFYKHWISNYSYWKKRGIPFYPAEFPYGSDPNFVKLKKFKGYTMDKMY HEFAPHPMFGIWLRKPMLIVKDPELIQMVLTKEFSHFRDRGIFKLPKRDTINHHLFNLEGEK WKAIRMKLTPTFTSGKLKTMFPLIISCAENFSSLLLSMADSKVDIKELAGRFTADVISSCAFGL EIDIMNNPDNKLRRIGIERVKVKTLKKLKNTLTQIFPALSTILPARSNESEEQNYVINLVKSIIEQ RENNGIVRNDFIDVLIKLKNKGNLGDDAQETEEPFEMTIELMAAQCFVFFIAGFETSSSVQSF CLYELALHQDIQSRLIKEIDETIEKNGSLTYKAVQEMEYLDMVISETSRKYPTVPTLVRQCTK SVTLSTGQNIEKDTMIIIPVWSLHHDSQYFMDPDKFDPERFSKENRDSIVPYTYLPFGEGPR MCIGMRFGLLQTKVGWTLLRKFRVEPCEETNIPLVIGGNSATTASDKPIIIKLIARY >NezVir_CYP6LV29/1-514 SEQ ID NO: 32 ATSRRIVLLQLPYKMLFGVTIIAGLLWLFYKHWVSVYTHWKEKGIPFHPAKFPFGSHPNLVKL KEYRGYTIDKMYHRFAPHPMFGIFFLRSPMLIVRDPETIQLILTKEFSHFRDRRILKISEKDVL NHHLFYLQGEKWRDLRMKLTPTFTSGKLKAMFPLFISCAESFSSLLLSKSDSKIDIKELMSRF TADVICSCAFGLELDVINHPDSKLRMIGIEKIKLQFLQKLKMAATILFPALSTLLNMRFTSLEDE KYILNLVKKIVEQREKNGIVRNDFIDLLMQSKNKGNQGDNEQEFEKTFEITLELMAAQCYVFF LAGFETSSSLQSFCLYELALHQDIQSRLIKEINEKIENNNGLTYKALHEMEYLDMIISETSRKY PTLPMLYRSCTKPIILPSGHKIEQDTIISIPTWSLHHDPQYFPDPEKFDPQRFSQENRGSIVPY TYLPFGEGPRMCIGMRFGLLQTKVGIVTLLQKCKVETCEDTKIPLVMGGISATTAPDEPIIIKLI ARS >NezVir_CYP6LV30/1-507 SEQ ID NO: 33 MFMTIYLVALAFFLLYKFWTSNYSYWKDRDIPHIPPVFPFGSSRDLALQRGFQGDIWSELYR KCSSQPFFGVHIMRTPFLVMRDPEMIRFVLASSFFNFRDRQPFKRSREPLTHHLFNLEGEQ WRALRTKLTATFTSGKLRGMFPLFLSCSESLDSILQTNVNKVIDVKDITARFSTDIIGSCAFG MDMDSISNPNSEFRKIGIEIFKLKNSTRIKLALVNTFPDIMKLFSPRFTPKSVEKFILRAVSGTI EHRLRYGIKRKDFIDLLMILKYMNGDKKKSDDIPKLNLNDMTMEMMAAQCFVFFTAGFETS GSVQSCCLYELALNQNIQNRVQKEIDHMTEHYGGLTYEAVHKMVFLDMVIAETMRKYPTLP SLTRFSTERTVLPSGHVIDKGVRVLIPVWALHRDPLLFPEPEKFDPERFSDDNMALIKPFSYL PFGEGPRMCIGKRFGLLQTKMGLITVLKKYRVEPTSKTEIPLDFSPKCILITATEGPIHLRLVE RTDHCPS >NezVir_CYP6LV31/1-533 SEQ ID NO: 34 FDNWLYLNTLFFIQLFSLKQVHTFNEMFAIIISLVVIAAVVYYRRYRSFYSHWDKRGIPAIPGS VPWGSYSSRSHMRQYQGFSLDKFYYKMTNHPYFGFYDMRSPILIAKDPEVIRLILTKEFSHF IDRTYTGLPKTDPLLHYQLFSLSGNKWRALRTKLTPTFTSGRMKAMFPLFLDCAQGLNSLL WSRVGSIVDVKDAVARFTTDVICSCAFGLQTNTVVEPNHPLRKAAADFLAFGDSLYLKFRLL LTLLSPFRIPFNRFTPKSVEDYIMKLISDTVEYREKNKITRNDFLELLIQLKNKGSLKDERKEE VEENFEINLDVMAAQSFLFFFAGYETSSSVQTFCLYELALNQDIQQKLRNEIQEVIKIHGEVT YQAVNDMKYLHMVVSETMRKYPTLPALMRRCVIPFTMPDGGKIQKGDQIFIPIWSLQHDPQ YFPDPEKFDPERFSQENERNIIPYTYLPFGGGPRMCIGNRFGLLQTKVGLITVIRNFQVLPCD KTSIPLKLVKNSNNITACEGPIILKLIPTAPEN >NezVir_CYP6LV32/1-451 SEQ ID NO: 35 MLFVVFLLAVVLFLVYKWWTSVYSVWDRRGVQNVPARTPLGSDGRFTLLTKYQGYTLNEM YQKFSSPYFGIYLIRSPFLVIKNPEIISIILTKEFSHFRNRQFLKIHQNDFIFQHLFNLGDDKWKT TRGKMQSTFSSSKLRTMFPLFVKCTENLMSALLEKEGDTINMKQALASFTTDLTCKTLFGLE ADTNCDSEVTRIGKIATDFNLMILLKIAVKLAFPEIAQNIPIKVFSTDIDKFFLKLVTEIVDYREK NNVKVHDFMDLLIQLKNRSKNGEEKKFENGNINIQSQDITLEVMAAQCFFLFNAGFENSSSI QTYCLYELALKPEIQKTLQDEIDKCLKKHGEMTYEALKEMNYLNMVISETMRKYPILPFVTRV CTSPLTFPDGFQVEKGDQMILPTWSLQHDPQYFPDPEKFDPERFSEQNKDSIVPYTYLPFG EGPRMCLGMRF >NezVir_CYP6LV33/1-441 SEQ ID NO: 36 KHKYFGYYEMRRPLLVVKDPEVLKLVLTKEFSHFRDRFTRPMPKTDPLLHYQLFILGGDKW RALRTKLTPTFTSGRMKAMFPLFVDCAQALNTLLWSQVGSAVDVKDVISRFTTDIICSCAFG LQTNTIAEPDHPLRKATADFLSNGDSLFFKIKFIVSMLVPFILPLSRFTPQEVEDYIMKLISDTV EYREKNQVTRNDFLDLLIQLKNKGSLREEGIAETEESFEVTLEVMAAQCFLFFFAGNETSSS VQSFCLYELALHPEIQQKLREEIQEVIRIHGGVTYQSVNEMKYLHMWSETMRKYPTLPQLV RSCVEPIVMPDGGRVEKGDQIAIPVWSLQHDPQYFPDPDKFNPDRFAPENEGNIKPYTYLP FGEGPRMCIGNRFGLLQTKVGLITIIRNFQVLPCEKTSIPLKLVRTNNSLTTCEGPILLKLTSIE ERS >NezVir_CYP9DS1/1-392 SEQ ID NO: 37 SKMRGMFTFMSECAKDFASYFLEEANGKPIEVDMKDLFTRYTNDVIATSSLGIRCDSLRER ENSFYTMGKKMTTFSSLTAGIKMMVATVLPKLLEITKIGFLPKDCANYFTQIIFETIQRRTKENI IRPDMIHLLLEARKGNLKHESKADESSGFATVEESDIGKSQKSRSVELTDEVIAAQAMIFFFA GFETSSTVMSFMSLELAINTDVQQRLLEEIDEVYKQYGDNVSYDAIMKMQYLDQVISETLRK WTPGFQTDRVCVKDYVIEPTKEGEHPLHIEKGLLLLVPTAGFHYDPKYFPNPEKFDPDRFS EENRSSIVPGSYMPFGLGPRNCIGSRFALLEIKVLFYHILSKFELTVVKRSCVPIKLSTEFNLT VEGGFWLGLKPRNISV >NezVir_CYP15A1/1-490 SEQ ID NO: 38 RMWFLILLAVLLALLILESTPPSRFPPGPRWIPFLGNYLLFYKLRQKLGFTHLVWEWLSKRY GPLVGVRLGNDKLVIGTNLAVVKELLTKEQFEARPDGFFFQFRAFGERYGLVFVDGEFFNE QKRFVMKHLKSFGLNRSIMEGRISGEAEDLVQHILKNQKDGVVFSEIVEISVMNILWSIVAGG RFQLDDKKARVLIDHIHTSFRLQDMSGGILNQMPFLRFICPELTSFNKLKDVLGNLTTFVKQII DEHRETVSSYENRDLVDAFLNEMKKHEASKSTFTEKQLIILLLDLFLAGPETTSATLGFAILHL LHYPHIQNNLHNELDTVIGKGKRPCMKDKPNLVYMEAFTMELLRSVNVTPTTVSHRAKEDA EVMGYIIPKDTIVLANLYSLHMNKDHWIDPEKFRPERFIDENGAIIQNDFFIPFGLGKRRCMG EALAKTSIFLFLTTILQNFKVRPVSQELPPMKSLDGATISPASFRCFFEPRE >NezVir_CYP18A1/1-526 SEQ ID NO: 39 MYHVKMLLELRSLAVFFIVFFFGRRLWALLSRIRTLPPGPWGLPLLGYLPFLKPEAHVHFAQ MAKKYGGIFSLSLGNQFVVILSDYKLIREAFRREDFTGRPDTEFTNILGGYGIINSDGRLWKE QRKFLHDKLRRLGMTYSGQGKHEMEARIMKEVEVFLHTLSKERNNSTDLNPILCTSISNVIC SLVMSVRFKQKDAKFTRFMNLIAEGFRLFGSLNYANFFPIMRYLPGLQEVIKKIAKNRTEMA AFFQETVDDHRATFDSHNMRDLIDNYLMEIEDAKATGRSEELFQGKEHDRQMQQIIGDLFS AGMETIKTTLLWAVLYMIHEPEVASKIQEELDRVVGRNRLPKLEDRPYLPYTEAVILEVLRISS VVPLGTTHSIHQETKLGGYTIPENAHVVPLLHAVHMDPNLWDEPKAFKPERFLNQEGKVCK PEYFMPFGVGRRMCLGDVLARMELFEFFSSLMHTFHLRKAGEDSGLPTLEATTGATLTPLP FEVSLVQRPLQDSPHEFLNTCQGLRPAGSL >NezVir_CYP301A1/1-539 SEQ ID NO: 40 CVPCWEVLQRCESSSLSIQVIFKLIFLYPGYLSEHTMQRWSGLGRRLSQLAACPSEVVRPY QEVPGPRPLPIIGNTWRFLPVVGDIEVSDVAAVSQKLYDVYGKIVRLSGLTGRPDLVFVFDP DEAEKVYRAEGDTPYRPSMPCIVKYKTEVRKEFFGELPGVIGVHGEPWRTFRTRVQKPILQ PRVVKQYIAPIQTVTELFIERMLEMKDENDEMPDDFDNEVHKWSLECIGRIALDVRLGCLDR NLPNNSEPQKIIDAAKFALRKIAILELKAPYWRYFPTTTWRKYIENMDYFRSVCMKYIQMALE NLKKKDNKQELSLLERILETEKDPKIACILALDLILVGIDTISMAVCSVLYQLATRPEEQQKMH EELVRIMPDPNCQLTSEMLDKMVYLKSFIKEVLRMYSTVIGIGRVLQEDTVLCGYRIPSGTQL VFPSIVMGSIEGYVSEPHRFLPERWMKCDRDNHYIHPFASLPYGFGARMCLGRRFADLEM QILLAKLIRTYRIEYFHEPLEYKVTFMYAPDGNLKLKMSKRKE >NezVir_CYP301B1/1-524 SEQ ID NO: 41 MEPAAGGEELGQASQSPQLSLHLNMIMRRTLCSAVSDIGAVLPKSYQKVPGPRPLPLLGNN WRFLPYIGQYKLEEIDKLSLMLRSRYGRIVRISNLLGRPDMVFLYDPNEIEKVFRGEDTLPYR PSMPSLDYYKHQLRKDFFSDIGGVIATHGEKWHQFRTKVQHALLQPRIAQLYLKPIEETANE FVNRIRDIRNENNEVPDDFLNEIHKWSLESIAKIALDARLGCLTPDGSQETQELIDAVNTFFK NVVILELKIPFWRVISTRTWKEYVEALDTIMRIVYKFVSKTLDELKNKNNECKEDSSLLQRVL YENLDNPKVAVILALDLFLVGIDTTSAAVSSILYQLSLHQEIQNMLYEEINRVLQNGPIDMKKL DQMVYLKACIKETLRMYPVVIGNGRCLKKDTVVCGYTIPKGTQIVFQHHAISNSEEYFDDPN VYKPERWLKKQKKKQYHPFATLPFGYGKRMCLGKRFADLELQCLIAKIIETYKVEFKRKLLD YSVHPMYMPHGPLNFKYTERKKKT >NezVir_CYP302A1/1-512 SEQ ID NO: 42 MAFIQRILSKRNVCSNALRKKDVPKPFNQIPGPRSLPIIGSSWKYIPFMGDWDVSKLHIVGTK RFEQYGGLVREEVSPGINFVHVYSAQDIEKIYKNEGKYPERLGHLALMHYRLCRPHLYNSG GLLPTNGSEWWRLRSTFQKHIARVQDARSFLSKGEDIINDFVTTILFNNYTCEDFLPLLSRLY LELMWMFIFGKRLNSFDSINISENSIPSKLMKAAEDITHTTMITDSSEKIWKVIKTPSYIKIEKN FEYIEKIVLSALKEAETENSKNRKHSDENSKICLIDKFFQTPEMSSKDINAMTADLVLGGVDT TAYTTAFLMYNLSRNKAVQEKLYSEAVKLLPSPDTRITSDILNSAIYARAVLKESLRLNPVSV GVSRILQQDTVFSGYLVPKGTLMLTQNLVACRNEDNFKNALEFIPERWIRGSPAYQEVSPY LVLPFSHGPRTCIARRLAEQNMLTLLLSIIRKYSISWMGEVMDIETPLTCKPDKAVKLSFHNW VVKNKVLNIS >NezVir_CYP305L1/1-502 SEQ ID NO: 43 LKLGIHRELTKMSLLVFISVIVLIVLFYYNLKSVKYPPGPIALPYFGNIITIKKLSKKFNGLQGAFI ELSKQYRTDVLSVSMSGEYSVVVQGKELIDEVLRGDEFQGRPNNFFIKLRSMGARRGITMT DGPLWKEQRAFAFKHLHEHGLGTQKMDDMLQRQLQEMLSKLNEGVLSNLVLKQYVSKCV LNVLWEMVTGSSFQDEETMTSLISLMEARSKAFDISGGLLSQFPWIRYIFPKYSGYNLIQTLN RKFKEMIMGIIEHHKKTIVKGHSRDFIDAFLHEMNENPTSSSFTDEQLVMVCLDFFIGGSQTI SGTLDYCFLYMTMYKDVQEKVQKELDDILLPGQSPSRNNKNKCPFVEAVISEVLRISPIISLL GPRRTTCDTFLSGYFIPKDTTVYLNFKTVHDSSKHWEDPGKFKPERFLNEEGTVKQEQTLY NFGRGKRRCPAEVLARTALFILFSGVLHNLKLEPADEKDPLSLRQVPGITTSAAEYYIKLTRR HK >NezVir_CYP306A1/1-558 SEQ ID NO: 44 AVSQLITVQYLVKCFTILQSCLQVMYEEDARGGYISGVLTKVAVRFSPLQSTIAMLPHHDTH STSYGLDCSLIFKDLSEILIASLVLLCVTVFFYYLWRTRGMPPGPWGLPLVGYLPWIDKDKPY VSMMELYQDYGGICTIRLGEVVAIVVSEPHYVKEALSQESLTGRAPLWLTHGLMNNNGLIAV EGPKWREQRKFVINCLKNLGAVKVGEKRAVMEKRILGGIRITFQMIDERREDGPFDPKQILS HTIGNIMNTIVFGKSFDLDDHTWVWLQHMAEEGVKLVGVAGPLNFMPYLRILPQYRKLLDFI KNGQKRTHDVYRSIANEQRTKDNILSYYLEAIASGKGEYFDEAQMLHLLADMFGAGVDSTL ATYRWVLLYLALHPEVQERVYEEVSSVIGKGKEPNMDHFSMCPYTEATILETMRIRPVVPLG IPHGATKDTQIAGFRVPEGTMIIVNQWTLHHNPKYWINPEEFEPKRFIDSDGCVRRKDSFNP FQTGKRSCFGEELAKMVLFLFTSSMVLRYRLQLEGSSSAGLGGECGITLSPGQHSISFVLR Q >NezVir_CYP307B1/1-477 SEQ ID NO: 45 MEGIYLSSASYLLLFGLAILWAVLSVLKRPKGSAPGPTPLPVLGSLHLLGGYELPYQAFDKLS SKYGPVFGIRLGSVECLVVSSLETVKEILINKGEHFDSRPNFSRYLNIFGGDKDNSLAFCDW SELQKTRREMIRDHTFPKAFSSKFHQLESLLNRELVVLCDQLSKGVTNIKPIMLHTCANVFM SFFTNTRFQLEDPVYSKILMYFDIIFYEVNQGYAADFMPWLNPMLMNNMKKMRKLGKIIREF MDERVVSNGGQEGDLLHMLLESVESGKMNRENAMFALEDIIGGHTAIANLIIKILGFISNQPE VQKKMQEEVDAVTCGKNIKLEDRLMMPYTEAVILESIRHICSPIVPHVASQDTTVNDYHVEK GTLIFLNNYTLNMSPELWTEPEKFSPERFLTEDGRLIKPEHFLPFGGGRRSCMGYKMTQYV SFSVLATMMQKYSIAPHPTNGKVPRGDLALPFDTLKFIFNPR >NezVir_CYP314A1/1-511 SEQ ID NO: 46 MQPPLEWSIPNFTAVFLFIAILLLKELRPIFKKTRYLTRPVTTKKKIPTVNQIPGPLQLPVIGTR WIYYTKYTLEKLHEAHKDMYRTYGPIVKEEALWNIPIINIFSKNEIEKILRHPSKYPLRPPTEVT AYYRATRPDRYASLGLINEQGETWHTLRSHLTPELTSAKTMSSFFPELLSVTEDFIRLLQVS KDANGIVEHFDDLACRMGLESTCCLILGKRLGVLEDEASEVSLRLANAVKEQFCASRDTYF GLPFYKLYPTKAYKRFVNAEEIIYDVISEMVENAENLENDTYLEDSPSVFQSILNNPGLDIREK KAGIIDFIAAGIKTLGNTLVFLLYLMAKNPECQEKIVDEIDSLTSGKELTLQALGKANYLKACIA ESYRMLPTAPCLARILETDMELNGFHLPSGTVVLCHTWQASLMEENFQNADQFIPERWLG KERMPWLVAPFGAGRRLCPGKRFVELELQVLLAQIVRKFKLECAGELEIQFEFLMAPASPS SLKLVERT >NezVir_CYP315A1/1-443 SEQ ID NO: 47 MMKMIPYVKGLPIIGTSLSILAAGSSPKLHLYIDRRHKKLGPIFKENMGTICGTFVADPLAART VFSAEGRYPKHMVPDAWKVYNKMYNCNRGLFFMEGEEWLKYRHIMNKLILKRNLPNQQV QEYIISSFMESMDNFVGKQMHNIEHKFYQLSISFFIGTLMGTAIINKMEYFNKDIDNLALVVNS IFSTTTNLMNIPISLATSLNMKIWKEFTESVEYTLKAGRVLLEKIKGFPLNDGLLKDLLEEDLD DEVITGLVMDMILAAGDTSAYTSQWALYLLSREPEVADKVRSNDQLVSGVVKEVLRLYPAAI FISRYLDRDLILPTLDCQLSKGELVMLSLYTIGRLESAYTEPLKFKPERWMRHVDSNSRHYL GVKEPMAWLPFGVGSRSCIGRRLAEAQLHLTISKILSKYRLHLVEPVDMELRMVPVPTKPIKI KVDRL >NezVir_CYP395P1/1-516 SEQ ID NO: 48 MITIALLIVIVSLLAYVYNWANNINQTWKRRGVKHRKPALIFGNVTILVPRKDQKHLSVLCADI CREFPDEPLVGFYDFTQPWLLLQDAEYIEKVLIKDFVHFTDHGFAINEEKNPIDAQLFNMVG KRWRAFRYKLSPIFTSGKLKSMYEPMSDCGVDLDNVLKTSNKEGLDFKQLMTHFAVDVVG SSVFGIHPKAIQNPNTKFCSLATDLFTFGFFDTIKFLIMFIFPKLSIKLGISFNNQNAVNYYSKIL KETFEYRTKNKVERNDFVQLLLTLKEKKKIDVQNWDSNDDYLKDGEAPAELESYEITENILM AQAYAFLVNGIDVLALSQVYALYELSLEPEIQEKAQNEIREQMKLHNGITYTALKNMTYLEKV VKETLRLHPAGGTLFRTCTKDYVFPNGTVIKEGEMLVIPMSAVHLNPNYYPEPDVFKPERFD LPMKPGTFLTFGDGPRVCIAMRYAILLIKYGIVKILSNYKVTLNTKTELPIKLKPNAAIGTPTSP LLFDLEAINKDY >NezVir_CYP395Q3/1-512 SEQ ID NO: 49 MLTLCLIILVLTLVGFIVNWIRKVHLFWEKKGIKHLKPSFLFGNSLPVLLNKKSISEQFIDLCKT YPNEPLLGHYDFLKPSLIVQDADYAEKILIKDFLHFTDHGMEVNEDKNPIDAQLFTMCGKKW RAFRYKLSPIFTSGKLKNMFDTMAVFGDRLVNLLSTKKEYKKVNLREAMSSLSMDIIASTVF GIETNVLENPDSEFRKMGKKVFDFGIVGFIKIWIIMSFPGLGKKLGVSINNKDVVQYFTDIIKK TFSHRRKNNIHRNDFVQMMIQLQDKGHIEVRNWDANDDYLKTDEDSNMNVDSYEITENVVI AQAFTFLTTGLDTIGIGQTYLLYELALQADIQDRVREEIFEQCKIHGGLNYDSLKAMTYLEKCL KESLRLHSTPQLFRICNKNYTFPNGYTIKKGETIQIAVSAIHRNPDYHPDPEVFKPERFDNLM RPGVWLSFGEGPRVCIAMRFALLQVKFGVARMLMKYRLSINPETKLPVEVLPQSVVLEPKY PIYFDLEEVS >NezVir_CYP395R1/1-512 SEQ ID NO: 50 MLAVGFGVLFIVLLLLILMWISSMNRHWEKKGIKFSKPFPLLGNCLPMILSKKSFTDIIDDLYN AHPNELVIGYYEFVSPKLIVRDLELARKVLIKDFSYFVDHVSEMDNVAWDSQLFMLSGNKW KALRLQMASIFTTGKLRTMYDSMPDIGKNLLQHLDNKVGNDIDIHELMILFSMDMIGSTAFGI DVGSLNNPNSEIMQMGKKIIDVGFLSVMHFWLYLLYPKLGNKIGIPHVYREVNNYYSEILKNT INYRKANKIQRNDFIEMMIQLREKGKLELKNLDPANDYLTSELVLNSPEMLNITDDLLMAQAH AVLTAGFESTSLLLTYTMVELCKNTDIQDIARREIMLQVKLNGGLTYDALKNMKYLDQVIKET QRFYPFTPVLMRICTKDYTLADGYVLKKGDPLYIPVASIHKDPSIFPEPDSFKPERFEDSQQP TAFMAFGAGPRMCIAVKYTLLIMKYGLALLLMNYEVKLSPLTKLPIKFTNKKFGNCETEKILFS FEKLVKEH >NezVir_CYP395S11/1-548 SEQ ID NO: 51 RTVEIIQYRVRTKFGLNQRLLAAANQFGSQCATDRMIGIALLVLAITALAYAFNWIKYWTKYW ENKGVKCLPAVPIFGNCLPMVLNKKNVSEIMEDIYNAFPDEPVAGYYEFLTPRLLIRDNELVQ KVLVKDFGHFVDHGFEVDEKKNPLDNQLFLMTGNKWRAFRTKMAPLFTSGKLKTMYDVM NEVGNGLLEYMDKNKANDIDIREAMGLFSMDIIGSAAFGINPGVLKNPDSEFRVKGKQINDP NWRNLIRIWFFFAFPKFSKKLGFSFQPRAVTSYFCNIIRNAIDYRKKNKIQRNDFVQMMMQL KEKGNIELKTLDATDDYLKNELNEASTEIFEITDDVLMAQAQSFLIAGFEATALLLTYAMLEIC QKPEIQDALRKEVLEQVKLNGGLTYEALRNMKYLEQAIKETQRIYPLIPFLTRVCTKSYTLSN GFTIEKGEYIYIPAAAIHMDPTFYPDPKTFKPERFAEQPKPGTFLPFGEGPRMCIAMRYAML VVKYGLALFLLNYRAKLSPSTKLPVQFLNRAFGNIPTEKILFNVEKYNEK >NezVir_CYP395T3/1-388 SEQ ID NO: 52 MCGNQWRVYRQKLSPAFTTGKLKYMLDPLAECVNNLLTLLESHAGEEVDMKETMELFSMD VIGSCVFGIDPGVTKNPNSEFRTIGKTIFEFTAIQQFRFAVLTMLPKLAKKLNFTFFRPEVVTY YCNIILNTLEYRKKNGIERHDFIQMMLQLQSKGKLDSQSTDPADDDLKTDKTLEGDDVQITD ELLIGTAFGFLTAGFHTTASSMTYALYELSRNPEALEKTKREIKEQVAVHGDITYDSLKSMTY LEKVLKEALRLHPGSPSTMRVCTKEYKFPNGLTMLPGDSINIPIYALHRDPNNFPDPLSFNP DRFDETPTPGTYLPFGDGPRMCIGMRFAMTAMKYALSKVLLNYDIQLGKTNETPIRMAPRG FLNVPKKEVNIKIIKV >NezVir_CYP3092D6/1-520 SEQ ID NO: 53 MSWQDWLMLATIAALSLLGLAYYTIKKLYRHFEDRNIPYIKPKFLLGSDPDGVLFRLHVCDS WDNIYKKLEGKPIGGFFQTVLPFLMVRDPEYIHQVLISSFDHFFDRNFLIDEEVNPLDAHLFL LRGNKWRYLRNKLSPIFSSGKLRWMFDEMDHCGDIFLECIDKLADGKDRDILDELARYATD VIESCAFGLEGDSIKNPNSKMRQVGRDLFDTSKFNLSQFFFLLRFSIPRLLIWLKVPSVPSHA KNFFCTTMSDVLEYRRKTGFQRKDFVQLLLQLKDKEIVEINSNYDVGDEKGKHEETVTEKIEI TDLLLVAQSFVFFVAGFETTSRTLHFLIHQLAEHQEFQKRARKEVLDIKAKHGRFSYDALKD MKFLNKCIAETLRMYPPVAMLNRECTKDFTFQDGTLIKKGEQIVIPIYSIHRDPRYFPDPLKY NPDRFEVDPQNGTYLPFGDGPRICIGKRFAIVEIKIIMARLLERYWFELSPLNGEKIEIDPWSL IVSSKKGLWVKIHKLTDLK >NezVir_CYP3092D7/1-509 SEQ ID NO: 54 IAAFSLLALAYYKIKKTFRHFKDRNIPYVEPTFPLGSEPQGVLFRKHIVDSFGEIYNQLEGKPV GGFFQTVLPFLMIRDPEYVHQVLISSFDHFFDRNFLVDEKVNPLDAHLFFLRGNKWRYLRN KLSPIFSGVKLRWMFEEMEKCGESFVECFDKLADGKDRDVLDELARYATDVIGSCAFGLEG DSLKNPNSPMRQMGKDLFDTSSINRTQITFLLRFSVPRLLLWFKVRSLPSAIEEYFCSTISSV LERRRKTGLKRRDFVQLLLQLKEKDVVNIDANDVDEKEDKSQQNNDIEKFEITDRLLMAQSF VFFVGGFETTSRTLHYLIYQLAQHPEIQERARQEVLRIKEKHSQFSYDALKDLKFLDNCISET LRLNPPVSMLNRECTKDFTFPDGTSIEKGEQIVIPIYSIHRDPKYFPEPTKFNPDRFLSDPQR GTYLPFGDGPRICIGKRFALVEIKIVMARLLERYSFEPSSLNKEPIELNPWINVLCAKNGLFVK IQKLNNSK >NezVir_CYP3092E6/1-486 SEQ ID NO: 55 FFEKRNIKYVKPKFLLGSEPDGVLFKIHITESWERIYKKLEHEKYGGFFHAILPTLMIRDPEYIE DILKTSFDHFVDRSFLVDVKTNPLDENLFFMRGNKWKYLRCKMASLFSQIKLKWMYEEIEK CSNTFDECLSEFADGKDADIKDLLARFVTDVVASCGFGVEPQALKNPDWIFRDIGREIVDPE NINMPLFLLRFSIPRLLIWFKIKTLTKKLRNFFLSTTKRILHHRRSTGIIRKDFVQLFLELKEKGT VGIDSRNIDTNKTNTESNNEIIELTDNLLAANSFLFFLAGFETTSTTLYYTYYFLAKHQEIQER ARKEVQEVKAKYGHFTFDSLKELKFLINCISETMRIYPPIAVVIRECTKDYNLLDGTLIDKGMR IIVPIMSIHRDPKNFAEPMEYKPERFENPPASGTYLPFGDGPRICIGKRFAEIIMYSTLARTLD KYKLELSPKCDHEIKLNPKVISTTPVHGLFFRIHKLNDTN >NezVir_CYP3092E7/1-483 SEQ ID NO: 56 FFEKRNIKYVKPKFLLGSDPDGVLFKIHVTESWDRIYKQLENEKCGGFYQAIVPTLMIRDPEY VNIVLKSSFDHFSDRIFLVDEKTNPLDEHLFFLRGNKWRYLRNKISPLFSQVKLKWMYEEIDK CVNLFDECLAELSDGKDLDIKELLARYTTDVVASCGFGIEPQCLKNPSSEFRKIGREYFDPN KINMRMLFLRLSIPRLLMWFKIKTVSAKINNFFLTTTKNILHHRRSTGVVRKDFVQLLLELKEK GTVEIDTTEIEKDETYKESPNEKIELTDNLLAAQSFVFFLAGFETTASVLNFTFYFWAKHQEIQ ERARKEVLEVKEKYGQFTFDSLKELKFLKNCIAETLRIYPSVPALNRECMKDFTLPDGTVIEK GLHVLVPILSLHRDPKYFPEPLEYKPDRFENPPVNGTYMPFGDGPRTCIGKRFAEAAMTSV LARSLEKYKFELSPMNNCGDIKLNPKVITSSPLHGIFLRIHKL >NezVir_CYP3224A4/1-497 SEQ ID NO: 57 MMEMILYAALIIALTNLALGIIIWFRVRKLYAYPGLLGFPVFGNLYYFYKNLFLGSFESIRVYLF EIVKQHGKNGICFHIAYGFRKLVIISSPQVVKQLGFHPHLKDKPVYGFQGFRRYMNGPFSRP RSDDSWKMRRKEYNCLLKKSSVENNFYYNFLKSADKMVELMLKSPSALDIHRAVLGVTQS VTMETLFGVESSLAFHPDVLQYMHSIKDIASRIIASPGIARTILSILRPYDEIYIRKIGTLRRMVL KELYRKMNNNQCFPSENTQSFNHLPMYIASRTEKSKKFNRRVVTELQEVFITSSHTVASTM SSTITCLAVLPEIQERAWKEQYEIFGDDNREPTLQDLEQMTYLERFIKESLRFCGPPLVGKQ ATDDIEVDGITIPKDTIVVYLLDFMRKDPNYWKDPELFNPDRFLEGGEELKYSFAPFGIGVRN CPGMTYAMTEMKIILSKVLRRTKLSLVNKDLKFEDLEFEAQILMELKNPPLLQVEERV >NezVir_CYP3224A5/1-510 SEQ ID NO: 58 MFNVEYIFRKMEKFATTAFIIAVAHLVLGLLLWFRVRKLYSYPGLLGFPVFGNLYYFYKTMLIA SFENMRIHLVQVAEQYGKNGICFCILFCFRKVVIISSPQVMKQIGFHPNLKDKPPYVFESFLK YTDGPFTTPSSDDVWKMKRKEYNNLLKKSSVENNFYNIFLKSADKLVELMLATPSTLDIEKA VLGVTQSVTMEALFGVDGRPAFDPEIIDHMYTLKNIITLIIGNPGIAKTILNGLGPFDGLLIRQA GALKKLSSQIMKQVHVKLKSSQHFPSENTKSNYSLSMYIASRTEKSKKFDQNVLTELQELFI TSSSTVSSTMSCTIICLAVLPEMQEKAWKEQNEIFGDDTREPSLEDLERMIFLERFIKESLRF CGPPLIAKHAAEDIKVDGVIIPKEAIVVYMLDFMRKDPKYWKDPKLFDPDRFLEENECSNYT YAPFGIGVRTCPGMNFAMTQMKITLSKVLRRVKLSTVKKDLKFENLEFEAMLLMELKNPPFL KVEERIM >NezVir_CYP3224B9/1-382 SEQ ID NO: 59 GIYAYAKGPFTQIRSDDLWKQKRKEYNIGLKRSHIDNVFCNIFNKSADKLIDLMVASASSVDA LHATMGIVRNVTLETLFNVDSSLAYDPQLITLMKKHRYLASFIVANPNLSGIILNILRPLDEILF RKLGEFRKVISEEIDKTLLSEQCPLPEQYLTMQIVSRTIKCNGNNNWNTTKLQDELMELYFT ATLTVSSVLSNTIIILALLPDIQERVWQEQYRIFGNDNRDPSIDDLKEMQFLDRCIKESLRFLG PPFVAKSVSHDIDINCITIPRGTNVLYLTGYLRMDPTHWKNPKVFDPDRFLEESETLKHSYS PFGIGVRGCPGSYFAPTLMKITLSKLLRRLKLRPVQKDFRFEDIKFKVSLMTEIEDPPALQVE ERT >NezVir_CYP3224B10/1-503 SEQ ID NO: 60 MEKFATTAFIIAVAHLVLGLLLWFRVRKLYSYPGLLGFPVFGNLYYFYRTLFLVTMDSMEKY MIRISETYGKDGLCFHWIYGFRTLVTVTNPHIVKEIGFHPNVTHKPNFIFSAFHSYFSGPFVS SRSDDLWKIQRKEYDKLYAVFTFHSRFLKKSRVESEHSNTFSKYADQMIELMLASPSADILR AVTLEFTHNSTMETLFGVDSSIVYNPQVIGFMSVIPVLGTLSVANPKLAGTIFGIFKKMESFFL RTIEKTRRLILEDIYSKILTSSPVAANKKALLSRQITSRMRKCNEDEDKLINELMELFVTSSGTT HALLSSSLIFLALLPDIQERAWQEQYEIFDNDKRDATFDDLSQMRFLDRFIKEALRFVAPPFY FKSVTGDTTINGITIPKGSNLVYLTGYMRMDPKYWKNPKVFDPDRFLEESETLKHSYTPFGI GVRNCPGMHYTTTLMKVALSKIIRRLKLRPVQKDFRFEDIQFETFIMRELANPPVLQVEQRE- >NezVir_CYP3224C1/1-488 SEQ ID NO: 61 MDGIYKVLLTILLANLVFGVILWLRVRKLCSFPGFLGVPVIGNLFYFYKTLFLITADSLENHLKE VTEKHGKNGFCFHISYGYKITAIITNPEIIKKISFHPNLIDKSYEMYGGFLDYMRGPFSRPRSD EKWKMWRKEYNIFLKRSCVDNDYFNTYITSAETLVNMMLDSTSAYGASIALTQNVTMRTLF GVETDLVYNKEIIKVLTRLIEMGAMLGANTNIARAIAPIVRPIAEKVSGKAVVIRKTIFQKIYKTIV SKKEPLSEPRLAMNVAAKSIESNESKRTLLQLMQEVLFTSAHTVASALSNTIILLAVQPDMQE RAFKEQCEIFGNDSRDPTIEDVERMEFLGRFIKECLRFLGPPFSGRKATADINLDGTIIPKGSI VVYLFNSITMDSKYWQNPNVFEPDRFLEESDLMKYTFTPFGVGVRSCPGMYFATTLIKITLS KILRTVKLRPVDKDFRFESLKYRSSLLTEIANHPKLHVERRA >NezVir_CYP3224D1/1-517 SEQ ID NO: 62 ALSVGWPTHFLWYQKFHLRRTQTVRMIETILYAALAILMAHLLFGVVLWFRVRKFYSYPNVL GFPVIGNLYYFYRTLFLFTADRTLKYVIPVAEEHGKDGLFFHWMFGSSVAAVITCPHLLKKLS FHPNLVDKPYAAYKGFQIFMEGPFSALRSDDVWKQHRKDYNNYLKKSRVDKDYFKTFTKS ADKLVDIMLETPSSLDANAACTAVAHDISMKTMFSVETSLVYRPECLRYIYRIKDISSILFLNV LIISPLFHILQPLSDLTIGKLTELRKLILENIDNQLKSNQTPLHELPFSTYLALKNRKDNGSKRQ LYNKIHELFLTSGHTISVQLENMICFLAVLPDIQERAWQEQYEIFGNDIRDPTIDDLNQMNYL DRFLKESYRFLKVPLLARMATADINVDGITIPSGTVVIYLMGYMKFLPKYWENPYIFDPDRFL EESDLLKCISSPFGFGIRNCPGEYYATILIKIILSKVLRKLKFRPVQKDFRFEDIKFKSYIFTEAE NPPNLQVEERT >NezVir_CYP3225A5/1-493 SEQ ID NO: 63 MLIEAIIILVATLCASYYWLFGFWNRRNVFNVKFQITFLTFIKVLIKNEHLGNIFADIYKKYKSHG MVGFYILFDPMLLVTNPKLVEEVIVKEFNKFHDTPTEMKKGINPLFALNPFAAKGTEKWKEL RSIQASNMTTFRFKEILPIIYCVAENMVNYLTEMKMEPIAAKELSFLFSVESSCLCGFGVQPN AFTDSENSFIEYSENIFKPSPFTMFCHFLLPWIGNLLKLRILSKDAEESFILFVKTIFEYRSRSN VTKNDFIYYLMKLNQKLKEGNKPEYSNVELAGHCLTYYLDSTQTTSNQLAFFLLDLANHQHV QDKLRKEISSISNSPRDFDLEKVNSIRYLNMAINESLRMHTQGTWISRTCTQDAVIGNTPIPK GTKVFVPVEAFHNDPEWFPSPEKFDPERFSEERKDSIPKYTFLPFGEGPRICVGYKLALLQI RMAVIFLVLNFTILPSSKVDREEIVLENALLPTPGHNAKLKFKPMKCIDQ >NezVir_CYP3225A6/1-496 SEQ ID NO: 64 MIAEAIVVLIITSYLSYIWLFGFWDRRNVFNIKFGFTLQTFPKILIRNEHIQDFFVDLYTKYKSH GIVGFYAMFTPMLLVTDPEIVKTVMVKDFNKFTDTGIEIRKDVDPLFAINPFVAKGIEKWKEL RSIQAANLTAVRFKEIIPTIHRVAESMVDYVREKKMEPITAQKLSFMYTVDNACSCGFGIEPS AFTDTENNFIKYANSDKLFNPSPLTMYCHLFIPAMTSVLKLRILSEEAGDFFDSFVKKMIEYR TSSNITKNDLINHIMKINQKLKEENKPAYTNLELAGHCMTFYVDSTATSASQLTFFLFDLADN PEVQEKLRKEISSISKCPSDFDIEKINSINYLNMAINESIRIHTQATWISRTCTQDSVIANTPIPK GTKVFIPIGQFHKDPEYFPDPNKFDPERFSEENKDSIPKYTFLPFGEGPRICVGFKFALLQIK LAVIFLLLNFTILPSNQEGKEGIVIDNTAFVTPGSSSKLKFKPIIQDISQ >NezVir_CYP3225A7/1-493 SEQ ID NO: 65 MLVEAWLFIALCLSYSWFFGFWDRRKVVNVKFEFTYLTFSRAFIKNEHLHDIFADIYRKYKS YGTVGFYTILSPMLLVTDPELVKDVLVKEFNKFHDTVMEMKKEVDPLLALNPFVAKGMEKW KELRSIQASNMTTVRFKEVIPIMYRVAENMVNYLAEKKMEPIGAKELSFLYTVDNSCSCGFG VEPSAFTDPENNFVKYANSDKIFKPSPYTMLFHFLLPRMANILKLRISSEDAEEFFKSFVQKM IEYRTSSNITKNDFINYIMKLNQKLKEENKPVYSKLELAAHCLTFYADSTETSSNQLAFFLLDL ANHQDVQDKLRKEISSISKSPIDFDLEKVNSINYLNMALNESLRLHTQGNWLSRTCTQDTVI GNAPIPKGTKVFVPIGQFHKDPEYFPDPEKFDPERFSEENKDSIPKYTFLPFGEGPRICVGF KFALLQIRLAVIFLVLNFTILPSNEDGKEEIVLENAPLPTPAPTSKLKFKPINTY >NezVir_CYP3225B7/1-491 SEQ ID NO: 66 MLLEIFIIALSALYLFNWWAHGYWKRKNVFSVPTEFLFGNVRLLLQQKITMYGMYRNFYQKY KEHKIIGFYSFYHPALLVTDPEIIKRILVTDFNSFSNSGSDMNKTLDPIFGLNPFLLKSIPEWKE SRSVQAAHQTQVKLRELVPGFIKVADFMFDFIKNQKNQTIKVLDLATRIMVDFSVLSAFGLEP KSFTDPDFGFLKHACSEKVFASSRWNTIGSIFHPLLIRIFSLRFVTKEAEDFFLHISKTNLEHR LSAKITRNDLFDTIMKSQKKNEGQNNKEKIQAEMVIAANCATFYMDATITSSSVLCFILLELAS HQDIQEKLREEILSVGKKPEDFDFEKINTMTYLQMVFDECMRLHPPVPSLSRTCTKDIVINDI KISKGTKVFISALALHQDPVYYPEPMKFDPERFSEVNKSSRVKYTYLPFGEGPRICVGFKYG TLVVKTATIFILLKYRILASNNAKGSLHDPFEFFLSPKPDATIIFQEL >NezVir_CYP3225B8/1-508 SEQ ID NO: 67 LSSWLKKTSTTSWFNFYNNMLLETIIVLSSVLFIFNWWAYGYWRRRNVYSLPTEFLFGNIKEI IMNQKVMCLKFRDIYEQYKQHRMVGFYSFYKPMLFVSDPEIIKRVLATDFNSFSSNGFTMD KDIDPIMGFNPFTAKTVPLWKELRSIQASNLTALKLKEWPGMVKIGEFMKDYIKNKKSQPVS VFDITTRAAVDSAILFGFGIEPKSFTDSEFSFMKYGTVEHLFSTNYMNTISSFFLPSLSKIFNS RITSKAAEDFFISMTKTNIEHRKTTKITRGDLFDTILKLNKKKLEQGDKAYSNLEMSAHCATFY LDATVTSATVSTFLLLELATHQDIQEKLRREIFLVGKKPEDFDFDKINGIPYLQMVFDESIRIHS PVTVLTRSCTKDTVIEDVKISKGTKVFISSLALHYDPEYYPEPEKFDPERFSENNKESMTKYT FLPFGEGPRICVGLKYGNLFVKTLIAFILLKYRILPTYDQNKVLHDYENFLLVPKSDATIKFEEL >NezVir_CYP3225B9/1-489 SEQ ID NO: 68 MLLEIIILLLSAIFIFNWWAHGYWKKRNVFSIPTEFLFGNTRELVMGQTLMALMFEDIYKKYKK HRMIGFYCFYKPMLFITDPDIVKKIFVTEFNNFSNNGFTVSKEVDPLLGFNPFTAKNSIQWKE LRSIQALNQTPLKLREVVSSLAKIGEFMYDFIKNQKGESIAVLDLTTRAAIDSAVLHGFGIEPK SFTDSEFGFMKHASGDKFFETSSWNIFAALFFPSLNKLHNFRITSKEAEDFFKCVTKTNIDH RQSANITRGDIVDTIIKLNKKKLEQTNKAYTDLEMTAHCATFYLDATVTASMVLAFFLLELAN HIDVQEKLRSEIKSVGNKPEDFDYDKINSIPYLQMVLDETLRMHTPLTVMSRICTRDTVLEDV KICKGTRIFISSIALHNDPEYFPDPEKFEPERFSESNKELMTKYTFLPFGEGPRICVGMKYATI FVKTIIAFILLKYRILPSGDKNTSLNEYDSFLLIVKPDAAVKLEEL >NezVir_CYP3225B10/1-488 SEQ ID NO: 69 MLLEIIVLLASFLLIFNWWGHGYWKRRNVFSIPKLFLFGNFWQLVMGQKVSLMFCDIYKKYK KHRVVGFYCFYKPMLLISDPEIIKRVLVIDFNSFSDNGFVVDKDIDPLFGYNPFTAKTIPLWKE LRSIQAANQTPLKLKEVVPSLANIKEFMYDFIKNQKNQPIEVSDLTLRAAIDSAVLNGFGIEPK SFTDPEFSFMTHASGEKLFEATFVTMISAFFFPLINRLFSLRMTSKEAEEFFVSMAKTNIDYR QSAKITRSDLFDTIMKLNQKKLEQGNKAYSALEMSSHCASFYMDATITSSAVLSFILLELAYH QDVQDKLRREIFLIGKKPEDLDFDKINSMTYLQMVFDETLRMHPPVMIVSRLCTKDTEIEDVK ISKGTKVFISPFALHYDPEYFPNPEKFDPDRFSDINKESMTKYSFLPFGEGPRICVGMKYANI FVKTSIALILLKYKILPAYDQNESLHDIDHFLLGPKPNAAVKFEEF >NezVir_CYP3226A1/1-513 SEQ ID NO: 70 LIPCTIKLQEVQELQIIMLGLITSLICLVFVAAYIFLKRRYTYWKMLGVAGPEPTMVVGNMKHII SLKFSEPDMMNGWYKEYKNEPYIGYYNFWKPTLFVIDPELIKAITETDFNHFTDHPNFTTET ETDAILDSLFDMKGARWKAKRQIFTKLFSPKKLRELSNILEEQQDSLLGEFEKLLKSTDEVEL MRIMERHVLKILTSFMYSIDSSQNQESHSKLSELSEIFARPPGSSVRRFLFFVVFPSLYHKLK LSAFPRVFWNYFNNFTNELLQSRNDQNVNREDLVALIGKMQKEGLLETDRIGHNEAVGHVF GFLIAGHHTTMTTVSHAIYQLSLHPQIQEKLRTEVDSVLKGKDNITYDSIKQMTYLDGVINETL RLFPLLGVLKRTCTQTYKINDKLTIPKGMDISIPAYSIHTDPEYFPEPEKFIPERFTDAETPPSL FMSFGKGPRMCIGKRFAYISMKSIIAKIISEYIILPGTKTRKPLQFDTSTFFITVHPVGGLHVRL QKRIK >NezVir_CYP3226B4/1-523 SEQ ID NO: 71 MHLWYFRTVQFPYSIGEMFEQSTIIFILFFITAVFCSFLGVCYEYMKRRYRYWSDIGIPGPKP EFIIGNMKESLFMKCTEPEMTDVWYKDYRGNPYIGFYNLLKPSLFIMDPELIRKVTEVDFNHF IDHPSFSEHSGSDVIIYSLFAMKDQVWKVKRPIFSRLFTPKKLREQIEIFNNRYSLLKEEIENK SELRKDTELLKFIGRYILISFSTILYGLDLMKDEKLFEDLEGHSEKFFHPGLHQALMFLFYTAS PDLFNFLRMKTFPRDIWKYFSPFTKELQEHNKRLVNTNGCNLVSLLNQYQDSEPASAIDHP EAVGHIFSFFSASNHTTITTVSYGLFLLGQHPEVQDMLREEVDRVLKRNQNITSENINDMVY LDAVLNETMRLYPLLGVLKRVCTKKYYVDELLTIPEGMDVFIPVQALHMDPEYFPEPEKFHP ERFLGLEKLPSIFMPFGRGPRNCIGLRMAEIAFKIAVARLISDYVILPNPKSTLPIKFDPRSLFIT CMPENGLWVKLQKRETHQ >NezVir_CYP3226B5/1-442 SEQ ID NO: 72 MLDQSTSILISITAVFFVFLGVCYEYLKRRYRYWSDKGIPGPKPIVFIGNMKESLFRKCTEPQ MTDVWYQNYRGSPYIGFYNLLKPSVFLIDPELIRKVTEVDFNHFVDHPPLSGHSGSDAIIDSL FTMNGQHWKDKRSIFSRMFTPKRLREQIEIFNNRYSFLKEEIEKQPGLNKDADLFKFIGRYILI GFSTILYGLDLTKDEKLFEDFERHSEIFLHPGLHTSLMFLFYSASPNLFNLLSMKTFPRDIYHY FSPLTKGLLEQNKKLGYTNSSDLPSLLNQYQDSNPASAIDHPESVGHIFSFLSASNHTTITTI SYGLFLLGQHPEVQDKLRDEVDRVLKDNQDITSENINEMVYLDAVLYETMRMYTLLGVLKRI CTKKYYVDERLTIPEGMEVFIPAQSLHMDPEYFPEPEKFNPERFLGLEKLPSIFMPFGRGPR N >NezVir_CYP3227A1/1-495 SEQ ID NO: 73 MAIVELIFVAFLLSIIHIVQHFRKTMSYWKVRGVKHIPPLPVVGNMLRAFKFDRHFFHVYNKM YHAFPEERMVGMYEFTTATLILRDPELIKTVLVSEFSTFPDRGPIMFNPGCILYWSIFSLGGN KWRAIRSKLLTPFTTGRLKLILPSVTRSCLEFLESGPKELTLDILRQLTLRIFSQTMFGIDIKSE EAEFLENYRGMLSVSKSKVVQQVGLTFFPRFSDFMSFKFMPIHLEKYFRSFLNAILNKKMD DSSWRDDAITILNEMRKRGKVHFHDKEKDMEELFDFNDELAQAQAFLLLFAALEPSSITLMH LAYDLAQSPDSQNKARQEIKALLQKYGGYSWECVKEMKYLNCCLKETLRLHPPLQFLNRV CNKDTELGGVKLDKGTRIVVPLQNLHLDPNYFSDPKKYKPERFLDEKIHQFIYLPFSDGPRIC LGSRFFIMEALTLFAHILEKFELSISKEMKLPLKYEPITVFLTPKINNPVIIHLKKIN >NezVir_CYP3227B1/1-502 SEQ ID NO: 74 MYQIPLALFIITAICGLLYFFISVWSAMIYWKVRGVKHLAPWPIVGNLGALLRLDKHVSYYYDK IYHAFPNERMIGMYEFMTPTLVLRDPELIEQVLVREFSTFPDHGPLLIEDDSLISESVFALTGS GAKWRAVRNKLLTTFTTGKMRAIFPELVASCQALVDKRPKTLIKEDFTAFAVESFMNSMFG TAILPAGKEELVLNCKTVFEGSRYRMFQQYGLTYFTKLSQFFNMTFMANELHNYFSSLMHT LLNQRSELDCGRNDYAQVLVDMKRLKKMVIFSRENSRENQEFDITDDLVIAQAFMFFFAGL DTTTLVMLHLAFDLSQAKDCQETARQEVRNVLKKYGGYSWDSVRDMKYLDACIQETLRLH PSLQFVVRVNDKPTDVAGVKIDKGTRIVIPLQTIHMDPNNFPKPEKYDPGRWLDESTRPNKF THLPFSEGPRVCLGKRFALMEIATLFAHILDNFELTLSPETKVPLIYEPNVFFHSPISKNPIRV DLMKI >NezVir_CYP3227B2/1-513 SEQ ID NO: 75 SGPPTLQGGKSSIQQKMLTLELLTLAVVVGLIHFSIIIWKSMTYWKERGVKHHTPVPIFGNFL SVISFRKHFFHYYDKVYKAFPNERMVGLYEFMTPTLVLRDTQLIEHVLIREFSTFPDHGSFLF EPSSVMYDSIFNMSGIRWRALRNKLLITFTTGKMRSVFPSLSESCLQLLNSNPKTLEREMLS DLAIRTFMESMFGTKILKSAEAEIYTKARKIFEPTWWRYTQQTLLTYFPKLADFLHLTFMPKH LDNYFRSIMNTILNQRVDSMEDRNDYAQVLVQMREQKKLNIYNRENKKVDQTFDVTNDLAI AQAFMFFFAGMDATSLLMLYTAANLAQSKNCQAKAREEIKTVLHKYGGYSWEAVRDMKYI DSCVQETLRMQPSLQFLNRVCDKDTSIDGVKLVKGTRIIIPIHTIQMDPKNFPNPEKFDPERF MEGINDKFAHLPFSDGPRVCLGKRFATMETTTFMAHLLENFELSLSPETKLPLKYQPTALFL TPKATNPIKIDLKRIN >NezVir_CYP3227B3/1-539 SEQ ID NO: 76 MMSESITSMFFKSWEFIQDLIKSDSFGYTTIIISLLVSRMLLTSEFVAFTALWGLLYLCLNIYW AMNYWKIRGVKHFKPWPIVGNMARVLKLEYHLAYYYDEIYNAFPGERMVGMYEFMTPSLV LRDTELIEQVLVKDFSTYPDHGPFLMEPKSILFESVFAMSGIRWRAIRNRLLTTFTTGKMRVI FPQILAPCQSFVKGKPKCLNVEIINELAVKIFMTAMFGINILPTGEEELMINCKRIFEPKATRIL QLIFLTYFPKLSNVLNLKFMPRDLDDYFRSLMNTILDQRENIDFERNDYTKVLVEMRKQEKM NIYNMRNDKVSQTFDMTNEIALSQAFMFFFAGLDTVSLLILHLAFEFSKSKYCQDKARQEVR SVLKKFNGYSWEAVREMKYLEQCILETLRLHPSLQFLVRITDKDTELGGVKIKKNTRIVIPIHS IQMDPKNFTDPNKFDPERFNVENQQNKFAHLPFSDGPRVCLGKRFAIMETATFFAHILDNY ELSLSPQTRLPLQYEPKTLFHTPKVQTSIHVTLNEIRK >NezVir_CYP3227B4/1-497 SEQ ID NO: 77 MTTLTLLVAVVVCCFLYLGLILWKANTYWEVRGVKHFKPWPLVGNLARALKFNRHVSFFYD EIYKAFPTERMVGMYEFLTPTLIIRDPTLVENVLVREFSTYPDHGPLFFEPSSISYESIFTITGI RWRALRNKLLTSFSTGKMKAIFPDIVRSCQSVVDSDPKRLHKDMLHEFAVKSFLNSMFGTN ILPEGEEELMAKSKEVFQGKPQRIIQQIMLTFFPKLGDFLNMKFMPKTLDNYFRNLLNTLVEQ RASANIKRDDYAKVLCDMNKMGKMDVYNRENKRIDETFDVTNDLVLAQAFMFFFAGLDTTV LVMLHTALELSLAKSCQEKARQEVRSVLKKYGGYSWEAVRDMKYLDQCIQETLRMHPSLQ FIVRMSDKDTVIDGVKIKKNTRIIIPLHSIQMDPNHFPNPHIFDPERFSVPLSSKFTHLPFSEGP RVCLGKRFATLETATIIAHILDNFELHPSPELKFPLKYEPNALFHSPISNDEISIILKRIM >NezVir_CYP3230A1/1-514 SEQ ID NO: 78 MVDLNQFWISLISIGIPLLIPIIFYLMVQNYKRTSYWKKRNIVYLPATPLFSKNIFDSFLIRYSLL STVYKHGKGNVCCGFFQFRKPALLIRSPHVINLVLNQEFRIFQNKRQSDYTEGNKDPLSQH LLALNGYKWKFLRAKLTPTFTSEKLKSMFSLLEICVQNFLSYIDESKDSPIDIMEICGKLSIDAI ASCAFGLELQCLKNRNHDFIKMGKAAFRPGNWHMFKAHLRTLYPQLFKKFNIRAYGKDVN DFFCSLVSETIRRRRMSGEKRVDFIYLLMKMLEEDEATVTEFNRTSTIKFTDDLIAAQAFSFFI GGYETTSITMSCIFYELACHDEIRQKVQNEIDSNLSSESEISYNDLKSLEYLDMVIKEVLRLHP PAFYTQRICSEDFKIPGSDVTIVKDMEVYIPILELHSDEENFPRPLEFIPERFSRENKSRIPKG SYLPFGDGPRKCIGMRFSLMELKLVMAITMLKYDFHLEKKTPEHINLEEYSRIYKIKNKIFLKF TKRVIS >NezVir_CYP3231A1/1-488 SEQ ID NO: 79 MVCLIRNIWNSVLRRKFYIMAPSVKKNMITALLLFTLFFLLCFQLTKKSLWSQLRIPEVHGIPIV GNLLPVVLKKKSYFETIEDLYKLGEGKDYIGIYNGTQPTLLIRNPDLVEILIKEEAKNFEDRGL CSDLSDPLSLNLFFLKGKLWKWTRAKLRPAFSNIRLKTVFNGIELCTADCVNSFGSSVDIKE VMDEYTCNVIAKNVFCVQDNTGFIENSLKVFSLSGLSGIAVLLRVFIPNFALSIGIKTVPQEIET FYRNAIAKSTRVPGSFLDLMLHLKETEPDFSDDLMVAQFFIFILAGFETTSSALTYALYLLSKN PDAQNKARFEAQKVFKEHGRSIDSLKKLTYLESIINETLRLYPSVTGMFRVAEKPFKLPCGA VLPPGTAISVPIYCLHRDSRFYEDPLKFIPERWEMPQKVFYPFGLGPRLCIGMKFALLEMKIF LSSVILKYNIKLNYATVEPLSFDPTSFFYKAINPILLDFEKTV
[0079] Polynucleotides
[0080] The southern green stink bug pheromone enzyme polypeptides described herein (e.g. the NvFPPS, NvTPS, and cytochrome P450 enzymes) can be encoded by polynucleotides. In some aspects, the NvFPPS enzyme can be encoded by a polynucleotide that has or includes a sequence that is 90-100% identical to SEQ ID NO: 2. In some aspects, the NvTPS enzyme can be encoded by a polynucleotide that has or includes a sequence that is 69-100% identical to SEQ ID NO: 1. One of ordinary skill in the art, based upon at least the polypeptide sequence can generate appropriate polynucleotides capable of encoding said polypeptide sequences using commercially and other wise available software that is capable of determining reading frames, codons, and the like. In some aspects the polynucleotides can be codon optimized. Codon optimization is described in greater detail elsewhere herein. In some aspects, the polynucleotides are codon optimized for expression in a plant cell. The polynucleotides can be naked or included in a vector. Suitable vectors are discussed in greater detail elsewhere herein. The polynucleotide can include one or more modified bases. The modification can modulate (increase or decrease) stability, modulate transcription efficiency, and provide other functionalities. Such modifications that can be applied to the polynucleotides described herein will be appreciated by those of ordinary skill in the art.
[0081] Vectors
[0082] Also provided herein are vectors that can contain one or more of the southern green stink bug pheromone enzymes described herein. In aspects, the vector can contain one or more polynucleotides encoding one or more elements of a southern green stink bug pheromone enzyme or system thereof described herein. The vectors can be useful in producing bacterial, fungal, yeast, plant cells, animal cells, and transgenic animals that can express one or more southern green stink bug pheromone enzymes or systems thereof described herein. Within the scope of this disclosure are vectors containing one or more of the polynucleotide sequences described herein. One or more of the polynucleotides that are part of or can encode one or more of the southern green stink bug pheromone enzymes or systems thereof described herein can be included in a vector or vector system. The vectors and/or vector systems can be used, for example, to express one or more of the polynucleotides in a cell, such as a producer cell, to produce one or more engineered southern green stink bug pheromone enzymes or systems thereof described elsewhere herein. Other uses for the vectors and vector systems described herein are also within the scope of this disclosure. In general, and throughout this specification, the term “vector” refers to a tool that allows or facilitates the transfer of an entity from one environment to another. In some contexts which will be appreciated by those of ordinary skill in the art, “vector” can be a term of art to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. A vector can be a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. Generally, a vector is capable of replication when associated with the proper control elements.
[0083] Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g. circular); nucleic acid molecules that comprise DNA, RNA, or both; and other varieties of polynucleotides known in the art. One type of vector is a “plasmid,” which refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques. Another type of vector is a viral vector, wherein virally-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g. retroviruses, replication defective retroviruses, adenoviruses, replication defective adenoviruses, and adeno-associated viruses (AAVs)). Viral vectors also include polynucleotides carried by a virus for transfection into a host cell. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as “expression vectors.” Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
[0084] Recombinant expression vectors can be composed of a nucleic acid (e.g. a polynucleotide) of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which can be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, “operably linked” and “operatively-linked” are used interchangeably herein and further defined elsewhere herein. In the context of a vector, the term “operably linked” is intended to mean that the nucleotide sequence of interest is linked to the regulatory element(s) in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell). Advantageous vectors include lentiviruses and adeno-associated viruses, and types of such vectors can also be selected for targeting particular types of cells. These and other aspects of the vectors and vector systems are described elsewhere herein.
[0085] In some aspects, the vector can be a bicistronic vector. In some aspects, a bicistronic vector can be used for one or more of the engineered southern green stink bug pheromone enzymes or systems thereof described herein. In some aspects, expression of elements of the engineered southern green stink bug pheromone enzymes or systems thereof described herein can be driven by the beta acting, CAG, CMV or other suitable constitutive, tissue specific, or inducible promoter. Where the element of capable of producing one or more engineered southern green stink bug pheromone enzymes or systems thereof described herein is an RNA, its expression can be driven by a Pol III promoter, such as a U6 promoter. In some aspects, the two are combined.
[0086] Cell-Based Vector Amplification and Expression
[0087] Vectors can be designed for expression of one or more elements of the engineered southern green stink bug pheromone enzymes or systems described herein (e.g. nucleic acid transcripts, proteins, enzymes, and combinations thereof) in a suitable host cell. In some aspects, the suitable host cell is a prokaryotic cell. Suitable host cells include, but are not limited to, bacterial cells, yeast cells, insect cells, and mammalian cells. The vectors can be viral-based or non-viral based. In some aspects, the suitable host cell is a eukaryotic cell. In some aspects, the suitable host cell is a suitable bacterial cell. Suitable bacterial cells include, but are not limited to bacterial cells from the bacteria of the species Escherichia coli. Many suitable strains of E. coli are known in the art for expression of vectors. These include, but are not limited to Pirn, Stbl2, Stbl3, Stbl4, TOP10, XL1 Blue, and XL10 Gold. In some aspects, the host cell is a suitable insect cell. Suitable insect cells include those from Spodoptera frugiperda. Suitable strains of S. frugiperda cells include, but are not limited to Sf9 and Sf21. In some aspects, the host cell is a suitable yeast cell. In some aspects, the yeast cell can be from Saccharomyces cerevisiae. In some aspects, the host cell is a suitable mammalian cell. Many types of mammalian cells have been developed to express vectors. Suitable mammalian cells include, but are not limited to, HEK293, Chinese Hamster Ovary Cells (CHOs), mouse myeloma cells, HeLa, U20S, A549, HT1080, CAD, P19, NIH 3T3, L929, N2a, MCF-7, Y79, SO-Rb50, HepG G2, DIKX-X11, J558L, Baby hamster kidney cells (BHK), and chicken embryo fibroblasts (CEFs). Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990).
[0088] In some aspects, the vector can be a yeast expression vector. Examples of vectors for expression in yeast Saccharomyces cerevisiae include pYepSecl (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kuijan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.). As used herein, a “yeast expression vector” refers to a nucleic acid that contains one or more sequences encoding an RNA and/or polypeptide and may further contain any desired elements that control the expression of the nucleic acid(s), as well as any elements that enable the replication and maintenance of the expression vector inside the yeast cell. Many suitable yeast expression vectors and features thereof are known in the art; for example, various vectors and techniques are illustrated in in Yeast Protocols, 2nd edition, Xiao, W., ed. (Humana Press, New York, 2007) and Buckholz, R. G. and Gleeson, M. A. (1991) Biotechnology (NY) 9(11): 1067-72. Yeast vectors can contain, without limitation, a centromeric (CEN) sequence, an autonomous replication sequence (ARS), a promoter, such as an RNA Polymerase III promoter, operably linked to a sequence or gene of interest, a terminator such as an RNA polymerase III terminator, an origin of replication, and a marker gene (e.g., auxotrophic, antibiotic, or other selectable markers). Examples of expression vectors for use in yeast may include plasmids, yeast artificial chromosomes, 2p plasmids, yeast integrative plasmids, yeast replicative plasmids, shuttle vectors, and episomal plasmids.
[0089] In some aspects, the vector is a baculovirus vector or expression vector and can be suitable for expression of polynucleotides and/or proteins in insect cells. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39). rAAV (recombinant Adeno-associated viral) vectors are preferably produced in insect cells, e.g., Spodoptera frugiperda Sf9 insect cells, grown in serum-free suspension culture. Serum-free insect cells can be purchased from commercial vendors, e.g., Sigma Aldrich (EX-CELL 405).
[0090] In some embodiments, the vector is a mammalian expression vector. In some aspects, the mammalian expression vector is capable of expressing one or more polynucleotides and/or polypeptides in a mammalian cell. Examples of mammalian expression vectors include, but are not limited to, pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195). The mammalian expression vector can include one or more suitable regulatory elements capable of controlling expression of the one or more polynucleotides and/or proteins in the mammalian cell. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art. More detail on suitable regulatory elements are described elsewhere herein.
[0091] For other suitable expression vectors and vector systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et al., MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.
[0092] In some embodiments, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al., 1987. Genes Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and immunoglobulins (Baneiji, et al., 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlund, et al., 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). Developmentally-regulated promoters are also encompassed, e.g., the murine hox promoters (Kessel and Gruss, 1990. Science 249: 374-379) and the α-fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546). With regards to these prokaryotic and eukaryotic vectors, mention is made of U.S. Pat. No. 6,750,059, the contents of which are incorporated by reference herein in their entirety. Other aspects can utilize viral vectors, with regards to which mention is made of U.S. patent application Ser. No. 13/092,085, the contents of which are incorporated by reference herein in their entirety. Tissue-specific regulatory elements are known in the art and in this regard, mention is made of U.S. Pat. No. 7,776,321, the contents of which are incorporated by reference herein in their entirety. In some embodiments, a regulatory element can be operably linked to one or more elements of a southern green stink bug pheromone enzyme or enzyme system so as to drive expression of the one or more elements of the southern green stink bug pheromone enzyme or enzyme system described herein.
[0093] Vectors may be introduced and propagated in a prokaryote or prokaryotic cell. In some aspects, a prokaryote is used to amplify copies of a vector to be introduced into a eukaryotic cell or as an intermediate vector in the production of a vector to be introduced into a eukaryotic cell (e.g. amplifying a plasmid as part of a viral vector packaging system). In some aspects, a prokaryote is used to amplify copies of a vector and express one or more nucleic acids, such as to provide a source of one or more proteins for delivery to a host cell or host organism.
[0094] In some aspects, the vector can be a fusion vector or fusion expression vector. In some aspects, fusion vectors add a number of amino acids to a protein encoded therein, such as to the amino terminus, carboxy terminus, or both of a recombinant protein. Such fusion vectors can serve one or more purposes, such as: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. In some aspects, expression of polynucleotides (such as non-coding polynucleotides) and proteins in prokaryotes can be carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion polynucleotides and/or proteins. In some aspects, the fusion expression vector can include a proteolytic cleavage site, which can be introduced at the junction of the fusion vector backbone or other fusion moiety and the recombinant polynucleotide or protein to enable separation of the recombinant polynucleotide or protein from the fusion vector backbone or other fusion moiety subsequent to purification of the fusion polynucleotide or protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Example fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia, Piscataway, N.J.) that fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein. Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amrann et al., (1988) Gene 69:301-315) and pET 11d (Studier et al., GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89).
[0095] In some embodiments, one or more vectors driving expression of one or more elements of one or more southern green stink bug pheromone enzymes or systems thereof described herein are introduced into a host cell such that expression of the elements of the engineered delivery system described herein direct formation of of one or more southern green stink bug pheromone enzymes or systems thereof described herein. For example, different elements of one or more southern green stink bug pheromone enzymes or systems thereof described herein can each be operably linked to separate regulatory elements on separate vectors. RNA(s) of different elements of the engineered delivery system described herein can be delivered to an animal or mammal or cell thereof to produce an animal or mammal or cell thereof that constitutively or inducibly or conditionally expresses different elements of one or more southern green stink bug pheromone enzymes or systems thereof described herein that incorporates one or more elements of one or more southern green stink bug pheromone enzymes or systems thereof described herein or contains one or more cells that incorporates and/or expresses one or more elements of one or more southern green stink bug pheromone enzymes or systems thereof described herein.
[0096] In some aspects, two or more of the elements expressed from the same or different regulatory element(s), can be combined in a single vector, with one or more southern green stink bug pheromone enzyme and/or enzyme system polynucleotides that are combined in a single vector may be arranged in any suitable orientation, such as one element located 5′ with respect to (“upstream” of) or 3′ with respect to (“downstream” of) a second element. The coding sequence of one element may be located on the same or opposite strand of the coding sequence of a second element, and oriented in the same or opposite direction. In some embodiments, a single promoter drives expression of a transcript encoding one or more engineered southern green stink bug pheromone enzymes, embedded within one or more intron sequences (e.g., each in a different intron, two or more in at least one intron, or all in a single intron). In some embodiments, the engineered southern green stink bug pheromone enzymes polynucleotide(s) can be operably linked to and expressed from the same promoter.
[0097] Vector Features
[0098] The vectors can include additional features that can confer one or more functionalities to the vector, the polynucleotide to be delivered, a virus particle produced there from, or polypeptide expressed thereof. Such features include, but are not limited to, regulatory elements, selectable markers, molecular identifiers (e.g. molecular barcodes), stabilizing elements, and the like. It will be appreciated by those skilled in the art that the design of the expression vector and additional features included can depend on such factors as the choice of the host cell to be transformed, the level of expression desired, etc.
[0099] Regulatory Elements
[0100] In aspects, the polynucleotides and/or vectors thereof described herein (such as the engineered southern green stink bug enzyme polynucleotide(s) described herein) can include one or more regulatory elements that can be operatively linked to the polynucleotide. The term “regulatory element” is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g., transcription termination signals, such as polyadenylation signals and poly-U sequences). Such regulatory elements are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). A tissue-specific promoter can direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g., liver, pancreas), or particular cell types (e.g., lymphocytes). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific. In some embodiments, a vector comprises one or more pol III promoter (e.g., 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g., 1, 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g., 1, 2, 3, 4, 5, or more pol I promoters), or combinations thereof. Examples of pol III promoters include, but are not limited to, U6 and H1 promoters. Examples of pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) (see, e.g., Boshart et al, Cell, 41:521-530 (1985)), the SV40 promoter, the dihydrofolate reductase promoter, the β-actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EF1α promoter. Also encompassed by the term “regulatory element” are enhancer elements, such as WPRE; CMV enhancers; the R-U5′ segment in LTR of HTLV-1 (Mol. Cell. Biol., Vol. 8(1), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit β-globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31, 1981).
[0101] In some aspects, the regulatory sequence can be a regulatory sequence described in U.S. Pat. No. 7,776,321, U.S. Pat. Pub. No. 2011/0027239, and PCT publication WO 2011/028929, the contents of which are incorporated by reference herein in their entirety. In some aspects, the vector can contain a minimal promoter. In some aspects, the minimal promoter is the Mecp2 promoter, tRNA promoter, or U6. In a further embodiment, the minimal promoter is tissue specific. In some aspects, the length of the vector polynucleotide the minimal promoters and polynucleotide sequences is less than 4.4 Kb.
[0102] To express a polynucleotide, the vector can include one or more transcriptional and/or translational initiation regulatory sequences, e.g. promoters, that direct the transcription of the gene and/or translation of the encoded protein in a cell. In some aspects a constitutive promoter may be employed. Suitable constitutive promoters for mammalian cells are generally known in the art and include, but are not limited to SV40, CAG, CMV, EF-1α, β-actin, RSV, and PGK. Suitable constitutive promoters for bacterial cells, yeast cells, and fungal cells are generally known in the art, such as a T-7 promoter for bacterial expression and an alcohol dehydrogenase promoter for expression in yeast.
[0103] In some aspects, the regulatory element can be a regulated promoter. “Regulated promoter” refers to promoters that direct gene expression not constitutively, but in a temporally- and/or spatially-regulated manner, and includes tissue-specific, tissue-preferred and inducible promoters. Regulated promoters include conditional promoters and inducible promoters. In some aspects, conditional promoters can be employed to direct expression of a polynucleotide in a specific cell type, under certain environmental conditions, and/or during a specific state of development. Suitable tissue specific promoters can include, but are not limited to, liver specific promoters (e.g. APOA2, SERPIN A1 (hAAT), CYP3A4, and MIR122), pancreatic cell promoters (e.g. INS, IRS2, Pdx1, AIx3, Ppy), cardiac specific promoters (e.g. Myh6 (alpha MHC), MYL2 (MLC-2v), TNI3 (cTnl), NPPA (ANF), Slc8a1 (Ncx1)), central nervous system cell promoters (SYN1, GFAP, INA, NES, MOBP, MBP, TH, FOXA2 (HNF3 beta)), skin cell specific promoters (e.g. FLG, K14, TGM3), immune cell specific promoters, (e.g. ITGAM, CD43 promoter, CD14 promoter, CD45 promoter, CD68 promoter), urogenital cell specific promoters (e.g. Pbsn, Upk2, Sbp, Fer114), endothelial cell specific promoters (e.g. ENG), pluripotent and embryonic germ layer cell specific promoters (e.g. Oct4, NANOG, Synthetic Oct4, T brachyury, NES, SOX17, FOXA2, MIR122), and muscle cell specific promoter (e.g. Desmin). Other tissue and/or cell specific promoters are generally known in the art and are within the scope of this disclosure.
[0104] Inducible/conditional promoters can be positively inducible/conditional promoters (e.g. a promoter that activates transcription of the polynucleotide upon appropriate interaction with an activated activator, or an inducer (compound, environmental condition, or other stimulus) or a negative/conditional inducible promoter (e.g. a promoter that is repressed (e.g. bound by a repressor) until the repressor condition of the promotor is removed (e.g. inducer binds a repressor bound to the promoter stimulating release of the promoter by the repressor or removal of a chemical repressor from the promoter environment). The inducer can be a compound, environmental condition, or other stimulus. Thus, inducible/conditional promoters can be responsive to any suitable stimuli such as chemical, biological, or other molecular agents, temperature, light, and/or pH. Suitable inducible/conditional promoters include, but are not limited to, Tet-On, Tet-Off, Lac promoter, pBad, AlcA, LexA, Hsp70 promoter, Hsp90 promoter, pDawn, XVE/OlexA, GVG, and pOp/LhGR.
[0105] Where expression in a plant cell is desired, the components of the one or more engineered southern green stink bug pheromone enzymes described herein are typically placed under control of a plant promoter, i.e. a promoter operable in plant cells. The use of different types of promoters is envisaged.
[0106] A constitutive plant promoter is a promoter that is able to express the open reading frame (ORF) that it controls in all or nearly all of the plant tissues during all or nearly all developmental stages of the plant (referred to as “constitutive expression”). One non-limiting example of a constitutive promoter is the cauliflower mosaic virus 35S promoter. Different promoters may direct the expression of a gene in different tissues or cell types, or at different stages of development, or in response to different environmental conditions. In particular embodiments, one or more of the engineered southern green stink bug pheromone enzymes are expressed under the control of a constitutive promoter, such as the cauliflower mosaic virus 35S promoter issue-preferred promoters can be utilized to target enhanced expression in certain cell types within a particular plant tissue, for instance vascular cells in leaves or roots or in specific cells of the seed. Examples of particular promoters for use in the expression of one or more of the engineered southern green stink bug enzymes and systems thereof are found in Kawamata et al., (1997) Plant Cell Physiol 38:792-803; Yamamoto et al., (1997) Plant J 12:255-65; Hire et al, (1992) Plant Mol Biol 20:207-18, Kuster et al, (1995) Plant Mol Biol 29:759-72, and Capana et al., (1994) Plant Mol Biol 25:681-91.
[0107] Examples of promoters that are inducible and that can allow for spatiotemporal control of gene editing or gene expression may use a form of energy. The form of energy may include but is not limited to sound energy, electromagnetic radiation, chemical energy and/or thermal energy. Examples of inducible systems include tetracycline inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid transcription activations systems (FKBP, ABA, etc), or light inducible systems (Phytochrome, LOV domains, or cryptochrome)., such as a Light Inducible Transcriptional Effector (LITE) that direct changes in transcriptional activity in a sequence-specific manner. The components of a light inducible system may include one or more elements of the one or more engineered southern green stink bug pheromone enzymes and/or systems thereof described herein, a light-responsive cytochrome heterodimer (e.g. from Arabidopsis thaliana), and a transcriptional activation/repression domain. In some aspects, the vector can include one or more of the inducible DNA binding proteins provided in PCT publication WO 2014/018423 and US Publications, 2015/0291966, 2017/0166903, 2019/0203212, which describe e.g. aspects of inducible DNA binding proteins and methods of use and can be adapted for use with the present invention.
[0108] In some aspects, transient or inducible expression can be achieved by including, for example, chemical-regulated promotors, i.e. whereby the application of an exogenous chemical induces gene expression. Modulation of gene expression can also be obtained by including a chemical-repressible promoter, where application of the chemical represses gene expression. Chemical-inducible promoters include, but are not limited to, the maize In2-2 promoter, activated by benzene sulfonamide herbicide safeners (De Veylder et al., (1997) Plant Cell Physiol 38:568-77), the maize GST promoter (GST-II-27, WO93/01294), activated by hydrophobic electrophilic compounds used as pre-emergent herbicides, and the tobacco PR-1 a promoter (Ono et al., (2004) Biosci Biotechnol Biochem 68:803-7) activated by salicylic acid. Promoters which are regulated by antibiotics, such as tetracycline-inducible and tetracycline-repressible promoters (Gatz et al., (1991) Mol Gen Genet 227:229-37; U.S. Pat. Nos. 5,814,618 and 5,789,156) can also be used herein.
[0109] In some aspects, the vector or system thereof can include one or more elements capable of translocating and/or expressing one or more engineered to/in a specific cell component or organelle. Such organelles can include, but are not limited to, nucleus, ribosome, endoplasmic reticulum, golgi apparatus, chloroplast, mitochondria, vacuole, lysosome, cytoskeleton, plasma membrane, cell wall, peroxisome, centrioles, etc.
[0110] Selectable Markers and Tags
[0111] One or more of the engineered southern green stink bug enzyme polynucleotides can be can be operably linked, fused to, or otherwise modified to include a polynucleotide that encodes or is a selectable marker or tag, which can be a polynucleotide or polypeptide. In some aspects, the polypeptide encoding a polypeptide selectable marker can be incorporated in the engineered southern green stink bug enzyme polynucleotide such that the selectable marker polypeptide, when translated, is inserted between two amino acids between the N- and C-terminus of the engineered southern green stink bug enzyme polypeptide or at the N- and/or C-terminus of the engineered southern green stink bug enzyme polypeptide. In some aspects, the selectable marker or tag is a polynucleotide barcode or unique molecular identifier (UMI).
[0112] It will be appreciated that the polynucleotide encoding such selectable markers or tags can be incorporated into a polynucleotide encoding one or more components of one or more of the engineered southern green stink bug enzymes or systems thereof described herein in an appropriate manner to allow expression of the selectable marker or tag. Such techniques and methods are described elsewhere herein and will be instantly appreciated by one of ordinary skill in the art in view of this disclosure. Many such selectable markers and tags are generally known in the art and are intended to be within the scope of this disclosure.
[0113] Suitable selectable markers and tags include, but are not limited to, affinity tags, such as chitin binding protein (CBP), maltose binding protein (MBP), glutathione-S-transferase (GST), poly(His) tag; solubilization tags such as thioredoxin (TRX) and poly(NANP), MBP, and GST; chromatography tags such as those consisting of polyanionic amino acids, such as FLAG-tag; epitope tags such as V5-tag, Myc-tag, HA-tag and NE-tag; protein tags that can allow specific enzymatic modification (such as biotinylation by biotin ligase) or chemical modification (such as reaction with FlAsH-EDT2 for fluorescence imaging), DNA and/or RNA segments that contain restriction enzyme or other enzyme cleavage sites; DNA segments that encode products that provide resistance against otherwise toxic compounds including antibiotics, such as, spectinomycin, ampicillin, kanamycin, tetracycline, Basta, neomycin phosphotransferase II (NEO), hygromycin phosphotransferase (HPT)) and the like; DNA and/or RNA segments that encode products that are otherwise lacking in the recipient cell (e.g., tRNA genes, auxotrophic markers); DNA and/or RNA segments that encode products which can be readily identified (e.g., phenotypic markers such as β-galactosidase, GUS; fluorescent proteins such as green fluorescent protein (GFP), cyan (CFP), yellow (YFP), red (RFP), luciferase, and cell surface proteins); polynucleotides that can generate one or more new primer sites for PCR (e.g., the juxtaposition of two DNA sequences not previously juxtaposed), DNA sequences not acted upon or acted upon by a restriction endonuclease or other DNA modifying enzyme, chemical, etc.; epitope tags (e.g. GFP, FLAG- and His-tags), and, DNA sequences that make a molecular barcode or unique molecular identifier (UMI), DNA sequences required for a specific modification (e.g., methylation) that allows its identification. Other suitable markers will be appreciated by those of skill in the art.
[0114] Selectable markers and tags can be operably linked to one or more components of one or more of the engineered southern green stink bug enzymes or systems thereof described herein via suitable linker, such as a glycine or glycine serine linkers as short as GS or GG up to (GGGGG).sub.3 or (GGGGS).sub.3. Other suitable linkers are described elsewhere herein.
[0115] The vector or vector system can include one or more polynucleotides encoding one or more targeting moieties. In some aspects, the targeting moiety encoding polynucleotides can be included in the vector or vector system, such as a viral vector system, such that they are expressed within and/or on the virus particle(s) produced such that the virus particles can be targeted to specific cells, tissues, organs, etc. In some aspects, the targeting moiety encoding polynucleotides can be included in the vector or vector system such that the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) and/or products expressed therefrom include the targeting moiety and can be targeted to specific cells, tissues, organs, etc. In some aspects, such as non-viral carriers, the targeting moiety can be attached to the carrier (e.g. polymer, lipid, inorganic molecule etc.) and can be capable of targeting the carrier and any attached or associated engineered southern green stink bug enzymes or systems thereof polynucleotide(s) to specific cells, tissues, organs, etc.
[0116] Cell-Free Vector and Polynucleotide Expression
[0117] In some aspects, the polynucleotide encoding one or more features of the one or more of the engineered southern green stink bug enzymes or systems thereof can be expressed from a vector or suitable polynucleotide in a cell-free in vitro system. In other words, the polynucleotide can be transcribed and optionally translated in vitro. In vitro transcription/translation systems and appropriate vectors are generally known in the art and commercially available. Generally, in vitro transcription and in vitro translation systems replicate the processes of RNA and protein synthesis, respectively, outside of the cellular environment. Vectors and suitable polynucleotides for in vitro transcription can include T7, SP6, T3, promoter regulatory sequences that can be recognized and acted upon by an appropriate polymerase to transcribe the polynucleotide or vector.
[0118] In vitro translation can be stand-alone (e.g. translation of a purified polyribonucleotide) or linked/coupled to transcription. In some aspects, the cell-free (or in vitro) translation system can include extracts from rabbit reticulocytes, wheat germ, and/or E. coli. The extracts can include various macromolecular components that are needed for translation of exogenous RNA (e.g. 70S or 80S ribosomes, tRNAs, aminoacyl-tRNA, synthetases, initiation, elongation factors, termination factors, etc.). Other components can be included or added during the translation reaction, including but not limited to, amino acids, energy sources (ATP, GTP), energy regenerating systems (creatine phosphate and creatine phosphokinase (eukaryotic systems)) (phosphoenol pyruvate and pyruvate kinase for bacterial systems), and other co-factors (Mg2+, K+, etc.). As previously mentioned, in vitro translation can be based on RNA or DNA starting material. Some translation systems can utilize an RNA template as starting material (e.g. reticulocyte lysates and wheat germ extracts). Some translation systems can utilize a DNA template as a starting material (e.g. E. coli-based systems). In these systems transcription and translation are coupled and DNA is first transcribed into RNA, which is subsequently translated. Suitable standard and coupled cell-free translation systems are generally known in the art and are commercially available.
[0119] Codon Optimization of Vector Polynucleotides
[0120] As described elsewhere herein, the polynucleotide encoding one or more engineered southern green stink bug enzymes or systems thereof described herein can be codon optimized. In some aspects, one or more polynucleotides contained in a vector (“vector polynucleotides”) described herein that are in addition to an optionally codon optimized polynucleotide encoding engineered southern green stink bug enzymes or systems thereof described herein can be codon optimized. In general, codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g., about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence. Various species exhibit particular bias for certain codons of a particular amino acid. Codon bias (differences in codon usage between organisms) often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, among other things, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the “Codon Usage Database” available at www.kazusa.orjp/codon/and these tables can be adapted in a number of ways. See Nakamura, Y., et al. “Codon usage tabulated from the international DNA sequence databases: status for the year 2000” Nucl. Acids Res. 28:292 (2000). Computer algorithms for codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, Pa.), are also available. In some embodiments, one or more codons (e.g., 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons) in a sequence encoding a DNA/RNA-targeting Cas protein corresponds to the most frequently used codon for a particular amino acid. As to codon usage in yeast, reference is made to the online Yeast Genome database available at http://www.yeastgenome.org/community/codon_usage.shtml, or Codon selection in yeast, Bennetzen and Hall, J Biol Chem. 1982 Mar. 25; 257(6):3026-31. As to codon usage in plants including algae, reference is made to Codon usage in higher plants, green algae, and cyanobacteria, Campbell and Gowri, Plant Physiol. 1990 January; 92(1): 1-11.; as well as Codon usage in plantgenes, Murray et al, Nucleic Acids Res. 1989 Jan. 25; 17(2):477-98; or Selection on the codon bias of chloroplast and cyanelle genes in different plant and algal lineages, Morton B R, J Mol Evol. 1998 April; 46(4):449-59.
[0121] The vector polynucleotide can be codon optimized for expression in a specific cell-type, tissue type, organ type, and/or subject type. In some aspects, a codon optimized sequence is a sequence optimized for expression in a eukaryote, e.g., humans (i.e. being optimized for expression in a human or human cell), or for another eukaryote, such as another animal (e.g. a mammal or avian) as is described elsewhere herein. Such codon optimized sequences are within the ambit of the ordinary skilled artisan in view of the description herein. In some aspects, the polynucleotide is codon optimized for a specific cell type. Such cell types can include, but are not limited to, epithelial cells (including skin cells, cells lining the gastrointestinal tract, cells lining other hollow organs), nerve cells (nerves, brain cells, spinal column cells, nerve support cells (e.g. astrocytes, glial cells, Schwann cells etc.), muscle cells (e.g. cardiac muscle, smooth muscle cells, and skeletal muscle cells), connective tissue cells (fat and other soft tissue padding cells, bone cells, tendon cells, cartilage cells), blood cells, stem cells and other progenitor cells, immune system cells, germ cells, and combinations thereof. Such codon optimized sequences are within the ambit of the ordinary skilled artisan in view of the description herein. In some aspects, the polynucleotide is codon optimized for a specific tissue type. Such tissue types can include, but are not limited to, muscle tissue, connective tissue, connective tissue, nervous tissue, and epithelial tissue. Such codon optimized sequences are within the ambit of the ordinary skilled artisan in view of the description herein. In some aspects, the polynucleotide is codon optimized for a specific organ. Such organs include, but are not limited to, muscles, skin, intestines, liver, spleen, brain, lungs, stomach, heart, kidneys, gallbladder, pancreas, bladder, thyroid, bone, blood vessels, blood, and combinations thereof. Such codon optimized sequences are within the ambit of the ordinary skilled artisan in view of the description herein.
[0122] In some embodiments, a vector polynucleotide is codon optimized for expression in particular cells, such as prokaryotic or eukaryotic cells. The eukaryotic cells may be those of or derived from a particular organism, such as a plant, bacteria, or yeast cell.
[0123] Non-Viral Vectors and Carriers
[0124] In some aspects, the vector is a non-viral vector or carrier. In some aspects, non-viral vectors can have the advantage(s) of reduced toxicity and/or immunogenicity and/or increased bio-safety as compared to viral vectors The terms of art “Non-viral vectors and carriers” and as used herein in this context refers to molecules and/or compositions that are not based on one or more component of a virus or virus genome (excluding any nucleotide to be delivered and/or expressed by the non-viral vector) that can be capable of attaching to, incorporating, coupling, and/or otherwise interacting with an engineered southern green stink bug enzymes or systems thereof polynucleotide described herein and can be capable of ferrying the polynucleotide to a cell and/or expressing the polynucleotide. It will be appreciated that this does not exclude the inclusion of a virus-based polynucleotide that is to be delivered. For example, if a gRNA to be delivered is directed against a virus component and it is inserted or otherwise coupled to an otherwise non-viral vector or carrier, this would not make said vector a “viral vector”. Non-viral vectors and carriers include naked polynucleotides, chemical-based carriers, polynucleotide (non-viral) based vectors, and particle-based carriers. It will be appreciated that the term “vector” as used in the context of non-viral vectors and carriers refers to polynucleotide vectors and “carriers” used in this context refers to a non-nucleic acid or polynucleotide molecule or composition that be attached to or otherwise interact with a polynucleotide to be delivered, such as an engineered southern green stink bug enzymes or systems thereof polynucleotide(s) of the present invention.
[0125] Naked Polynucleotides
[0126] In some aspects, one or more engineered southern green stink bug enzymes or systems thereof polynucleotide(s) described elsewhere herein can be included in a naked polynucleotide. The term of art “naked polynucleotide” as used herein refers to polynucleotides that are not associated with another molecule (e.g. proteins, lipids, and/or other molecules) that can often help protect it from environmental factors and/or degradation. As used herein, associated with includes, but is not limited to, linked to, adhered to, adsorbed to, enclosed in, enclosed in or within, mixed with, and the like. Naked polynucleotides that include one or more of the engineered southern green stink bug enzymes or systems thereof polynucleotides described herein can be delivered directly to a host cell and optionally expressed therein. The naked polynucleotides can have any suitable two- and three-dimensional configurations. By way of non-limiting examples, naked polynucleotides can be single-stranded molecules, double stranded molecules, circular molecules (e.g. plasmids and artificial chromosomes), molecules that contain portions that are single stranded and portions that are double stranded (e.g. ribozymes), and the like. In some aspects, the naked polynucleotide contains only the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) of the present invention. In some aspects, the naked polynucleotide can contain other nucleic acids and/or polynucleotides in addition to the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) of the present invention. The naked polynucleotides can include one or more elements of a transposon system. Transposons and system thereof are described in greater detail elsewhere herein.
[0127] Non-Viral Polynucleotide Vectors
[0128] In some aspects, one or more of the engineered southern green stink bug enzymes or systems thereof polynucleotides can be included in a non-viral polynucleotide vector. Suitable non-viral polynucleotide vectors include, but are not limited to, transposon vectors and vector systems, plasmids, bacterial artificial chromosomes, yeast artificial chromosomes, AR (antibiotic resistance)-free plasmids and miniplasmids, circular covalently closed vectors (e.g. minicircles, minivectors, miniknots,), linear covalently closed vectors (“dumbbell shaped”), MIDGE (minimalistic immunologically defined gene expression) vectors, MiLV (micro-linear vector) vectors, Ministrings, mini-intronic plasmids, PSK systems (post-segregationally killing systems), ORT (operator repressor titration) plasmids, and the like. See e.g. Hardee et al. 2017. Genes. 8(2):65.
[0129] In some aspects, the non-viral polynucleotide vector can have a conditional origin of replication. In some aspects, the non-viral polynucleotide vector can be an ORT plasmid. In some aspects, the non-viral polynucleotide vector can have a minimalistic immunologically defined gene expression. In some aspects, the non-viral polynucleotide vector can have one or more post-segregationally killing system genes. In some aspects, the non-viral polynucleotide vector is AR-free. In some aspects, the non-viral polynucleotide vector is a minivector. In some aspects, the non-viral polynucleotide vector includes a nuclear localization signal. In some aspects, the non-viral polynucleotide vector can include one or more CpG motifs. In some aspects, the non-viral polynucleotide vectors can include one or more scaffold/matrix attachment regions (S/MARs). See e.g. Mirkovitch et al. 1984. Cell. 39:223-232, Wong et al. 2015. Adv. Genet. 89:113-152, whose techniques and vectors can be adapted for use in the present invention. S/MARs are AT-rich sequences that play a role in the spatial organization of chromosomes through DNA loop base attachment to the nuclear matrix. S/MARs are often found close to regulatory elements such as promoters, enhancers, and origins of DNA replication. Inclusion of one or S/MARs can facilitate a once-per-cell-cycle replication to maintain the non-viral polynucleotide vector as an episome in daughter cells. In aspects, the S/MAR sequence is located downstream of an actively transcribed polynucleotide (e.g. one or more engineered southern green stink bug enzymes or systems thereof polynucleotides) included in the non-viral polynucleotide vector. In some aspects, the S/MAR can be a S/MAR from the beta-interferon gene cluster. See e.g. Verghese et al. 2014. Nucleic Acid Res. 42:e53; Xu et al. 2016. Sci. China Life Sci. 59:1024-1033; Jin et al. 2016. 8:702-711; Koirala et al. 2014. Adv. Exp. Med. Biol. 801:703-709; and Nehlsen et al. 2006. Gene Ther. Mol. Biol. 10:233-244, whose techniques and vectors can be adapted for use in the present invention.
[0130] In some aspects, the non-viral vector is a transposon vector or system thereof. As used herein, “transposon” (also referred to as transposable element) refers to a polynucleotide sequence that is capable of moving form location in a genome to another. There are several classes of transposons. Transposons include retrotransposons and DNA transposons. Retrotransposons require the transcription of the polynucleotide that is moved (or transposed) in order to transpose the polynucleotide to a new genome or polynucleotide. DNA transposons are those that do not require reverse transcription of the polynucleotide that is moved (or transposed) in order to transpose the polynucleotide to a new genome or polynucleotide. In some aspects, the non-viral polynucleotide vector can be a retrotransposon vector. In some aspects, the retrotransposon vector includes long terminal repeats. In some aspects, the retrotransposon vector does not include long terminal repeats. In some aspects, the non-viral polynucleotide vector can be a DNA transposon vector. DNA transposon vectors can include a polynucleotide sequence encoding a transposase. In some aspects, the transposon vector is configured as a non-autonomous transposon vector, meaning that the transposition does not occur spontaneously on its own. In some of these aspects, the transposon vector lacks one or more polynucleotide sequences encoding proteins required for transposition. In some aspects, the non-autonomous transposon vectors lack one or more Ac elements.
[0131] In some aspects a non-viral polynucleotide transposon vector system can include a first polynucleotide vector that contains the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) of the present invention flanked on the 5′ and 3′ ends by transposon terminal inverted repeats (TIRs) and a second polynucleotide vector that includes a polynucleotide capable of encoding a transposase coupled to a promoter to drive expression of the transposase. When both are expressed in the same cell the transposase can be expressed from the second vector and can transpose the material between the TIRs on the first vector (e.g. the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) of the present invention) and integrate it into one or more positions in the host cell's genome. In some aspects the transposon vector or system thereof can be configured as a gene trap. In some aspects, the TIRs can be configured to flank a strong splice acceptor site followed by a reporter and/or other gene (e.g. one or more of the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) of the present invention) and a strong poly A tail. When transposition occurs while using this vector or system thereof, the transposon can insert into an intron of a gene and the inserted reporter or other gene can provoke a mis-splicing process and as a result it in activates the trapped gene.
[0132] Any suitable transposon system can be used. Suitable transposon and systems thereof can include, Sleeping Beauty transposon system (Tc1/mariner superfamily) (see e.g. Ivics et al. 1997. Cell. 91(4): 501-510), piggyBac (piggyBac superfamily) (see e.g. Li et al. 2013 110(25): E2279-E2287 and Yusa et al. 2011. PNAS. 108(4): 1531-1536), Tol2 (superfamily hAT), Frog Prince (Tc1/mariner superfamily) (see e.g. Miskey et al. 2003 Nucleic Acid Res. 31(23):6873-6881) and variants thereof.
[0133] Chemical Carriers
[0134] In some aspects the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) can be coupled to a chemical carrier. Chemical carriers that can be suitable for delivery of polynucleotides can be broadly classified into the following classes: (i) inorganic particles, (ii) lipid-based, (iii) polymer-based, and (iv) peptide based. They can be categorized as (1) those that can form condensed complexes with a polynucleotide (such as the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) of the present invention), (2) those capable of targeting specific cells, (3) those capable of increasing delivery of the polynucleotide (such as the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) of the present invention) to the nucleus or cytosol of a host cell, (4) those capable of disintegrating from DNA/RNA in the cytosol of a host cell, and (5) those capable of sustained or controlled release. It will be appreciated that any one given chemical carrier can include features from multiple categories. The term “particle” as used herein, refers to any suitable sized particles for delivery of the engineered southern green stink bug enzymes or systems thereof components described herein. Suitable sizes include macro-micro-, and nano-sized particles.
[0135] In some aspects, the non-viral carrier can be an inorganic particle. In some aspects, the inorganic particle, can be a nanoparticle. The inorganic particles can be configured and optimized by varying size, shape, and/or porosity. In some aspects, the inorganic particles are optimized to escape from the reticulo endothelial system. In some aspects, the inorganic particles can be optimized to protect an entrapped molecule from degredation., the Suitable inorganic particles that can be used as non-viral carriers in this context can include, but are not limited to, calcium phosphate, silica, metals (e.g. gold, platinum, silver, palladium, rhodium, osmium, iridium, ruthenium, mercury, copper, rhenium, titanium, niobium, tantalum, and combinations thereof), magnetic compounds, poarticles, and materials, (e.g. supermagnetic iron oxide and magnetite), quantum dots, fullerenes (e.g. carbon nanoparticles, nanotubes, nanostrings, and the like), and combinations thereof. Other suitable inorganic non-viral carriers are discussed elsewhere herein.
[0136] In some aspects, the non-viral carrier can be lipid-based. Suitable lipid-based carriers are also described in greater detail herein. In some aspects, the lipid-based carrier includes a cationic lipid or an amphiphilic lipid that is capable of binding or otherwise interacting with a negative charge on the polynucleotide to be delivered (e.g. such as an engineered southern green stink bug enzymes or systems thereof polynucleotide(s). In some aspects, chemical non-viral carrier systems can include a polynucleotide such as the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) of the present invention) and a lipid (such as a cationic lipid). These are also referred to in the art as lipoplexes. Other aspects of lipoplexes are described elsewhere herein. In some aspects, the non-viral lipid-based carrier can be a lipid nano emulsion. Lipid nano emulsions can be formed by the dispersion of an immisicible liquid in another stabilized emulsifying agent and can have particles of about 200 nm that are composed of the lipid, water, and surfactant that can contain the polynucleotide to be delivered (e.g. the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) of the present invention). In some aspects, the lipid-based non-viral carrier can be a solid lipid particle or nanoparticle.
[0137] In some aspects, the non-viral carrier can be peptide-based. In some aspects, the peptide-based non-viral carrier can include one or more cationic amino acids. In some aspects, 35 to 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 99 or 100% of the amino acids are cationic. In some aspects, peptide carriers can be used in conjunction with other types of carriers (e.g. polymer-based carriers and lipid-based carriers to functionalize these carriers). In some aspects, the functionalization is targeting a host cell. Suitable polymers that can be included in the polymer-based non-viral carrier can include, but are not limited to, polyethylenimine (PEI), chitosan, poly (DL-lactide) (PLA), poly (DL-Lactide-co-glycoside) (PLGA), dendrimers (see e.g. US Pat. Pub. 2017/0079916 whose techniques and compositions can be adapted for use with the engineered southern green stink bug enzymes or systems thereof polynucleotide(s), polymethacrylate, and combinations thereof.
[0138] In some aspects, the non-viral carrier can be configured to release an engineered delivery system polynucleotide that is associated with or attached to the non-viral carrier in response to an external stimulus, such as pH, temperature, osmolarity, concentration of a specific molecule or composition (e.g. calcium, NaCl, and the like), pressure and the like. In some aspects, the non-viral carrier can be a particle that is configured includes one or more of the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) describe herein and a environmental triggering agent response element, and optinally a triggering agent. In some aspects, the particle can include a polymer that can be selected from the group of polymethacrylates and polyacrylates. In some aspects, the non-viral particle can include one or more aspects of the compositions microparticles described in US Pat. Pubs. 20150232883 and 20050123596, whose techniques and compositions can be adapted for use in the present invention.
[0139] In some aspects, the non-viral carrier can be a polymer-based carrier. In some aspects, the polymer is cationic or is predominantly cationic such that it can interact in a charge-dependent manner with the negatively charged polynucleotide to be delivered (such as the engineered southern green stink bug enzymes or systems thereof polynucleotide(s) described herein). Polymer-based systems are described in greater detail elsewhere herein.
[0140] Viral Vectors
[0141] In some aspects, the vector is a viral vector. The term of art “viral vector” and as used herein in this context refers to polynucleotide based vectors that contain one or more elements from or based upon one or more elements of a virus that can be capable of expressing and packaging a polynucleotide, such as an engineered southern green stink bug enzymes or systems thereof polynucleotide(s) described herein, into a virus particle and producing said virus particle when used alone or with one or more other viral vectors (such as in a viral vector system). Viral vectors and systems thereof can be used for producing viral particles for delivery of and/or expression of one or more components of the engineered southern green stink bug enzymes or systems thereof described herein. The viral vector can be part of a viral vector system involving multiple vectors. In some aspects, systems incorporating multiple viral vectors can increase the safety of these systems. Suitable viral vectors can include retroviral-based vectors, lentiviral-based vectors, adenoviral-based vectors, adeno associated vectors, helper-dependent adenoviral (HdAd) vectors, hybrid adenoviral vectors, herpes simplex virus-based vectors, poxvirus-based vectors, and Epstein-Barr virus-based vectors. Other aspects of viral vectors and viral particles produce therefrom are described elsewhere herein. In some aspects, the viral vectors are configured to produce replication incompetent viral particles for improved safety of these systems.
[0142] Retroviral and Lentiviral Vectors
[0143] Retroviral vectors can be composed of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression. Suitable retroviral vectors for the one or more engineered southern green stink bug enzymes or systems thereof polynucleotide(s) can include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian immunodeficiency virus (SIV), human immunodeficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J. Virol. 66:1635-1640 (1992); Sommnerfelt et al., Virol. 176:58-59 (1990); Wilson et al., J. Virol. 63:2374-2378 (1989); Miller et al., J. Virol. 65:2220-2224 (1991); PCT/US94/05700). Selection of a retroviral gene transfer system may therefore depend on the target tissue.
[0144] The tropism of a retrovirus can be altered by incorporating foreign envelope proteins, expanding the potential target population of target cells. Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and are described in greater detail elsewhere herein. A retrovirus can also be engineered to allow for conditional expression of the inserted transgene, such that only certain cell types are infected by the lentivirus.
[0145] Lentiviruses are complex retroviruses that have the ability to infect and express their genes in both mitotic and post-mitotic cells. Advantages of using a lentiviral approach can include the ability to transduce or infect non-dividing cells and their ability to typically produce high viral titers, which can increase efficiency or efficacy of production and delivery. Suitable lentiviral vectors include, but are not limited to, human immunodeficiency virus (HIV)-based lentiviral vectors, feline immunodeficiency virus (FIV)-based lentiviral vectors, simian immunodeficiency virus (SIV)-based lentiviral vectors, Moloney Murine Leukaemia Virus (Mo-MLV), Visna.maedi virus (VMV)-based lentiviral vector, carpine arthritis-encephalitis virus (CAEV)-based lentiviral vector, bovine immune deficiency virus (BIV)-based lentiviral vector, and Equine infectious anemia (EIAV)-based lentiviral vector. In some embodiments, an HIV-based lentiviral vector system can be used. In some embodiments, a FIV-based lentiviral vector system can be used.
[0146] In some aspects, the lentiviral vector is an EIAV-based lentiviral vector or vector system. EIAV vectors have been used to mediate expression, packaging, and/or delivery in other contexts, such as for ocular gene therapy (see, e.g., Balagaan, J Gene Med 2006; 8: 275-285). In another embodiment, RetinoStat@, (see, e.g., Binley et al., HUMAN GENE THERAPY 23:980-991 (September 2012)), which describes RetinoStat@, an equine infectious anemia virus-based lentiviral gene therapy vector that expresses angiostatic proteins endostatin and angiostatin that is delivered via a subretinal injection for the treatment of the wet form of age-related macular degeneration. Any of these vectors described in these publications can be modified for the engineered southern green stink bug enzymes or systems thereof described herein.
[0147] In some aspects, the lentiviral vector or vector system thereof can be a first-generation lentiviral vector or vector system thereof. First-generation lentiviral vectors can contain a large portion of the lentivirus genome, including the gag and pol genes, other additional viral proteins (e.g. VSV-G) and other accessory genes (e.g. vif, vprm vpu, nef, and combinations thereof), regulatory genes (e.g. tat and/or rev) as well as the gene of interest between the LTRs. First generation lentiviral vectors can result in the production of virus particles that can be capable of replication in vivo, which may not be appropriate for some instances or applications.
[0148] In some aspects, the lentiviral vector or vector system thereof can be a second-generation lentiviral vector or vector system thereof. Second-generation lentiviral vectors do not contain one or more accessory virulence factors and do not contain all components necessary for virus particle production on the same lentiviral vector. This can result in the production of a replication-incompetent virus particle and thus increase the safety of these systems over first-generation lentiviral vectors. In some aspects, the second-generation vector lacks one or more accessory virulence factors (e.g. vif, vprm, vpu, nef, and combinations thereof). Unlike the first-generation lentiviral vectors, no single second generation lentiviral vector includes all features necessary to express and package a polynucleotide into a virus particle. In some aspects, the envelope and packaging components are split between two different vectors with the gag, pol, rev, and tat genes being contained on one vector and the envelope protein (e.g. VSV-G) are contained on a second vector. The gene of interest, its promoter, and LTRs can be included on a third vector that can be used in conjunction with the other two vectors (packaging and envelope vectors) to generate a replication-incompetent virus particle.
[0149] In some aspects, the lentiviral vector or vector system thereof can be a third-generation lentiviral vector or vector system thereof. Third-generation lentiviral vectors and vector systems thereof have increased safety over first- and second-generation lentiviral vectors and systems thereof because, for example, the various components of the viral genome are split between two or more different vectors but used together in vitro to make virus particles, they can lack the tat gene (when a constitutively active promoter is included up-stream of the LTRs), and they can include one or more deletions in the 3′LTR to create self-inactivating (SIN) vectors having disrupted promoter/enhancer activity of the LTR. In some aspects, a third-generation lentiviral vector system can include (i) a vector plasmid that contains the polynucleotide of interest and upstream promoter that are flanked by the 5′ and 3′ LTRs, which can optionally include one or more deletions present in one or both of the LTRs to render the vector self-inactivating; (ii) a “packaging vector(s)” that can contain one or more genes involved in packaging a polynucleotide into a virus particle that is produced by the system (e.g. gag, pol, and rev) and upstream regulatory sequences (e.g. promoter(s)) to drive expression of the features present on the packaging vector, and (iii) an “envelope vector” that contains one or more envelope protein genes and upstream promoters. In aspects, the third-generation lentiviral vector system can include at least two packaging vectors, with the gag-pol being present on a different vector than the rev gene.
[0150] In some aspects, self-inactivating lentiviral vectors with an siRNA targeting a common exon shared by HIV tat/rev, a nucleolar-localizing TAR decoy, and an anti-CCR5-specific hammerhead ribozyme (see, e.g., DiGiusto et al. (2010) Sci Transl Med 2:36ra43) can be used/and or adapted to the engineered southern green stink bug enzymes or systems thereof described herein.
[0151] In some aspects, the pseudotype and infectivity or tropisim of a lentivirus particle can be tuned by altering the type of envelope protein(s) included in the lentiviral vector or system thereof. As used herein, an “envelope protein” or “outer protein” means a protein exposed at the surface of a viral particle that is not a capsid protein. For example, envelope or outer proteins typically comprise proteins embedded in the envelope of the virus. In some aspects, a lentiviral vector or vector system thereof can include a VSV-G envelope protein. VSV-G mediates viral attachment to an LDL receptor (LDLR) or an LDLR family member present on a host cell, which triggers endocytosis of the viral particle by the host cell. Because LDLR is expressed by a wide variety of cells, viral particles expressing the VSV-G envelope protein can infect or transduce a wide variety of cell types. Other suitable envelope proteins can be incorporated based on the host cell that a user desires to be infected by a virus particle produced from a lentiviral vector or system thereof described herein and can include, but are not limited to, feline endogenous virus envelope protein (RD114) (see e.g. Hanawa et al. Molec. Ther. 2002 5(3) 242-251), modified Sindbis virus envelope proteins (see e.g. Morizono et al. 2010. J. Virol. 84(14) 6923-6934; Morizono et al. 2001. J. Virol. 75:8016-8020; Morizono et al. 2009. J. Gene Med. 11:549-558; Morizono et al. 2006 Virology 355:71-81; Morizono et al J. Gene Med. 11:655-663, Morizono et al. 2005 Nat. Med. 11:346-352), baboon retroviral envelope protein (see e.g. Girard-Gagnepain et al. 2014. Blood. 124: 1221-1231); Tupaia paramyxovirus glycoproteins (see e.g. Enkirch T. et al., 2013. Gene Ther. 20:16-23); measles virus glycoproteins (see e.g. Funke et al. 2008. Molec. Ther. 16(8): 1427-1436), rabies virus envelope proteins, MLV envelope proteins, Ebola envelope proteins, baculovirus envelope proteins, filovirus envelope proteins, hepatitis E1 and E2 envelope proteins, gp41 and gp120 of HIV, hemagglutinin, neuraminidase, M2 proteins of influenza virus, and combinations thereof.
[0152] In some aspects, the tropism of the resulting lentiviral particle can be tuned by incorporating cell targeting peptides into a lentiviral vector such that the cell targeting peptides are expressed on the surface of the resulting lentiviral particle. In some aspects, a lentiviral vector can contain an envelope protein that is fused to a cell targeting protein (see e.g. Buchholz et al. 2015. Trends Biotechnol. 33:777-790; Bender et al. 2016. PLoS Pathog. 12(e1005461); and Friedrich et al. 2013. Mol. Ther. 2013. 21: 849-859.
[0153] In some aspects, a split-intein-mediated approach to target lentiviral particles to a specific cell type can be used (see e.g. Chamoun-Emaneulli et al. 2015. Biotechnol. Bioeng. 112:2611-2617, Ramirez et al. 2013. Protein. Eng. Des. Sel. 26:215-233. In these aspects, a lentiviral vector can contain one half of a splicing-deficient variant of the naturally split intein from Nostoc punctiforme fused to a cell targeting peptide and the same or different lentiviral vector can contain the other half of the split intein fused to an envelope protein, such as a binding-deficient, fusion-competent virus envelope protein. This can result in production of a virus particle from the lentiviral vector or vector system that includes a split intein that can function as a molecular Velcro linker to link the cell-binding protein to the pseudotyped lentivirus particle. This approach can be advantageous for use where surface-incompatibilities can restrict the use of, e.g., cell targeting peptides.
[0154] In some aspects, a covalent-bond-forming protein-peptide pair can be incorporated into one or more of the lentiviral vectors described herein to conjugate a cell targeting peptide to the virus particle (see e.g. Kasaraneni et al. 2018. Sci. Reports (8) No. 10990). In some aspects, a lentiviral vector can include an N-termial PDZ domain of InaD protein (PDZ1) and its pentapeptide ligand (TEFCA) from NorpA, which can conjugate the cell targeting peptide to the virus particle via a covalent bond (e.g. a disulfide bond). In some aspects, the PDZ1 protein can be fused to an envelope protein, which can optionally be binding deficient and/or fusion competent virus envelope protein and included in a lentiviral vector. In some aspects, the TEFCA can be fused to a cell targeting peptide and the TEFCA-CPT fusion construct can be incorporated into the same or a different lentiviral vector as the PDZ1-envenlope protein construct. During virus production, specific interaction between the PDZ1 and TEFCA facilitates producing virus particles covalently functionalized with the cell targeting peptide and thus capable of targeting a specific cell-type based upon a specific interaction between the cell targeting peptide and cells expressing its binding partner. This approach can be advantageous for use where surface-incompatibilities can restrict the use of, e.g., cell targeting peptides.
[0155] Lentiviral vectors have been disclosed as in the treatment for Parkinson's Disease, see, e.g., US Patent Publication No. 20120295960 and U.S. Pat. Nos. 7,303,910 and 7,351,585. Lentiviral vectors have also been disclosed for the treatment of ocular diseases, see e.g., US Patent Publication Nos. 20060281180, 20090007284, US20110117189; US20090017543; US20070054961, US20100317109. Lentiviral vectors have also been disclosed for delivery to the brain, see, e.g., US Patent Publication Nos. US20110293571; US20110293571, US20040013648, US20070025970, US20090111106 and US Patent No. U.S. Pat. No. 7,259,015. Any of these systems or a variant thereof can be used to deliver an engineered southern green stink bug pheromone enzyme or system thereof polynucleotide described herein to a cell.
[0156] In some aspects, a lentiviral vector system can include one or more transfer plasmids. Transfer plasmids can be generated from various other vector backbones and can include one or more features that can work with other retroviral and/or lentiviral vectors in the system that can, for example, improve safety of the vector and/or vector system, increase virial titers, and/or increase or otherwise enhance expression of the desired insert to be expressed and/or packaged into the viral particle. Suitable features that can be included in a transfer plasmid can include, but are not limited to, 5′LTR, 3′LTR, SIN/LTR, origin of replication (Ori), selectable marker genes (e.g. antibiotic resistance genes), Psi (4), RRE (rev response element), cPPT (central polypurine tract), promoters, WPRE (woodchuck hepatitis post-transcriptional regulatory element), SV40 polyadenylation signal, pUC origin, SV40 origin, F1 origin, and combinations thereof.
[0157] Adenoviral Vectors, Helper-Dependent Adenoviral Vectors, and Hybrid Adenoviral Vectors
[0158] In some aspects, the vector can be an adenoviral vector. In some aspects, the adenoviral vector can include elements such that the virus particle produced using the vector or system thereof can be serotype 2 or serotype 5. In some aspects, the polynucleotide to be delivered via the adenoviral particle can be up to about 8 kb. Thus, in some aspects, an adenoviral vector can include a DNA polynucleotide to be delivered that can range in size from about 0.001 kb to about 8 kb. Adenoviral vectors have been used successfully in several contexts (see e.g. Teramato et al. 2000. Lancet. 355:1911-1912; Lai et al. 2002. DNA Cell. Biol. 21:895-913; Flotte et al., 1996. Hum. Gene. Ther. 7:1145-1159; and Kay et al. 2000. Nat. Genet. 24:257-261.
[0159] In some aspects the vector can be a helper-dependent adenoviral vector or system thereof. These are also referred to in the art as “gutless” or “gutted” vectors and are a modified generation of adenoviral vectors (see e.g. Thrasher et al. 2006. Nature. 443:E5-7). In aspects of the helper-dependent adenoviral vector system one vector (the helper) can contain all the viral genes required for replication but contains a conditional gene defect in the packaging domain. The second vector of the system can contain only the ends of the viral genome, one or more engineered southern green stink bug enzyme or system thereof polynucleotides, and the native packaging recognition signal, which can allow selective packaged release from the cells (see e.g. Cideciyan et al. 2009. N Engl J Med. 361:725-727). Helper-dependent adenoviral vector systems have been successful for gene delivery in several contexts (see e.g. Simonelli et al. 2010. J Am Soc Gene Ther. 18:643-650; Cideciyan et al. 2009. N Engl J Med. 361:725-727; Crane et al. 2012. Gene Ther. 19(4):443-452; Alba et al. 2005. Gene Ther. 12:18-S27; Croyle et al. 2005. Gene Ther. 12:579-587; Amalfitano et al. 1998. J. Virol. 72:926-933; and Morral et al. 1999. PNAS. 96:12816-12821). The techniques and vectors described in these publications can be adapted for inclusion and delivery of the engineered southern green stink bug enzyme or system thereof polynucleotides described herein. In some aspects, the polynucleotide to be delivered via the viral particle produced from a helper-dependent adenoviral vector or system thereof can be up to about 37 kb. Thus, in some aspects, a adenoviral vector can include a DNA polynucleotide to be delivered that can range in size from about 0.001 kb to about 37 kb (see e.g. Rosewell et al. 2011. J. Genet. Syndr. Gene Ther. Suppl. 5:001).
[0160] In some aspects, the vector is a hybrid-adenoviral vector or system thereof. Hybrid adenoviral vectors are composed of the high transduction efficiency of a gene-deleted adenoviral vector and the long-term genome-integrating potential of adeno-associated, retroviruses, lentivirus, and transposon based-gene transfer. In some aspects, such hybrid vector systems can result in stable transduction and limited integration site. See e.g. Balague et al. 2000. Blood. 95:820-828; Morral et al. 1998. Hum. Gene Ther. 9:2709-2716; Kubo and Mitani. 2003. J. Virol. 77(5): 2964-2971; Zhang et al. 2013. PloS One. 8(10) e76771; and Cooney et al. 2015. Mol. Ther. 23(4):667-674), whose techniques and vectors described therein can be modified and adapted for use with the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein. In some aspects, a hybrid-adenoviral vector can include one or more features of a retrovirus and/or an adeno-associated virus. In some aspects the hybrid-adenoviral vector can include one or more features of a spuma retrovirus or foamy virus (FV). See e.g. Ehrhardt et al. 2007. Mol. Ther. 15:146-156 and Liu et al. 2007. Mol. Ther. 15:1834-1841, whose techniques and vectors described therein can be modified and adapted for use with the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein. Advantages of using one or more features from the FVs in the hybrid-adenoviral vector or system thereof can include the ability of the viral particles produced therefrom to infect a broad range of cells, a large packaging capacity as compared to other retroviruses, and the ability to persist in quiescent (non-dividing) cells. See also e.g. Ehrhardt et al. 2007. Mol. Ther. 156:146-156 and Shuji et al. 2011. Mol. Ther. 19:76-82, whose techniques and vectors described therein can be modified and adapted for use with the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein.
[0161] Adeno Associated Viral (AAV) Vectors
[0162] In an embodiment, the vector can be an adeno-associated virus (AAV) vector. See, e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368; WO 93/24641; Kotin, Human Gene Therapy 5:793-801 (1994); and Muzyczka, J. Clin. Invest. 94:1351 (1994). Although similar to adenoviral vectors in some of their features, AAVs have some deficiency in their replication and/or pathogenicity and thus can be safer that adenoviral vectors. In some aspects the AAV can integrate into a specific site on chromosome 19 of a human cell with no observable side effects. In some aspects, the capacity of the AAV vector, system thereof, and/or AAV particles can be up to about 4.7 kb.
[0163] The AAV vector or system thereof can include one or more regulatory molecules. In some aspects the regulatory molecules can be promoters, enhancers, repressors and the like, which are described in greater detail elsewhere herein. In some aspects, the AAV vector or system thereof can include one or more polynucleotides that can encode one or more regulatory proteins. In some aspects, the one or more regulatory proteins can be selected from Rep78, Rep68, Rep52, Rep40, variants thereof, and combinations thereof.
[0164] The AAV vector or system thereof can include one or more polynucleotides that can encode one or more capsid proteins. The capsid proteins can be selected from VP1, VP2, VP3, and combinations thereof. The capsid proteins can be capable of assembling into a protein shell of the AAV virus particle. In some aspects, the AAV capsid can contain 60 capsid proteins. In some aspects, the ratio of VP1:VP2:VP3 in a capsid can be about 1:1:10.
[0165] In some aspects, the AAV vector or system thereof can include one or more adenovirus helper factors or polynucleotides that can encode one or more adenovirus helper factors. Such adenovirus helper factors can include, but are not limited, E1A, E1B, E2A, E4ORF6, and VA RNAs. In some aspects, a producing host cell line expresses one or more of the adenovirus helper factors.
[0166] The AAV vector or system thereof can be configured to produce AAV particles having a specific serotype. In some aspects, the serotype can be AAV-1, AAV-2, AAV-3, AAV-4, AAV-5, AAV-6, AAV-8, AAV-9 or any combinations thereof. In some aspects, the AAV can be AAV1, AAV-2, AAV-5 or any combination thereof. One can select the AAV of the AAV with regard to the cells to be targeted; e.g., one can select AAV serotypes 1, 2, 5 or a hybrid capsid AAV-1, AAV-2, AAV-5 or any combination thereof for targeting brain and/or neuronal cells; and one can select AAV-4 for targeting cardiac tissue; and one can select AAV8 for delivery to the liver. Thus, in some aspects, an AAV vector or system thereof capable of producing AAV particles capable of targeting the brain and/or neuronal cells can be configured to generate AAV particles having serotypes 1, 2, 5 or a hybrid capsid AAV-1, AAV-2, AAV-5 or any combination thereof. In some aspects, an AAV vector or system thereof capable of producing AAV particles capable of targeting cardiac tissue can be configured to generate an AAV particle having an AAV-4 serotype. In some aspects, an AAV vector or system thereof capable of producing AAV particles capable of targeting the liver can be configured to generate an AAV having an AAV-8 serotype. In some aspects, the AAV vector is a hybrid AAV vector or system thereof. Hybrid AAVs are AAVs that include genomes with elements from one serotype that are packaged into a capsid derived from at least one different serotype. For example, if it is the rAAV2/5 that is to be produced, and if the production method is based on the helper-free, transient transfection method discussed above, the 1st plasmid and the 3rd plasmid (the adeno helper plasmid) will be the same as discussed for rAAV2 production. However, the 2nd plasmid, the pRepCap will be different. In this plasmid, called pRep2/Cap5, the Rep gene is still derived from AAV2, while the Cap gene is derived from AAV5. The production scheme is the same as the above-mentioned approach forAAV2 production. The resulting rAAV is called rAAV2/5, in which the genome is based on recombinant AAV2, while the capsid is based on AAV5. It is assumed the cell or tissue-tropism displayed by this AAV2/5 hybrid virus should be the same as that of AAV5.
[0167] In some aspects, the AAV vector or system thereof is configured as a “gutless” vector, similar to that described in connection with a retroviral vector. In some aspects, the “gutless” AAV vector or system thereof can have the cis-acting viral DNA elements involved in genome amplification and packaging in linkage with the heterologous sequences of interest (e.g. the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein).
[0168] Herpes Simplex Viral Vectors
[0169] In some aspects, the vector can be a Herpes Simplex Viral (HSV)-based vector or system thereof. HSV systems can include the disabled infections single copy (DISC) viruses, which are composed of a glycoprotein H defective mutant HSV genome. When the defective HSV is propagated in complementing cells, virus particles can be generated that are capable of infecting subsequent cells permanently replicating their own genome but are not capable of producing more infectious particles. See e.g. 2009. Trobridge. Exp. Opin. Biol. Ther. 9:1427-1436, whose techniques and vectors described therein can be modified and adapted for use with the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein. In some aspects where an HSV vector or system thereof is utilized, the host cell can be a complementing cell. In some aspects, HSV vector or system thereof can be capable of producing virus particles capable of delivering a polynucleotide cargo of up to 150 kb. Thus, in some aspect the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein included in the HSV-based viral vector or system thereof can sum from about 0.001 to about 150 kb. HSV-based vectors and systems thereof have been successfully used in several contexts including various models of neurologic disorders. See e.g. Cockrell et al. 2007. Mol. Biotechnol. 36:184-204; Kafri T. 2004. Mol. Biol. 246:367-390; Balaggan and Ali. 2012. Gene Ther. 19:145-153; Wong et al. 2006. Hum. Gen. Ther. 2002. 17:1-9; Azzouz et al. J. Neruosci. 22L10302-10312; and Betchen and Kaplitt. 2003. Curr. Opin. Neurol. 16:487-493, whose techniques and vectors described therein can be modified and adapted for use with the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein.
[0170] Poxvirus Vectors
[0171] In some aspects, the vector can be a poxvirus vector or system thereof. In some aspects, the poxvirus vector can result in cytoplasmic expression of one or more engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein. In some aspects the capacity of a poxvirus vector or system thereof can be about 25 kb or more. In some aspects, a poxivirus vector or system thereof can include a
[0172] Vector Construction
[0173] The vectors described herein can be constructed using any suitable process or technique. In some aspects, one or more suitable recombination and/or cloning methods or techniques can be used to the vector(s) described herein. Suitable recombination and/or cloning techniques and/or methods can include, but not limited to, those described in U.S. Application publication No. US 2004-0171156 A1. Other suitable methods and techniques are described elsewhere herein.
[0174] Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No. 5,173,414; Tratschin et al., Mol. Cell. Biol. 5:3251-3260 (1985); Tratschin, et al., Mol. Cell. Biol. 4:2072-2081 (1984); Hermonat & Muzyczka, PNAS 81:6466-6470 (1984); and Samulski et al., J. Virol. 63:03822-3828 (1989). Any of the techniques and/or methods can be used and/or adapted for constructing an AAV or other vector described herein.nAAV vectors are discussed elsewhere herein.
[0175] In some embodiments, the vector can have one or more insertion sites, such as a restriction endonuclease recognition sequence (also referred to as a “cloning site”). In some embodiments, one or more insertion sites (e.g., about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more insertion sites) are located upstream and/or downstream of one or more sequence elements of one or more vectors.
[0176] Delivery vehicles, vectors, particles, nanoparticles, formulations and components thereof for expression of one or more elements of the engineered southern green stink bug pheromone enzymes and systems thereof and/or polynucleotide(s) described herein described herein are as used in the foregoing documents, such as WO 2014/093622 (PCT/US2013/074667) and are discussed in greater detail herein.
[0177] Virus Particle Production from Viral Vectors
[0178] Retroviral Production
[0179] In some aspects, one or more viral vectors and/or system thereof can be delivered to a suitable cell line for production of virus particles containing the polynucleotide or other payload to be delivered to a host cell. Suitable host cells for virus production from viral vectors and systems thereof described herein are known in the art and are commercially available. For example, suitable host cells include HEK 293 cells and its variants (HEK 293T and HEK 293TN cells). In some aspects, the suitable host cell for virus production from viral vectors and systems thereof described herein can stably express one or more genes involved in packaging (e.g. pol, gag, and/or VSV-G) and/or other supporting genes.
[0180] In some aspects, after delivery of one or more viral vectors to the suitable host cells for or virus production from viral vectors and systems thereof, the cells are incubated for an appropriate length of time to allow for viral gene expression from the vectors, packaging of the polynucleotide to be delivered (e.g. an engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein), and virus particle assembly, and secretion of mature virus particles into the culture media. Various other methods and techniques are generally known to those of ordinary skill in the art.
[0181] Mature virus particles can be collected from the culture media by a suitable method. In some aspects, this can involve centrifugation to concentrate the virus. The titer of the composition containing the collected virus particles can be obtained using a suitable method. Such methods can include transducing a suitable cell line (e.g. NIH 3T3 cells) and determining transduction efficiency, infectivity in that cell line by a suitable method. Suitable methods include PCR-based methods, flow cytometry, and antibiotic selection-based methods. Various other methods and techniques are generally known to those of ordinary skill in the art. The concentration of virus particle can be adjusted as needed. In some aspects, the resulting composition containing virus particles can contain 1×10.sub.1-1×10.sub.20 particles/mL.
[0182] AAV Particle Production
[0183] There are two main strategies for producing AAV particles from AAV vectors and systems thereof, such as those described herein, which depend on how the adenovirus helper factors are provided (helper v. helper free). In some aspects, a method of producing AAV particles from AAV vectors and systems thereof can include adenovirus infection into cell lines that stably harbor AAV replication and capsid encoding polynucleotides along with AAV vector containing the polynucleotide to be packaged and delivered by the resulting AAV particle (e.g. the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein). In some aspects, a method of producing AAV particles from AAV vectors and systems thereof can be a “helper free” method, which includes co-transfection of an appropriate producing cell line with three vectors (e.g. plasmid vectors): (1) an AAV vector that contains a polynucleotide of interest (e.g. the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein between 2 ITRs; (2) a vector that carries the AAV Rep-Cap encoding polynucleotides; and (helper polynucleotides. One of skill in the art will appreciate various methods and variations thereof that are both helper and -helper free and as well as the different advantages of each system.
[0184] Vector and Virus Particle Delivery
[0185] A vector (including non-viral carriers) described herein can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides encoded by nucleic acids as described herein (e.g., engineered southern green stink bug pheromone enzymes and systems thereof described herein transcripts, proteins, enzymes, mutant forms thereof, fusion proteins thereof, etc.), and virus particles (such as from viral vectors and systems thereof).
[0186] One or more engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein can be delivered using adeno associated virus (AAV), lentivirus, adenovirus or other plasmid or viral vector types, in particular, using formulations and doses from, for example, U.S. Pat. No. 8,454,972 (formulations, doses for adenovirus), U.S. Pat. No. 8,404,658 (formulations, doses for AAV) and U.S. Pat. No. 5,846,946 (formulations, doses for DNA plasmids) and from clinical trials and publications regarding the clinical trials involving lentivirus, AAV and adenovirus. For examples, for AAV, the route of administration, formulation and dose can be as in U.S. Pat. No. 8,454,972 and as in clinical trials involving AAV. For Adenovirus, the route of administration, formulation and dose can be as in U.S. Pat. No. 8,404,658 and as in clinical trials involving adenovirus.
[0187] For plasmid delivery, the route of administration, formulation and dose can be as in U.S. Pat. No. 5,846,946 and as in clinical studies involving plasmids. In some aspects, doses can be based on or extrapolated to an average 70 kg individual (e.g. a male adult human), and can be adjusted for patients, subjects, mammals of different weight and species. Frequency of administration is within the ambit of the medical or veterinary practitioner (e.g., physician, veterinarian), depending on usual factors including the age, sex, general health, other conditions of the patient or subject and the particular condition or symptoms being addressed. The viral vectors can be injected into or otherwise delivered to the tissue or cell of interest.
[0188] In terms of in vivo delivery, AAV is advantageous over other viral vectors for a couple of reasons such as low toxicity (this may be due to the purification method not requiring ultra-centrifugation of cell particles that can activate the immune response) and a low probability of causing insertional mutagenesis because it doesn't integrate into the host genome.
[0189] The vector(s) and virus particles described herein can be delivered in to a host cell in vitro, in vivo, and or ex vivo. Delivery can occur by any suitable method including, but not limited to, physical methods, chemical methods, and biological methods. Physical delivery methods are those methods that employ physical force to counteract the membrane barrier of the cells to facilitate intracellular delivery of the vector. Suitable physical methods include, but are not limited to, needles (e.g. injections), ballistic polynucleotides (e.g. particle bombardment, micro projectile gene transfer, and gene gun), electroporation, sonoporation, photoporation, magnetofection, hydroporation, and mechanical massage. Chemical methods are those methods that employ a chemical to elicit a change in the cells membrane permeability or other characteristic(s) to facilitate entry of the vector into the cell. For example, the environmental pH can be altered which can elicit a change in the permeability of the cell membrane. Biological methods are those that rely and capitalize on the host cell's biological processes or biological characteristics to facilitate transport of the vector (with or without a carrier) into a cell. For example, the vector and/or its carrier can stimulate an endocytosis or similar process in the cell to facilitate uptake of the vector into the cell.
[0190] Delivery of the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein components (e.g. polynucleotides encoding engineered southern green stink bug pheromone enzymes and systems thereof polypeptides) to cells via particles. The term “particle” as used herein, refers to any suitable sized particles for delivery of the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) and/or polypeptides described herein components described herein. Suitable sizes include macro-, micro-, and nano-sized particles. In some aspects, any of the of the engineered southern green stink bug pheromone enzymes and systems thereof polynucleotide(s) described herein components (e.g. polypeptides, polynucleotides, vectors and combinations thereof described herein) can be attached to, coupled to, integrated with, otherwise associated with one or more particles or component thereof as described herein. The particles described herein can then be administered to a cell or organism by an appropriate route and/or technique. In some aspects, particle delivery can be selected and be advantageous for delivery of the polynucleotide or vector components. It will be appreciated that in aspects, particle delivery can also be advantageous for other engineered southern green stink bug pheromone enzymes and systems thereof described herein molecules and formulations described elsewhere herein.
[0191] Modified Cells and Organisms
[0192] One or more of the polynucleotides and/or vectors can be delivered to and/or expressed in heterologous cells to produce modified cells. In some aspects, the cell is a plant cell. In some aspects, the plant is suitable as a trap crop for management of the Southern green stink bug. As such, also described herein are cells that can include and/or express one or more one or more engineered polynucleotides or vectors capable of producing one or more engineered southern green stink bug pheromone enzymes described herein. Thus, also contemplated herein are organisms that can express in one or more cells one or more one or more engineered polynucleotides or vectors capable of producing one or more engineered southern green stink bug pheromone enzymes described herein. In some instances, the organism is a mosaic. In some instances, the organism can express one or more of the engineered polynucleotides or vectors capable of producing one or more engineered southern green stink bug pheromone enzymes described herein in all cells. The polypeptides, polynucleotides, and vectors described herein can be used to modify one or more cells and/or be used to generate organisms to contain one or more modified cells.
[0193] As used herein, the term “transgenic cell” refers to a cell, such as a eukaryotic cell, in which one or more of the engineered polynucleotides capable of producing one or more engineered southern green stink bug pheromone enzymes described herein (the “transgene”) has been genomically integrated. The nature, type, or origin of the cell are not particularly limiting according to the present invention. Also, the way the transgene is introduced in the cell can vary and can be any method as is known in the art. In certain embodiments, the transgenic cell is obtained by introducing the transgene in an isolated cell. In certain other embodiments, the transgenic cell is obtained by isolating cells from a transgenic organism.
[0194] Modified Cells
[0195] In some aspects the modified cell can be a prokaryotic cell. The prokaryotic cells can be bacterial cells. The bacterial cell can be any suitable strain of bacterial cell.
[0196] In some aspects the modified cell can be a eukaryotic cell. The eukaryotic cells may be those of or derived from a particular organism, such as a plant or a mammal, including but not limited to human, or non-human eukaryote or animal or mammal as herein discussed, e.g., mouse, rat, rabbit, dog, livestock, or non-human mammal or primate. In some embodiments, processes for modifying the germ line genetic identity of human beings and/or processes for modifying the genetic identity of animals which are likely to cause them suffering without any substantial medical benefit to man or animal, and also animals resulting from such processes, may be excluded.
[0197] In certain embodiments, the methods as described herein may comprise providing a transgenic cell in which one or more nucleic acids encoding one or more engineered southern green stink bug pheromone enzymes described herein are provided or introduced operably connected in the cell with a regulatory element comprising a promoter of one or more gene of interest. By means of example, and without limitation, the transgenic cell as referred to herein may be derived from a transgenic eukaryote, such as a knock-in eukaryote. Any suitable genetic modification method can be used to modify the cells (e.g. convention recombinant techniques and cloning, Cre-Lox systems, Zinc Finger nucleases, TALE nucleases, CRISPR-Cas systems, and the like). Delivery systems for transgenes are well known in the art. By means of example, the transgene may be delivered in for instance eukaryotic cell by means of vector (e.g., AAV, adenovirus, lentivirus) and/or particle and/or nanoparticle delivery, as also described herein elsewhere.
[0198] The host cell for modification can be any cell. A wide variety of cell lines for tissue culture are known in the art. Examples of cell lines include, but are not limited to, C8161, CCRF-CEM, MOLT, mIMCD-3, NHDF, HeLa-S3, Huh1, Huh4, Huh7, HUVEC, HASMC, HEKn, HEKa, MiaPaCell, Panc1, PC-3, TF1, CTLL-2, C1R, Rat6, CV1, RPTE, A10, T24, J82, A375, ARH-77, Calu1, SW480, SW620, SKOV3, SK-UT, CaCo2, P388D1, SEM-K2, WEHI-231, HB56, TIB55, Jurkat, J45.01, LRMB, Bcl-1, BC-3, IC21, DLD2, Raw264.7, NRK, NRK-52E, MRC5, MEF, Hep G2, HeLa B, HeLa T4, COS, COS-1, COS-6, COS-M6A, BS-C-1 monkey kidney epithelial, BALB/3T3 mouse embryo fibroblast, 3T3 Swiss, 3T3-L1, 132-d5 human fetal fibroblasts; 10.1 mouse fibroblasts, 293-T, 3T3, 721, 9L, A2780, A2780ADR, A2780cis, A172, A20, A253, A431, A-549, ALC, B16, B35, BCP-1 cells, BEAS-2B, bEnd.3, BHK-21, BR 293, BxPC3, C3H-10T1/2, C6/36, Cal-27, CHO, CHO-7, CHO-IR, CHO-K1, CHO-K2, CHO-T, CHO Dhfr −/−, COR-L23, COR-L23/CPR, COR-L23/5010, COR-L23/R23, COS-7, COV-434, CML T1, CMT, CT26, D17, DH82, DU145, DuCaP, EL4, EM2, EM3, EMT6/AR1, EMT6/AR10.0, FM3, H1299, H69, HB54, HB55, HCA2, HEK-293, HeLa, Hepa1c1c7, HL-60, HMEC, HT-29, Jurkat, JY cells, K562 cells, Ku812, KCL22, KG1, KYO1, LNCap, Ma-Mel 1-48, MC-38, MCF-7, MCF-10A, MDA-MB-231, MDA-MB-468, MDA-MB-435, MDCK II, MDCK II, MOR/0.2R, MONO-MAC 6, MTD-1A, MyEnd, NCI-H69/CPR, NCI-H69/LX10, NCI-H69/LX20, NCI-H69/LX4, NIH-3T3, NALM-1, NW-145, OPCN/OPCT cell lines, Peer, PNT-1A/PNT 2, RenCa, RIN-5F, RMA/RMAS, Saos-2 cells, Sf-9, SkBr3, T2, T-47D, T84, THP1 cell line, U373, U87, U937, VCaP, Vero cells, WM39, WT-49, X63, YAC-1, YAR, and transgenic varieties thereof. Cell lines are available from a variety of sources known to those with skill in the art (see, e.g., the American Type Culture Collection (ATCC) (Manassas, Va.)).
[0199] In some aspects, the cell is a plant cell. In some aspects, the cell is from a plant suitable for use as a trap crop for a stink bug. In some aspects, the cell is from a plant suitable for use as a trap crop of the southern green stink bug. In some aspects, the plant cell is from a sunflower plant, a squash plant, a zucchini plant, a pumpkin plant, a hollyhock plant, buckwheat, triticale, crimson clover, vetch sorghum, and millet. Other plants may be suitable for use as trap crops. Characteristics of suitable trap crops are described in greater detail elsewhere herein.
[0200] In some embodiments, a cell transfected with one or more vectors described herein is used to establish a new cell line comprising one or more polynucleotide and/or vector-derived sequences. In some embodiments, a cell transiently transfected with one or more engineered southern green stink bug pheromone enzymes described herein as described herein (such as by transient transfection of one or more vectors, or transfection with RNA), is used to establish a new cell line comprising cells containing the modification but lacking any other exogenous sequence. In some embodiments, cells transiently or non-transiently transfected with one or more vectors described herein, or cell lines derived from such cells are used in assessing one or more test compounds.
[0201] In one aspect, the invention provides a eukaryotic host cell comprising (a) a first regulatory element operably linked to one or more engineered southern green stink bug pheromone enzymes described herein, wherein when expressed, produces the one or more enzymes encoded by one or more engineered southern green stink bug pheromone enzyme polynucleotides described herein.
[0202] Modified Organisms
[0203] A wide variety of animals, plants, algae, fungi, yeast, etc. and animal, plant, algae, fungus, yeast cell or tissue systems may be engineered for the desired physiological and agronomic characteristics described herein using the nucleic acid constructs of the present disclosure and the various transformation methods mentioned elsewhere herein. In aspects, one or more cells of a plant, animal, algae, fungus, yeast contain one or more polynucleotides, vectors encoding one or more engineered southern green stink bug enzymes described herein. In some aspects, the polynucleotide(s) encoding one or more engineered southern green stink bug enzymes described herein can be stably or transiently incorporated into one or more cells of a plant, animal, algae, fungus, and/oryeast ortissue system. In some aspects, one or more engineered southern green stink bug enzymes described herein are genomically incorporated into one or more cells of a plant, animal, algae, fungus, and/or yeast or tissue system. Further aspects of the modified organisms and systems are described elsewhere herein.
[0204] The engineered southern green stink bug pheromone enzyme polynucleotides described can be used to confer desired traits (e.g. pheromone and/or pheromone precursor production) on essentially any animal plant, algae, fungus, yeast, etc. A wide variety of animals, plants, algae, fungus, yeast, etc. and plant algae, fungus, yeast cell or tissue systems may be engineered for the desired physiological and agronomic characteristics described herein using the nucleic acid constructs of the present disclosure and the various transformation methods mentioned above.
Thus, the invention provides a plant, animal or cell, produced by the present methods, or a progeny thereof. The progeny may be a clone of the produced plant or animal, or may result from sexual reproduction by crossing with other individuals of the same species to introgress further desirable traits into their offspring. The cell may be in vivo or ex vivo in the cases of multicellular organisms, particularly animals or plants.
[0205] In some aspects, one or more engineered southern green stink bug enzymes described herein are expressed in one or more cells of the plant, animal, algae, fungus, yeast, or tissue systems. In some aspects, one or more engineered southern green stink bug enzymes described herein can be transcribed and/or translated by a cell to produce one or more engineered southern green stink bug pheromone enzymes described elsewhere herein. In an aspect, described herein is a non-human eukaryotic organism (such as a plant); preferably a multicellular eukaryotic organism, comprising a eukaryotic host cell containing one or more components of a non-class I engineered CRISPR-Cas system described herein according to any of the described embodiments.
[0206] Thus, the described herein a plant, animal or cell, produced by the present methods and incorporating one or more of the polynucleotides and/or enzymes described herein, or a progeny thereof. The progeny may be a clone of the produced plant or animal, or may result from sexual reproduction by crossing with other individuals of the same species to introgress further desirable traits into their offspring. The cell may be in vivo or ex vivo in the cases of multicellular organisms, particularly animals or plants.
[0207] The methods described herein generally result in the generation of “improved animals, plants, algae, fungi, yeast, etc.” in that they have one or more desirable traits compared to the wildtype animal, plant, algae, fungi, yeast, etc. In particular embodiments, the plants, algae, fungi, yeast, etc., cells or parts obtained are transgenic plants, comprising an exogenous DNA sequence incorporated into the genome of all or part of the cells. In particular embodiments, non-transgenic genetically modified animals, plants, algae, fungi, yeast, etc., parts or cells are obtained, in that no exogenous DNA sequence is incorporated into the genome of any of the cells of the modified animals, plants, algae, fungi, yeast, etc. In such embodiments, the improved animals, plants, algae, fungi, yeast, etc. are non-transgenic. Accordingly, as used herein, a “non-transgenic” animal, plant, algae, fungi, yeast, etc. or cell thereof is an animal, plant, algae, fungi, yeast, etc. or cell thereof which does not contain a foreign DNA stably integrated into its genome.
[0208] Modified Plants and Algae
[0209] Described herein are plants cells obtainable and obtained by the methods provided herein. The improved plants obtained by the methods described herein may be useful in food or feed production through expression of genes which, for instance ensure tolerance to plant pests, herbicides, drought, low or high temperatures, excessive water, etc.
[0210] The modified plants described herein can be used as trap crops that can be used to control southern green stink bug infestation. The trap crops can be planted one or more times a year. In some aspects, the modified trap crop expressing one or more engineered southern green stink bug polynucleotides vectors and/or enzymes as described elsewhere herein. In some aspects, the modified trap crop a sunflower plant, a squash plant, a zucchini plant, a pumpkin plant, a hollyhock plant, buckwheat, triticale, crimson clover, vetch sorghum, and millet. Other plants may be suitable for use as trap crops. Suitable trap crops can have one or more of the following characteristics: attracts the target pests (e.g. southern green stink bug), seeds are readily available, cost effective relative to other management strategies, culture and the management of the plant is well known, the plant is hardy in the geographical location needed and/or time of year needed, has minimal side effects (e.g. it is not invasive, other herbivores on it are benign or beneficial), an optimal maturity time (range is short to long), duration is extendable (by ratooning), the physical properties can be variable (height for barrier; foliage color), is multi-functional (e.g. attracts pollinators, beneficial insects, etc.).
[0211] In aspects more than one type of engineered trap crop can be used in the same area. In aspects, more than one type of trap crop can be used throughout the year. The physical appearance and height of the engineered trap crop plants can be important and their efficacy as a barrier can be improved by using pole or climbing species or cultivars on a vertical lattice of wire fencing on posts placed in the ground or in portable containers. The default (lack of knowledge) approach relative to placement would be to ring the entire cash crop with the trap crop. Alternatively, to reduce the amount of space and expense required for the trap crop, one may exploit stink bug behavior and use the “source-sink” approach to determine where to strategically place smaller trap crop plots in the most probable pathways that stink bugs will use to arrive at the cash crop from their previous hosts.
[0212] In aspects, the efficiency of the engineered trap crop can be further enhanced by the addition of visual and semiochemical attractants. The yellow pyramid trap baited with the species-specific attractant chemical(s) will attract and capture stink bugs and attract natural enemies. Simple 5-7 gallon plant pots or 3×36 inch mailing tubes painted safety yellow #K7744 will also attract both stink bugs and natural enemies to the trap crops. Stink bugs may be consumed by birds and other animals when exposed off the plant. Specific insect natural enemies include hymenopterous egg parasitoids and parasitic flies (Tachinidae). The mortality exerted on the various stink bug species by these parasitoids is not well documented but it is known that tachinid flies do respond to the semiochemicals released by stink bugs. Thus, the addition of semiochemicals to trap crops may increase natural enemy populations there, bringing them into more frequent contact with stink bugs.
The invention also provides for improved parts of a plant. Plant parts include, but are not limited to, leaves, stems, roots, tubers, seeds, endosperm, ovule, and pollen. Plant parts as envisaged herein may be viable, nonviable, regeneratable, and/or non-regeneratable.
[0213] It is also encompassed herein to provide plant cells and plants generated according to the methods of the invention. Gametes, seeds, embryos, either zygotic or somatic, progeny or hybrids of plants comprising the genetic modification, which are produced by traditional breeding methods, are also included within the scope of the present invention. Such plants may contain a heterologous or foreign DNA sequence inserted at or instead of a target sequence. Alternatively, such plants may contain only an alteration (mutation, deletion, insertion, substitution) in one or more nucleotides. As such, such plants will only be different from their progenitor plants by the presence of the particular modification.
[0214] In some aspects, the modified organism is a plant. In general, the term “plant” relates to any various photosynthetic, eukaryotic, unicellular or multicellular organism of the kingdom Plantae characteristically growing by cell division, containing chloroplasts, and having cell walls comprised of cellulose. The term plant encompasses monocotyledonous and dicotyledonous plants. Specifically, the plants are intended to comprise without limitation angiosperm and gymnosperm plants such as acacia, alfalfa, amaranth, apple, apricot, artichoke, ash tree, asparagus, avocado, banana, barley, beans, beet, birch, beech, blackberry, blueberry, broccoli, Brussel's sprouts, cabbage, canola, cantaloupe, carrot, cassava, cauliflower, cedar, a cereal, celery, chestnut, cherry, Chinese cabbage, citrus, clementine, clover, coffee, corn, cotton, cowpea, cucumber, cypress, eggplant, elm, endive, eucalyptus, fennel, figs, fir, geranium, grape, grapefruit, groundnuts, ground cherry, gum hemlock, hickory, kale, kiwifruit, kohlrabi, larch, lettuce, leek, lemon, lime, locust, pine, maidenhair, maize, mango, maple, melon, millet, mushroom, mustard, nuts, oak, oats, oil palm, okra, onion, orange, an ornamental plant or flower or tree, papaya, palm, parsley, parsnip, pea, peach, peanut, pear, peat, pepper, persimmon, pigeon pea, pine, pineapple, plantain, plum, pomegranate, potato, pumpkin, radicchio, radish, rapeseed, raspberry, rice, rye, sorghum, safflower, sallow, soybean, spinach, spruce, squash, strawberry, sugar beet, sugarcane, sunflower, sweet potato, sweet corn, tangerine, tea, tobacco, tomato, trees, triticale, turf grasses, turnips, vine, walnut, watercress, watermelon, wheat, yams, yew, and zucchini. The term plant also encompasses Algae, which are mainly photoautotrophs unified primarily by their lack of roots, leaves and other organs that characterize higher plants.
[0215] Plants can be modified to express one or more of the engineered southern green stink bug pheromones using a suitable modification technique, including but not limited to recombinant technology techniques and various genome editing systems, e.g. a CRISPR-Cas system, TALENs, Zinc-finger nucleases, can be used to confer desired traits on essentially any plant. Such methods are known in the art. A wide variety of plants and plant cell systems may be engineered for the desired physiological and agronomic characteristics described herein using the nucleic acid constructs of the present disclosure and the various transformation methods mentioned above. In preferred embodiments, target plants and plant cells for engineering include, but are not limited to, those monocotyledonous and dicotyledonous plants, such as crops including grain crops (e.g., wheat, maize, rice, millet, barley), fruit crops (e.g., tomato, apple, pear, strawberry, orange), forage crops (e.g., alfalfa), root vegetable crops (e.g., carrot, potato, sugar beets, yam), leafy vegetable crops (e.g., lettuce, spinach); flowering plants (e.g., petunia, rose, chrysanthemum), conifers and pine trees (e.g., pine fir, spruce); plants used in phytoremediation (e.g., heavy metal accumulating plants); oil crops (e.g., sunflower, rape seed) and plants used for experimental purposes (e.g., Arabidopsis). Thus, a broad range of plants, such as for example with dicotyledonous plants can be modifiedbelonging to the orders Magniolales, Illiciales, Laurales, Piperales, Aristochiales, Nymphaeales, Ranunculales, Papeverales, Sarraceniaceae, Trochodendrales, Hamamelidales, Eucomiales, Leitneriales, Myricales, Fagales, Casuarinales, Caryophyllales, Batales, Polygonales, Plumbaginales, Dilleniales, Theales, Malvales, Urticales, Lecythidales, Violales, Salicales, Capparales, Ericales, Diapensales, Ebenales, Primulales, Rosales, Fabales, Podostemales, Haloragales, Myrtales, Cornales, Proteales, San tales, Rafflesiales, Celastrales, Euphorbiales, Rhamnales, Sapindales, Juglandales, Geraniales, Polygalales, Umbellales, Gentianales, Polemoniales, Lamiales, Plantaginales, Scrophulariales, Campanulales, Rubiales, Dipsacales, and Asterales; the methods and CRISPR-Cas systems can be used with monocotyledonous plants such as those belonging to the orders Alismatales, Hydrocharitales, Najadales, Triuridales, Commelinales, Eriocaulales, Restionales, Poales, Juncales, Cyperales, Typhales, Bromeliales, Zingiberales, Arecales, Cyclanthales, Pandanales, Arales, Lilliales, and Orchid ales, or with plants belonging to Gymnospermae, e.g those belonging to the orders Pinales, Ginkgoales, Cycadales, Araucariales, Cupressales and Gnetales.
[0216] Other plants that can be modified as described herein include those in the non-limitative list of dicot, monocot or gymnosperm genera hereunder: Atropa, Alseodaphne, Anacardium, Arachis, Beilschmiedia, Brassica, Carthamus, Cocculus, Croton, Cucumis, Citrus, Citrullus, Capsicum, Catharanthus, Cocos, Coffea, Cucurbita, Daucus, Duguetia, Eschscholzia, Ficus, Fragaria, Glaucium, Glycine, Gossypium, Helianthus, Hevea, Hyoscyamus, Lactuca, Landolphia, Linum, Litsea, Lycopersicon, Lupinus, Manihot, Majorana, Malus, Medicago, Nicotiana, Olea, Parthenium, Papaver, Persea, Phaseolus, Pistacia, Pisum, Pyrus, Prunus, Raphanus, Ricinus, Senecio, Sinomenium, Stephania, Sinapis, Solanum, Theobroma, Trifolium, Trigonella, Vicia, Vinca, Vilis, and Vigna; and the genera Allium, Andropogon, Aragrostis, Asparagus, Avena, Cynodon, Elaeis, Festuca, Festulolium, Heterocallis, Hordeum, Lemna, Lolium, Musa, Oryza, Panicum, Pannesetum, Phleum, Poa, Secale, Sorghum, Triticum, Zea, Abies, Cunninghamia, Ephedra, Picea, Pinus, and Pseudotsuga.
[0217] As used herein “algae” or “algae cells” that can be modified as described herein include, but are not limited to, algea selected from several eukaryotic phyla, including the Rhodophyta (red algae), Chlorophyta (green algae), Phaeophyta (brown algae), Bacillariophyta (diatoms), Eustigmatophyta and dinoflagellates as well as the prokaryotic phylum Cyanobacteria (blue-green algae). The term “algae” includes for example algae selected from: Amphora, Anabaena, Anikstrodesmis, Botryococcus, Chaetoceros, Chlamydomonas, Chlorella, Chlorococcum, Cyclotella, Cylindrotheca, Dunaliella, Emiliana, Euglena, Hematococcus, Isochrysis, Monochrysis, Monoraphidium, Nannochloris, Nannnochloropsis, Navicula, Nephrochloris, Nephroselmis, Nitzschia, Nodularia, Nostoc, Oochromonas, Oocystis, Oscillartoria, Pavlova, Phaeodactylum, Playtmonas, Pleurochrysis, Porhyra, Pseudoanabaena, Pyramimonas, Stichococcus, Synechococcus, Synechocystis, Tetraselmis, Thalassiosira, and Trichodesmium.
A part of a plant, i.e., a “plant tissue” may be treated according to the methods of the present invention to produce an improved plant. Plant tissue also encompasses plant cells. The term “plant cell” as used herein refers to individual units of a living plant, either in an intact whole plant or in an isolated form grown in in vitro tissue cultures, on media or agar, in suspension in a growth media or buffer or as a part of higher organized unites, such as, for example, plant tissue, a plant organ, or a whole plant.
[0218] A “protoplast” refers to a plant cell that has had its protective cell wall completely or partially removed using, for example, mechanical or enzymatic means resulting in an intact biochemical competent unit of living plant that can reform their cell wall, proliferate and regenerate grow into a whole plant under proper growing conditions.
[0219] The term “transformation” broadly refers to the process by which a plant host is genetically modified by the introduction of DNA by means of Agrobacteria or one of a variety of chemical or physical methods. As used herein, the term “plant host” refers to plants, including any cells, tissues, organs, or progeny of the plants. Many suitable plant tissues or plant cells can be transformed and include, but are not limited to, protoplasts, somatic embryos, pollen, leaves, seedlings, stems, calli, stolons, microtubers, and shoots. A plant tissue also refers to any clone of such a plant, seed, progeny, propagule whether generated sexually or asexually, and descendents of any of these, such as cuttings or seed.
[0220] The term “transformed” as used herein, refers to a cell, tissue, organ, or organism into which a foreign DNA molecule, such as a construct, has been introduced. The introduced DNA molecule may be integrated into the genomic DNA of the recipient cell, tissue, organ, or organism such that the introduced DNA molecule is transmitted to the subsequent progeny. In these embodiments, the “transformed” or “transgenic” cell or plant may also include progeny of the cell or plant and progeny produced from a breeding program employing such a transformed plant as a parent in a cross and exhibiting an altered phenotype resulting from the presence of the introduced DNA molecule. Preferably, the transgenic plant is fertile and capable of transmitting the introduced DNA to progeny through sexual reproduction.
[0221] The term “progeny”, such as the progeny of a transgenic plant, is one that is born of, begotten by, or derived from a plant or the transgenic plant. The introduced DNA molecule may also be transiently introduced into the recipient cell such that the introduced DNA molecule is not inherited by subsequent progeny and thus not considered “transgenic”.
[0222] The term “plant promoter” as used herein is a promoter capable of initiating transcription in plant cells, whether or not its origin is a plant cell. Exemplary suitable plant promoters include, but are not limited to, those that are obtained from plants, plant viruses, and bacteria such as Agrobacterium or Rhizobium which comprise genes expressed in plant cells.
[0223] In particular embodiments, the DNA construct may be introduced into the plant cell using techniques such as but not limited to electroporation, microinjection, aerosol beam injection of plant cell protoplasts, or the DNA constructs can be introduced directly to plant tissue using biolistic methods, such as DNA particle bombardment (see also Fu et al., Transgenic Res. 2000 February; 9(1):11-9). The basis of particle bombardment is the acceleration of particles coated with gene/s of interest toward cells, resulting in the penetration of the protoplasm by the particles and typically stable integration into the genome. (see e.g. Klein et al, Nature (1987), Klein et ah, Bio/Technology (1992), Casas et ah, Proc. Natl. Acad. Sci. USA (1993).).
[0224] In particular embodiments, the DNA constructs containing one or more engineered southern green stink bug pheromone polynucleotides described herein may be introduced into the plant by Agrobacterium-mediated transformation. The DNA constructs may be combined with suitable T-DNA flanking regions and introduced into a conventional Agrobacterium tumefaciens host vector. The foreign DNA can be incorporated into the genome of plants by infecting the plants or by incubating plant protoplasts with Agrobacterium bacteria, containing one or more Ti (tumor-inducing) plasmids. (see e.g. Fraley et al., (1985), Rogers et al., (1987) and U.S. Pat. No. 5,563,055).
[0225] CRISPR or other RNA-guided gene modification systems generally known in the art can be used to introduce targeted double-strand or single-strand breaks and/or to introduce into one or more plant cells or entire plantsgene activator and or repressor systems and without being limitative, can be used for gene targeting, gene replacement, targeted mutagenesis, targeted deletions or insertions, targeted inversions and/or targeted translocations. By co-expression of multiple targeting polyncuelotides (e.g.) RNAs directed to achieve multiple modifications in a single cell, multiplexed genome modification can be ensured. This technology can be used to high-precision engineering of plants with improved characteristics, including enhanced nutritional quality, increased resistance to diseases and resistance to biotic and abiotic stress, and increased production of commercially valuable plant products or heterologous compounds.
[0226] In particular embodiments, the methods described herein are used to modify endogenous genes or to modify their expression without the permanent introduction into the genome of the plant, including those encoding CRISPR components, so as to avoid the presence of foreign DNA in the genome of the plant. This can be of interest as the regulatory requirements for non-transgenic plants are less rigorous.
[0227] 1. Chloroplast Targeting
[0228] In particular embodiments, it is envisaged that the transgenes are expressed specifically in the chloroplast. For this purpose use is made of chloroplast transformation methods or compartmentalization of the engineered vectors or polynucleotides described herein to the chloroplast. For instance, the introduction of genetic modifications in the plastid genome can reduce biosafety issues such as gene flow through pollen. Methods of chloroplast transformation are known in the art and include Particle bombardment, PEG treatment, and microinjection. Additionally, methods involving the translocation of transformation cassettes from the nuclear genome to the pastid can be used as described in WO2010061186.
[0229] Alternatively, it is envisaged to target one or more of the the engineered vectors or polynucleotides described herein to the plant chloroplast. This is achieved by incorporating in the expression construct a sequence encoding a chloroplast transit peptide (CTP) or plastid transit peptide, operably linked to the 5′ region of the sequence encoding the CRISPR-Cas protein. The CTP is removed in a processing step during translocation into the chloroplast. Chloroplast targeting of expressed proteins is well known to the skilled artisan (see for instance Protein Transport into Chloroplasts, 2010, Annual Review of Plant Biology, Vol. 61: 157-180). In such embodiments it is also desired to target the guide RNA to the plant chloroplast. Methods and constructs which can be used for translocating guide RNA into the chloroplast by means of a chloroplast localization sequence are described, for instance, in US 20040142476, incorporated herein by reference. Such variations of constructs can be incorporated into the expression systems of the invention to efficiently translocate the CRISPR-Cas-guide RNA.
[0230] 2. Introduction of Polynucleotides in Algal Cells
[0231] Transgenic algae (or other plants such as rape) may be particularly useful for the expression and/or production of the southern green stink bug pheromone enzymes described herien. These may be engineered to express or overexpress high levels of oil or alcohols for use in the oil or biofuel industries.
U.S. Pat. No. 8,945,839 describes a method for engineering Micro-Algae (Chlamydomonas reinhardtii cells) species) using Cas9. Using similar tools, the methods of the CRISPR-Cas system described herein can be applied on Chlamydomonas species and other algae. Electroporation protocols are available to the skilled person such as the standard recommended protocol from the GeneArt Chlamydomonas Engineering kit.
[0232] Organisms such as microalgae are widely used for synthetic biology. Stovicek et al. (Metab. Eng. Comm., 2015; 2:13 describes genome editing of industrial yeast, for example, Saccharomyces cerevisae, to efficiently produce robust strains for industrial production. Stovicek used a CRISPR— The methods of Stovicek and Hlavova may be applied and/or adapted to produce a modified microalgae expression one or more of the engineered vectors, polynucleotides, and/or polypeptides described herein
[0233] 3. Transient Expression of the Engineered Polynucleotides and/or Vectors in Plant Cells
[0234] In particular embodiments, it is envisaged that one or more of the engineered vectors or polynucleotides described herein are transiently expressed in the plant cell. In these embodiments, expression of the transgene(s) is transient, plants regenerated from such plant cells typically contain no foreign DNA. In particular embodiments, one or more of the engineered vectors or polynucleotides described herein can be introduced in the plant cells using a plant viral vector (Scholthof et al. 1996, Annu Rev Phytopathol. 1996; 34:299-323). In further particular embodiments, said viral vector is a vector from a DNA virus. For example, geminivirus (e.g., cabbage leaf curl virus, bean yellow dwarf virus, wheat dwarf virus, tomato leaf curl virus, maize streak virus, tobacco leaf curl virus, or tomato golden mosaic virus) or nanovirus (e.g., Faba bean necrotic yellow virus). In other particular embodiments, said viral vector is a vector from an RNA virus. For example, tobravirus (e.g., tobacco rattle virus, tobacco mosaic virus), potexvirus (e.g., potato virus X), or hordeivirus (e.g., barley stripe mosaic virus). The replicating genomes of plant viruses are non-integrative vectors.
[0235] In particular embodiments, the vector used for transient expression of the transgene(s) for instance a pEAQ vector, which is tailored for Agrobacterium-mediated transient expression (Sainsbury F. et al., Plant Biotechnol J. 2009 September; 7(7):682-93) in the protoplast.
[0236] In particular embodiments, double-stranded DNA fragments encoding the engineered southern green stink bug pheromone enzymes described herein can be transiently introduced into the plant cell. In such embodiments, the introduced double-stranded DNA fragments are provided in sufficient quantity to modify the cell but do not persist after a contemplated period of time has passed or after one or more cell divisions. Methods for direct DNA transfer in plants are known by the skilled artisan (see for instance Davey et al. Plant Mol Biol. 1989 September; 13(3):273-85.)
[0237] In other embodiments, an RNA polynucleotide encoding the engineered southern green stink bug pheromone enzymes described herein is/are introduced into the plant cell, which is then translated and processed by the host cell generating the protein in sufficient quantity to modify the cell (in the presence of at least one guide RNA) but which does not persist after a contemplated period of time has passed or after one or more cell divisions. Methods for introducing mRNA to plant protoplasts for transient expression are known by the skilled artisan (see for instance in Gallie, Plant Cell Reports (1993), 13; 119-122).
[0238] Combinations of the different methods described above are also envisaged.
[0239] Delivery of engineered polynucleotides, vectors, and polypeptides to a plant cell In particular embodiments, it is of interest to deliver one or more engineered polynucleotides, vectors and/or polypeptides described herein directly to the plant cell. This is of interest, inter alia, for the generation of non-transgenic plants (see e.g. elsewhere herein). In particular embodiments, one or more engineered polynucleotides, vectors and/or polypeptides described herein is prepared outside the plant or plant cell and delivered to the cell. For instance, in particular embodiments, the engineered southern green stink bug pheromone protein(s) is/are prepared in vitro prior to introduction to the plant cell. Such protein(s) can be prepared by various methods known by one of skill in the art and include recombinant production. After expression, the engineered protein(s) described herein is/are isolated, refolded if needed, purified and optionally treated to remove any purification tags, such as a His-tag. Once crude, partially purified, or more completely purified engineered protein(s) is/are obtained, the protein may be introduced to the plant cell.
[0240] In particular embodiments, the engineered polypeptides, polynucleotides, and/or vectors described herein are introduced into the plant cells using nanoparticles. The components, either as protein or nucleic acid or in a combination thereof, can be uploaded onto or packaged in nanoparticles and applied to the plants (such as for instance described in WO 2008042156 and US 20130185823). In some embodiments, cell penetrating peptides can be used to introduce one or more of the engineered polypeptides, polynucleotides, and/or vectors described herein into a plant cell. Accordingly, in particular, embodiments the invention comprises compositions comprising a cell penetrating peptide linked to one or more of the engineered protein(s) described herein. In particular embodiments, one or more of the engineered protein(s) described herein is coupled to one or more CPPs to effectively transport them inside plant protoplasts. In other embodiments, the engineered proteins are encoded by one or more circular or non-circular DNA molecule(s) which are coupled to one or more CPPs for plant protoplast delivery. The plant protoplasts are then regenerated to plant cells and further to plants. CPPs are generally described as short peptides of fewer than 35 amino acids either derived from proteins or from chimeric sequences which are capable of transporting biomolecules across cell membrane in a receptor independent manner. CPP can be cationic peptides, peptides having hydrophobic sequences, amphipatic peptides, peptides having proline-rich and anti-microbial sequence, and chimeric or bipartite peptides (Pooga and Lan gel 2005). CPPs are able to penetrate biological membranes and as such trigger the movement of various biomolecules across cell membranes into the cytoplasm and to improve their intracellular routing, and hence facilitate interaction of the biolomolecule with the target. Examples of CPP include amongst others: Tat, a nuclear transcriptional activator protein required for viral replication by HIV type1, penetratin, Kaposi fibroblast growth factor (FGF) signal peptide sequence, integrin β signal peptide sequence; polyarginine peptide Args sequence, Guanine rich-molecular transporters, sweet arrow peptide, etc.
[0241] In particular embodiments, the methods described herein are used to modify endogenous genes or to modify their expression without the permanent introduction into the genome of the plant of any foreign gene, including those one or more of the engineered polypeptides described elsewhere herein, so as to avoid the presence of foreign DNA in the genome of the plant. This can be of interest as the regulatory requirements for non-transgenic plants are less rigorous.
[0242] In particular embodiments, the engineered polypeptides, polynucleotides and/or vectors are introduced in the plant cell, protoplast or plant tissue either separately or in mixture, with the aid of particulate delivering molecules such as nanoparticles or CPP molecules as described herein above.
[0243] Detecting Modifications in the Plant Genome-Selectable Markers
[0244] Where the method involves introduction of a transgene, a transformed plant cell, callus, tissue or plant may be identified and isolated by selecting or screening the engineered plant material for the presence of the transgene or for traits encoded by the transgene. Physical and biochemical methods may be used to identify plant or plant cell transformants containing inserted gene constructs or an endogenous DNA modification. These methods include but are not limited to: 1) Southern analysis or PCR amplification for detecting and determining the structure of the recombinant DNA insert or modified endogenous genes; 2) Northern blot, S1 RNase protection, primer-extension or reverse transcriptase-PCR amplification for detecting and examining RNAtranscripts of the gene constructs; 3) enzymatic assays for detecting enzyme or ribozyme activity, where such gene products are encoded by the gene construct or expression is affected by the genetic modification; 4) protein gel electrophoresis, Western blot techniques, immunoprecipitation, or enzyme-linked immunoassays, where the gene construct or endogenous gene products are proteins. Additional techniques, such as in situ hybridization, enzyme staining, and immunostaining, also may be used to detect the presence or expression of the recombinant construct or detect a modification of endogenous gene in specific plant organs and tissues. The methods for doing all these assays are well known to those skilled in the art.
Additionally (or alternatively), the expression system encoding the engineered polypeptides is typically designed to comprise one or more selectable or detectable markers that provide a means to isolate or efficiently select cells that contain and/or have been modified by the transgene system at an early stage and on a large scale.
[0245] In the case of Agrobacterium-mediated transformation, the marker cassette may be adjacent to or between flanking T-DNA borders and contained within a binary vector. In another embodiment, the marker cassette may be outside of the T-DNA. A selectable marker cassette may also be within or adjacent to the same T-DNA borders as the expression cassette or may be somewhere else within a second T-DNA on the binary vector (e.g., a 2 T-DNA system).
For particle bombardment or with protoplast transformation, the expression system can comprise one or more isolated linear fragments or may be part of a larger construct that might contain bacterial replication elements, bacterial selectable markers or other detectable elements. The expression cassette(s) comprising the engineered polynucleotides described herein may be physically linked to a marker cassette or may be mixed with a second nucleic acid molecule encoding a marker cassette. The marker cassette is comprised of necessary elements to express a detectable or selectable marker that allows for efficient selection of transformed cells.
[0246] The selection procedure for the cells based on the selectable marker will depend on the nature of the marker gene. In particular embodiments, use is made of a selectable marker, i.e. a marker which allows a direct selection of the cells based on the expression of the marker. A selectable marker can confer positive or negative selection and is conditional or non-conditional on the presence of external substrates (Miki et al. 2004, 107(3): 193-232). Most commonly, antibiotic or herbicide resistance genes are used as a marker, whereby selection is be performed by growing the engineered plant material on media containing an inhibitory amount of the antibiotic or herbicide to which the marker gene confers resistance. Examples of such genes are genes that confer resistance to antibiotics, such as hygromycin (hpt) and kanamycin (nptII), and genes that confer resistance to herbicides, such as phosphinothricin (bar) and chlorosulfuron (als).
[0247] Transformed plants and plant cells may also be identified by screening for the activities of a visible marker, typically an enzyme capable of processing a colored substrate (e.g., the β-glucuronidase, luciferase, B or C1 genes). Such selection and screening methodologies are well known to those skilled in the art.
[0248] 4. Plant Cultures and Regeneration
[0249] In particular embodiments, plant cells which have a modified genome and that are produced or obtained by any of the methods described herein, can be cultured to regenerate a whole plant which possesses the transformed or modified genotype and thus the desired phenotype. Conventional regeneration techniques are well known to those skilled in the art. Particular examples of such regeneration techniques rely on manipulation of certain phytohormones in a tissue culture growth medium, and typically relying on a biocide and/or herbicide marker which has been introduced together with the desired nucleotide sequences. In further particular embodiments, plant regeneration is obtained from cultured protoplasts, plant callus, explants, organs, pollens, embryos or parts thereof (see e.g. Evans et al. (1983), Handbook of Plant Cell Culture, Klee et al (1987) Ann. Rev. of Plant Phys.).
[0250] In particular embodiments, transformed or improved plants as described herein can be self-pollinated to provide seed for homozygous improved plants of the invention (homozygous for the DNA modification) or crossed with non-transgenic plants or different improved plants to provide seed for heterozygous plants. Where a recombinant DNA was introduced into the plant cell, the resulting plant of such a crossing is a plant which is heterozygous for the recombinant DNA molecule. Both such homozygous and heterozygous plants obtained by crossing from the improved plants and comprising the genetic modification (which can be a recombinant DNA) are referred to herein as “progeny”. Progeny plants are plants descended from the original transgenic plant and containing the genome modification or recombinant DNA molecule introduced by the methods provided herein. Alternatively, genetically modified plants can be obtained by one of the methods described supra using the a genome modification technique whereby no foreign DNA is incorporated into the genome. Progeny of such plants, obtained by further breeding may also contain the genetic modification. Breedings are performed by any breeding methods that are commonly used for different crops (e.g., Allard, Principles of Plant Breeding, John Wiley & Sons, NY, U. of CA, Davis, Calif., 50-98 (1960).
[0251] Modified Fungi
[0252] In some embodiments, the modified organism can be a fungus. As used herein, a “fungal cell” refers to any type of eukaryotic cell within the kingdom of fungi. Phyla within the kingdom of fungi include Ascomycota, Basidiomycota, Blastocladiomycota, Chytridiomycota, Glomeromycota, Microsporidia, and Neocallimastigomycota. Fungal cells may include yeasts, molds, and filamentous fungi. In some embodiments, the fungal cell is a yeast cell.
As used herein, the term “yeast cell” refers to any fungal cell within the phyla Ascomycota and Basidiomycota. Yeast cells may include budding yeast cells, fission yeast cells, and mold cells. Without being limited to these organisms, many types of yeast used in laboratory and industrial settings are part of the phylum Ascomycota. In some embodiments, the yeast cell is an S. cerervisiae, Kluyveromyces marxianus, or Issatchenkia orientalis cell. Other yeast cells may include without limitation Candida spp. (e.g., Candida albicans), Yarrowia spp. (e.g., Yarrowia lipolytica), Pichia spp. (e.g., Pichia pastoris), Kluyveromyces spp. (e.g., Kluyveromyces lactis and Kluyveromyces marxianus), Neurospora spp. (e.g., Neurospora crassa), Fusarium spp. (e.g., Fusarium oxysporum), and Issatchenkia spp. (e.g., Issatchenkia orientalis, a.k.a. Pichia kudriavzevii and Candida acidothermophilum). In some embodiments, the fungal cell is a filamentous fungal cell. As used herein, the term “filamentous fungal cell” refers to any type of fungal cell that grows in filaments, i.e., hyphae or mycelia. Examples of filamentous fungal cells may include without limitation Aspergillus spp. (e.g., Aspergillus niger), Trichoderma spp. (e.g., Trichoderma reesei), Rhizopus spp. (e.g., Rhizopus oryzae), and Mortierella spp. (e.g., Mortierella isabellina).
[0253] In some embodiments, the fungal cell is an industrial strain. As used herein, “industrial strain” refers to any strain of fungal cell used in or isolated from an industrial process, e.g., production of a product on a commercial or industrial scale. Industrial strain may refer to a fungal species that is typically used in an industrial process, or it may refer to an isolate of a fungal species that may be also used for non-industrial purposes (e.g., laboratory research). Examples of industrial processes may include fermentation (e.g., in production of food or beverage products), distillation, biofuel production, production of a compound, and production of a polypeptide. Examples of industrial strains may include, without limitation, JAY270 and ATCC4124.
[0254] In some embodiments, the fungal cell is a polyploid cell. As used herein, a “polyploid” cell may refer to any cell whose genome is present in more than one copy. A polyploid cell may refer to a type of cell that is naturally found in a polyploid state, or it may refer to a cell that has been induced to exist in a polyploid state (e.g., through specific regulation, alteration, inactivation, activation, or modification of meiosis, cytokinesis, or DNA replication). A polyploid cell may refer to a cell whose entire genome is polyploid, or it may refer to a cell that is polyploid in a particular genomic locus of interest.
[0255] In some embodiments, the fungal cell is a diploid cell. As used herein, a “diploid” cell may refer to any cell whose genome is present in two copies. A diploid cell may refer to a type of cell that is naturally found in a diploid state, or it may refer to a cell that has been induced to exist in a diploid state (e.g., through specific regulation, alteration, inactivation, activation, or modification of meiosis, cytokinesis, or DNA replication). For example, the S. cerevisiae strain S228C may be maintained in a haploid or diploid state. A diploid cell may refer to a cell whose entire genome is diploid, or it may refer to a cell that is diploid in a particular genomic locus of interest. In some embodiments, the fungal cell is a haploid cell. As used herein, a “haploid” cell may refer to any cell whose genome is present in one copy. A haploid cell may refer to a type of cell that is naturally found in a haploid state, or it may refer to a cell that has been induced to exist in a haploid state (e.g., through specific regulation, alteration, inactivation, activation, or modification of meiosis, cytokinesis, or DNA replication). For example, the S. cerevisiae strain S228C may be maintained in a haploid or diploid state. A haploid cell may refer to a cell whose entire genome is haploid, or it may refer to a cell that is haploid in a particular genomic locus of interest.
[0256] The yeast can be modified using any suitable technique, which are generally known in the art and can include recombinant engineering techniques, cloning, TALEs, CRISPR-Cas, and and the like. Methods for transforming yeast cells which can be used to introduce the engineered polynucleotides described herein are well known to the artisan as can be exemplified are reviewed by Kawai et al., 2010, Bioeng Bugs. 2010 November-December; 1(6): 395-403). Non-limiting examples include transformation of yeast cells by lithium acetate treatment (which may further include carrier DNA and PEG treatment), bombardment or by electroporation.
[0257] Modified Microorganisms
[0258] In some aspects, the modified organism is a modified micro-organism.
[0259] In particular embodiments, the micro-organism is selected from the genus Escherichia, Bacillus, Lactobacillus, Rhodococcus, Synechococcus, Synechoystis, Pseudomonas, Aspergillus, Trichoderma, Neurospora, Fusarium, Humicola, Rhizomucor, Kluyveromyces, Pichia, Mucor, Myceliophtora, Penicillium, Phanerochaete, Pleurotus, Trametes, Chrysosporium, Saccharomyces, Stenotrophamonas, Schizosaccharomyces, Yarrowia, or Streptomyces.
[0260] Any of the modified plants described herein can be used to manage
EXAMPLES
[0261] Now having described the embodiments of the present disclosure, in general, the following Examples describe some additional embodiments of the present disclosure. While embodiments of the present disclosure are described in connection with the following examples and the corresponding text and figures, there is no intent to limit embodiments of the present disclosure to this description. On the contrary, the intent is to cover all alternatives, modifications, and equivalents included within the spirit and scope of embodiments of the present disclosure. The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to perform the methods and use the probes disclosed and claimed herein. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.), but some errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, temperature is in ° C., and pressure is at or near atmospheric. Standard temperature and pressure are defined as 20° C. and 1 atmosphere.
Example 1
[0262] This Example can demonstrate the identification of two N. viridula IDS-type genes and encoded enzymes. One gene (abbreviated NvTPS1) can encode an enzyme encodes an enzyme that converts (E,E)-FPP to (Z)-α-bisabolene as the likely precursor of trans-/cis-(Z)-α-bisabolene epoxide. The second gene can have bona fide IDS activity producing (E,E)-FPP. As is further demonstrated herein NvTPS1 is highly expressed in the tissue associated with the abdominal sternites of mature males, which correlates with (Z)-α-bisabolene activity in crude protein extracts of males, while low NvTPS1 transcript levels and enzyme activity were observed in females.
[0263] Materials and Methods.
[0264] Chemicals and Reagents. [1-.sub.3H]-FPP (20 Ci/mmol) was obtained from American Radiolabeled Chemicals (St. Louis, Mo.). Opoponax oil, a source of (Z)-α-bisabolene, was obtain-ed from Floracopeia (Grass Valley, Calif.; reported source, Commiphora guidotti, Sapindales: Burseraceae). All other chemicals were from Sigma-Aldrich (St. Louis, Mo.).
[0265] Preparations of Reference Standards. Preparation of (+)-(S,Z)-α-bisabolene: Opopanax oil (45 ml) was distilled in vacuum to provide (among others) a fraction (2.71 g) with the boiling point 77-78° C. /0.1-0.2 mg Hg. The content of (+)-(S,Z)-α-bisabolene in this fraction according to GC-MS analysis was 65%. This was flash chromatographed on silica with hexanes to provide a fraction (500 mg) containing 87% (+)-(S,Z)-α-bisabolene, which was further purified by chromatography on AgNO.sub.3—SiO.sub.2 eluting with hexanes/ethyl acetate, 97:3, to furnish the desired product (142 mg) of 95% chemical purity. [α]D20+2.0 (c 1.17, EtOH); lit. (Delay and Ohloff 0.1979. Helv Chim Acta 62:369-377) [α]D20+4.15 (1%, EtOH).
[0266] Preparation of (−)-(R,Z)-α-bisabolene: trans-(R,Z)-α-bisabolene epoxide, the enantiomer of the main component of the N. viridula sex pheromone, was prepared from a (+)-limo-nene oxide mixture following Chen et al. (2000. Synthesis. 269-272) [α]D20+8.2 (c 2.65, CH2Cl2); lit. (Baker et al. 1987. J Chem Soc Chem Commun: 414-416) [α]D20+19.1 (c 0.53, CH2Cl2). The retention time and the mass-spectrum of the product were identical to those of an authentic sample of trans-(S,Z)-α-bisabolene epoxide prepared previously from (−)-limonene oxide Chen et al. (2000. Synthesis. 269-272). This epoxide (50 mg, 0.23 mmol) was deoxygenated by stirring at r.t. with zinc (83 mg, 1.27 mmol), sodium iodide (272 mg, 1.81 mmol), sodium acetate (93 mg, 1.13 mmol), and acetic acid (249 μl) in dichloromethane (2 ml) for 18 h following (Scalabrino et al. 2003. Org Biomol Chem 1:318-327) The mixture was filtered through Celite, the filtrate was further diluted with CH.sub.2Cl.sub.2, then washed with NaHCO.sub.3, brine, and dried with Na.sub.2SO.sub.4. After evaporation of the solvent, the residue was chromatographed on silica with hexanes to provide (R,Z)-α-bisabolene (27 mg, 58%), which matched (+)-(S,Z)-α-bisabolene by GC retention time and mass-spectrum but was levorotatory with [α]D20-2.3 (c 1.0, EtOH) and optical purity 66% (ee), as determined by GC analysis on an enantioselective Hydrodex-β-6TBDM column.
[0267] Insects. Acolonyof N. viridula originated with field collections near Tifton, Ga., USA. Insects were reared in ventilated plastic cylinders (21 cm×21 cm o.d.) on a diet of organic green beans, shelled raw sunflower seeds and buckwheat seeds (2:1 w/w), glued onto squares of brown wrapping paper with wheat-based wallpaper paste. Distilled water was supplied in two cotton-stopped 7 cm×2 cm o.d. shell vials held together with a rubber band. Insects were reared in a climate controlled growth chamber (25±5° C., 16:8 h L:D, 65% RH). Eggs were collected weekly and hatched in plastic Petri dishes with a water vial, and after molting to second-instars, the nymphs were transferred to the larger rearing cages as described above for the remaining four instars. Newly enclosed adults were removed from cages three times weekly and moved to new cages, isolating males and females. Insects were kept until the immature (2-3 day post molt) or mature (14-15 day post molt) adult stage.
[0268] Crude Protein Extracts of N. viridula. Abdominal cuticles from one mature (14-15 days post molt) adult male and female N. viridula were used for crude protein assays. Insects were fixed with hexane vapor in a screw top jar and dissected in phosphate buffered saline (PBS) (137 mM NaCl, 8.1 mM Na2HPO4, 1.5 mM NaH2PO4, 2.7 mM KCl, pH 7.2). Head, thorax and abdominal soft tissues were removed except for epithelial cells lining the cuticle. Abdominal cuticles were then frozen in liquid nitrogen, pulverized with a mortar and pestle, and suspended in assay buffer (25 mM HEPES, 5 mM MgCl2, 10% glycerol, 1 mM DTT, pH 7). Protein concentrations were determined with a Bradford Assay (Bio-Rad, Hercules, Calif.) according to the manufacturer's protocol resulting in a protein concentration of 1.2 μg/μl and 0.8 μg/μl for female and male tissue, respectively.
[0269] RNAseq and De Novo Transcriptome Assembly. Total RNA was extracted each from pooled abdominal sternites of five mature (14-15 days post molt) male and five mature female N. viridula using Trizol Reagent (Invitrogen, Thermo Fisher Scientific) according to the manufacturer's protocol. RNAwas DNase treated with RQ1 DNase I (Promega, Madison, Wis.) and purified using the RNeasy Plant Mini Kit (Qiagen, Germantown, Md.). RNA integrity was analyzed on a Bioanalyzer 2100 (Agilent Technologies, Santa Clara, Calif.). RNAseq was performed by Beckman Coulter Genomics (Danvers, Mass.) on an Illumina HiSeq instrument using paired-end (2×100 bp) reads resulting in approximately 82 M reads per sample. Quality of fastq files was assessed using the publically available software FastQC. Based on quality scores, reads were truncated by 9 bp using Trimmomatic (Bolger et al. 2014) to remove low quality sequence and the resulting reads were reanalyzed by FastQC. High quality reads were assembled de novo using Trinity (Grabherr et al. 2011) and assembly quality was verified by aligning processed reads to the assembled transcriptome using Bowtie2 (Langmead and Salzberg. 2012. PNAS 115:E8634-E8641). RNAseq data and gene accession numbers are deposited in GenBank.
[0270] Identification and Cloning of IDS Type Genes. Three putative isoprenyl diphosphate synthase like genes (NvIDS1-NvIDS3) were identified from the transcriptome data with tblastn searches using query sequences of functionally characterized TPS and FPPS from M. histrionica and the bifunctional IDS/TPS from I. pini (Gilg et al. 2005. PNAS 102:9760-9765; Lancaster et al. 2018. PNAS 1150: 115: E8534-E8641; Sparks et al. 2017. Insects 8:55). Primers were designed to clone full-length NvIDS1 (NvTPS_1F/NvTPS_1137R), NvIDS2 (NvFPPS_1F/NvFPPS_1212R) and NvIDS3 (NvIDS3_1F/NvIDS3_1134R) (Table 1). cDNAs were generated from total RNA using GoScript reverse transcriptase (Promega). NvIDS1 and NvIDS2 cDNAs were amplified with Q5 proofreading DNA polymerase (New England Biolabs) and ligated into the pGEM-T Easy vector (Promega). Sequences for NvIDS1 and NvIDS2 were verified before cloning into expression vectors. Sequences have been deposited in the GenBank database under accession numbers MG748543 (NvIDS1/NvTPS), MG748544 (NvIDS2/NvFPPS) and MG748545 (NvIDS3). A cDNA from NvADS3 was not be amplified.
TABLE-US-00002 TABLE 1 List of primers used in Example 1 Amplicon Gene Primers (5′.fwdarw.3′) size (bp) Purpose NvIDS1/NvTPS NcTPS-F 1137 Blunt-end cloning into pGEM-T easy vector ATGGCAGCAAGGGCACCCGTACA SEQ ID NO: 80 NVTPS-R TTAGTTATTTAATACGCTTTCAGCTTCT SEQ ID NO: 81 NvTPS-QF 100 qRT-PCR GTTTGGGCTTCCGTGTGTG SEQ ID NO: 82 NvTPS-QR TACCGAAGTGGCGCTTAACC SEQ ID NO: 83 NvIDS2/NvFPPS NvFPPS-F 1212 Blunt-end cloning into pGEM-T easy vector ATGCCACTTGCAAAACTGTG SEQ ID NO: 84 NvFPPS-R CTACTGCTTTCTGCCATATGTTTTATG SEQ ID NO: 85 NvIDS3 NvIDS3-F 1134 Blunt-end cloning into pGEM-T easy vector ATGGCAGCAAGGGCATC SEQ ID NO: 86 NvIDS3-R TTAAACATACACTTTTATTCTTTCAATTTG SEQ ID NO: 87 RpS4 NvRpS4-F 100 qRT-PCR GCTCGTGGTCCCAAAAAGC SEQ ID NO: 88 NvRpS4-R GACCTGAGCTGGGCCTTG SEQ ID NO: 89
[0271] Heterologous Expression of Recombinant NvFPPS. For expression in bacterial cells, full-length NvFPPS (NvIDS2)cDNA was amplified from the pGEM-T Easy construct with Q5 DNA polymerase and cloned into the pEXP5-NT/TOPO ex-pression vector (Invitrogen, Thermo Fisher Scientific) generating an N-terminal 6× histidine tag. Following transformation of the vector into Escherichia coli BL21(DE3) pLysS (Invitrogen), cells (50 ml) were grown at 37° C. and 220 rpm and induced with 1 mM IPTG at an OD600 of 0.6. Cells were cultivated at 18° C. for another 18 h before the cell pellet was incubated at 4° C. for 30 min in 2 ml extraction buffer (50 mM Tris HCl, pH 7.5, 20 mM imidazole, 300 mM NaCl, 10% glycerol [v/v], 5 mM MgCl2, 2 mM DTT) supplemented with 0.3 mg/ml lysozyme (AppliChem, Maryland Heights, Mo.), 2.5 U/ml benzonase (EMD Millipore, Novagen) and proteinase inhibitors (Protease Inhibitor Mix HP, Serva, Heidelberg, Germany). Upon sonication (4×30 s treatment, Bandelin UW2070, Berlin, Germany; 50%) the recombinant protein was purified from cell lysates on Ni-NTA Spin Columns (Qiagen) according to the manufacturer's instructions. In preparation for enzyme assays, a buffer exchange to 25 mM 3-(N-morpholino)-2-hydroxypropanesulfonic acid (MOPSO, pH 7.2, 10% [v/v] glycerol, 1 mM DTT, 5 mM MgCl2) was conducted on PD-10 Desalting Columns (GE Healthcare Life Sciences, Pittsburgh, Pa.).
[0272] Heterologous Expression of Recombinant NvTPS. Full-length NvTPS (NvIDS1) cDNA was cloned into the pEXP5-NT/TOPO (Invitrogen) expression vector as described above and transformed into E. coli BL21(DE3)pLysS cells. Single colonies were selected at 18° C. on LB with ampicillin (100 μg/ml) and chloramphenicol (34 μg/ml). Expression cultures (200 ml of the same medium) were started from 5 ml overnight cultures and incubated at 18° C. for 4-8 h. Following induction at an OD600 of 0.50 with 0.5 mM IPTG, cells were cultivated for another 48 h, then washed in 100 ml wash buffer (20 mM Tris-HCl, 50 mM KCl, pH 7), pelleted, and resuspended in 15 ml cell lysis buffer (50 mM NaH2PO4, 300 mM NaCl, 5 mM imidazole, 0.5 mM PMSF, 2 mM DTT, pH 8). Upon sonication for 2×30 s (on ice, 1 min interval, 20% amplitude, Branson Digital Sonifier), the recombinant protein was purified with Ni-NTA agarose (Qiagen) using three washes of 30 mM imidazole and elution as a 1 ml fraction with 250 mM imidazole. Buffer exchange into TPS assay buffer (25 mM HEPES, 10 mM MgCl2, 10% glycerol, pH 7) was performed on PD MiniTrap G-25 desalting columns (GE Healthcare Life Sciences).
[0273] IDS Activity Assay and Analysis. IDS enzyme assays were per-formed with 96 μl of purified protein mixed with 2 μl50 μM isopentenyl diphosphate (IPP; Sigma-Aldrich) and 2 μl 50 μM dimethylallyl diphosphate (DMAPP; Sigma-Aldrich). Upon incubation at 30° C. for 2 h, IDS enzyme products were analyzed on an Agilent 1260 HPLC system (Agilent Technologies) coupled to an API 5000 triple-quadrupole mass spectrometer (AB Sciex Instruments) following the protocol described by Beran et al. 2016. PNAS. 113:2922-2927.
[0274] TPS Activity Assay. To determine terpene synthase activity in crude protein extracts of male and female abdominal cuticle tissue, 50 μM (E,E)-FPP was added to protein extracts in assay buffer (see above) containing 50 μg protein at a final volume of 200 μl and with a 200 μl hexane overlay to collect volatiles. Following incubation for 12 h at 30° C., enzyme products were extracted by mixing for 15 s using a vortex and phases were separated by centrifuging at 4000×g for 10 min. One μl of the hexane extract was analyzed by GC-MS.
[0275] TPS activity of purified, recombinant NvTPS protein was determined in assay buffer (see above) with 1 mM DTT and 50 μM allylic substrate [(E,E)-, (Z,E)- or (Z,Z)-FPP] in a total volume of 100 μl and with a 100 μl hexane overlay. Upon incubation at 30° C. for 1 h, assays were stopped on ice and compounds extracted by mixing using a vortex at maximum speed for 15 s. Phases were separated by centrifuging at 4000×g for 10 min and the hexane phase was removed and dried over MgSO4. One μL of the hexane extract was analyzed by GC-MS.
[0276] To determine the apparent Km value of NvTPS for (E,E)-FPP, 0.05 μg of recombinant protein was incubated with increasing concentrations of [1-3H]-(E,E)-FPP (64 μCi mmol-1) in a total volume of 50 μl. Assays were incubated at 30° C. for 5 min prior to extraction of the enzyme product with 250 μl hexane. Assays were performed in triplicate. Quantification of the radioactive product was as described by Tholl et al. (2005. Plant. J. 42:757-771). The Km value was calculated by rectangular hyperbolic regression analysis using Hyperbolic Regression Analysis software (HYPER 1.01) (J. S. Easterby, University of Liverpool).
[0277] Gas Chromatography-Mass Spectrometry Analysis and Determination of Absolute Configuration ofNvTPS Products. GC-MS analysis of hexane extracts from assays with crude protein lysates or NvTPS recombinant protein was performed using split injection (5:1 ratio) at an injection temperature of 240° C. Compounds were separated on a GC-2010 gas chromatograph (Shimadzu, Kyoto, Japan) with a 30 m×0.25 mm i.d.×0.25 μm film Zebron ZB-XLB column (Phenomenex, Torrance, Calif.) coupled to a QP2010S mass spectrometer (Shimadzu). Separation steps were as follows: initial 2 min hold at 40° C., followed by a 5° C./min ramp to 220° C., then a 70° C./min ramp to 240° C. followed by a 2 min hold time at 240° C. Mass spectrometry was performed with a 240° C. ion source temperature, 280° C. interface temperature, electron ionization (EI) potential of 70 eV, and scan range of 50 to 400 amu. Helium was used as a carrier gas at 1.9 ml/min. Enzyme products were identified by library suggestions and comparison to a reference standard (Opoponax oil) for (Z)-α-bisabolene.
[0278] The absolute configurations of the (Z)-α-bisabolene product of NvTPS was determined by separation on a chiral Hydrodex β-6TBDM column (25 m×0.25 mm, ID) in com-parison with the synthetic reference standards (+) and (−)-(Z)-α-bisabolenes. Samples were injected without split at a concentration of about 40 μg/ml (in hexane) and separated at a gradient from 40(5) to 200° C. at 10° C./min with H2 as the carrier gas (2 ml/min), a detector temperature of 200° C., and an injection temperature of 200° C. Comparative analysis of reference standards was performed with a 25:1 split injection of about 1 mg/ml hexane solutions. Separation occurred isother-mally at 200° C. with H2 as the carrier gas (2 ml/min), a detector temperature of 200° C., and an injection temperature of 200° C.
[0279] Gene Expression Analysis. For sex-specific gene expression analysis from whole bugs, mature (15 days post molt) male and female insects were fixed by adding hexane to a sealed jar and then frozen in liquid nitrogen. To determine gene transcript abundance in the cuticle tissue, three mature males or females were treated with hexane and individuals were dissected in PBS. All tissues were removed except the epithelial cells attached to the cuticle. Tissues were kept frozen in liquid nitrogen between dissections. Pooled tissue samples from males and females were stored at −80° C. prior to RNA extraction. cDNAs of RNA extracted from whole bugs of cuticle tissue were generated as described above. Relative transcript abundance was measured by quantitative (Real Time)-Reverse Transcription PCR (qRT-PCR) using the ddCt method and normalized to the 30S ribosomal protein S4 (RpS4) (Livak and Schmittgen. 2001. Methods 25:402-408). Primers were designed to amplify a fragment of approximately 100 bp using Geneious (v. 7.1.9) (Table 1) and tested for non-specific binding. Reaction plates contained 2 μl cDNA (1 ng/μl), 0.6 μL of each primer (300 nM final concentration), 6.8 μl dH2O and 10 μl PowerSYBR Green PCR Master Mix (Applied Biosystems, Thermo Fisher Scientific) per well. The samples were analyzed using an Applied Biosystems 7300 with default settings (50° C. 2 min, 95° C. 10 min followed by 40 cycles of 95° C. 15 s, 60° C. 1 min). Primers were tested for non-specific amplification by analyzing the dissociation curve after PCR. Significance was measured using Student's t test.
[0280] Amino Acid Sequence Alignment and Phylogenetic Analysis. Amino acid sequence alignments were performed in Geneious (v. 7.1.9) using MAFFT with automatic algorithm selection. For phylogenetic analysis, poorly conserved positions were removed using Gblocks (v. 0.91b) with default settings. A consensus tree was built from Bayesian phylogenetic posterior probabilities using MrBayes (v. 3.2.5). Analysis was performed with 2 parallel processes each of 4 MCMC chains sampled every 1000 generations until the standard deviation of split frequencies reached <0.01. The first 25% of saved trees were discarded prior to analysis.
[0281] Results.
[0282] Determination of (Z)-α-Bisabolene Synthase Activity in Crude Protein Extracts. Since the sex pheromone of N. viridula is released from glands at the ventral abdomen of mature males but not from females, we prepared crude protein extracts from the tissue associated with the ventral sternites of males and females and comparatively examined these extracts for the presence or absence of TPS activity. Incubation with (E,E)-FPP and subsequent analysis of hexane-extracted products by GC-MS showed the formation of (Z)-α-bisabolene in extracts from males while only little activity was found in females (
[0283] Identification and Functional Characterization of IDS-Like Genes in N. viridula. To identify possible IDS-like genes associated with the (Z)-α-bisabolene synthase activity in male N. viridula a comparative transcriptome data from tissue associated with the ventral sternites of mature males and females was generated. A tblastn search was performed to search for IDS-type sequences using MhTPS (MG662378.1) and MhFPPS (MG662379.1) from M. histrionica as well as the bifunctional GPPS/TPS (AAX55632.1) and FPPS (AAX55631.1) from Ips pini as query sequences. Three IDS-like sequences (NvIDS1-3, accession numbers MG748543 (NVIDS1) (SEQ ID NO: 1), MG748544 (NvIDS2) (SEQ ID NO: 2), and MG748545 (NvIDS3) (SEQ ID NO: 3), respectively) were found, while no plant or microbial type TPS sequences could be identified. Full length cDNAs of two of these sequences were further amplified: cDNA of NvIDS1 was obtained from RNA extracted from the cuticle associated tissue of mature males and cDNA of NvIDS2 was amplified from the same tissue of mature males and females. The NvIDS1 cDNA (SEQ ID NO: 1) encodes a 43.32 kDa protein containing 379 amino acids (SEQ ID NO: 4) (NvTPS) and the cDNA of NvIDS2 (NvFPPS) (SEQ ID NO: 2) encodes a 46.00 kDa protein consisting of 403 amino acids and can had a sequence according to SEQ ID NO: 5.
TABLE-US-00003 SEQ ID NO: 1 ATGGCAGCAAGGGCACCCGTACACCTCAGAGGATTTATTGCAAGAGTCG CCCTTAACAAGAAAAATCTTCATGCAAGACATAAGCTAGACACAGATAT TGACAAATATTATTACACGCTCCACAATGTAATAATTCCAGATTTTATG GATATGGTTAAGGAAATACCAGGTTATCCAGAAAGGATTAAGAAGTGCG TTGCTCACACCACCCCATCATATTTTGAAGGATGGGCCTTCAGCACCGA ATTAATATACAAAACAGTGGCAGATAAACAACATCAAACAGAAAGGAAC TTAGAAAAGTGTAGAATCATCAGAGCTTTGATGGATATGAGCTATGCGA TGGCAGGAATACTTGATGACTATGTTGACAAAGGTGAGTTCAGACGAGG TAAGAAGGTTTGGGCTTCCGTGTGTGAGGGAGGCCAAGAAGCTGCAATC TACGACTCCATTGCTGTCACCTACTTGATGTCACTTATGGTTAAGCGCC ACTTCGGTACGGATCCAGGATATAGCAAGCTGATAGAATTATTTAATAT GGTTCCTGGCACAGCGGCGATAGGGAACACGCTGGATATCCTTGACCGT CACGACACAAACTACTATGATGATACAATGTGGAAACATTCCGTCCAAA ACAAAGCAGCAAATACTGTATTTCCTGCAGCAACTGCTGGCCTAATTCA TGCAGGAGTACTCTGTGATGACCTACTTGATAGAACTAGTGAAGTGTTT GGCTACACTGGACATCTGTTTCAAGTCTGGGATGATTTCATGGAACACT ACGCTGTGAAAGAACAATCTGGCAAAGGTGCTCCAGATACCAAATATAA CGCAAAAACTTGGGCAACGTTGACTGCAATGGCCCACTTTAATGAAGCC CAAGCCAAGGAGTTTAAGGCCTGCTACGGGTCCACCGATCCAGCCAAAA GATCGAGAGTGCGCGAACTATATGATGAAGTGAATTTACGAGGACTATA TATTGATTATCTCAGAAATACTTATATGGTCGTGGAAGAAAAAATCAGC AAAATTCCCGATCCCAGAATACAAAGTGCCTGTAGAAGCTACATGGATT GGTTGCTTGTTGAACCACCCCAGGATGAAGAAGAAGCTGAAAGCGTATT AAATAACTGA SEQ ID NO: 2 ATGCCACTTGCAAAACTGTGCGCGAAAAAACTTTCAAGCCCTTTAATGA AATTATGTTACCCTAATTTGAACGGAAAATTGCCCTTTAGTAATTTATC TAATATCTTAGACAATTCTTCTTTAAAATTTCATAGCTGCAATCCTCAT ATTACCTGCAGAGGGCTTAGCACAGTTGCACTACGTCCACAGACTATAA CAAAAGATGATAAGAGAGATTTTATGGCTGTATTTCCAGACATTGTTCG GGATTTGACACAACTGAATCCTGGAATATCAGATCTCAGTACTTTAATT TCTAAGATTATGCAATATAATGTATCAGGAGGAAAGAAAGTAAGAGGGC TGACTGTTGTTTATAGTTATCGCATGCTTGCTCCTGACCATGCTTTAAC ACCAGAAAACATCAGGCTGGCCCAGATTTTAGGGTGGTGCGTTGAAATG CTCCAAGGATTTTTCTTAGTTATTGATGATCTTGCTGATCAGTCTATAA CTAGAAGGGGAAGACCCTGTTGGTATAGAAATCCTGATGTTGGACTTCG TGCTGGTTCTGATGCTCTTCTTATACAGTCAGGAACTTTTCAACTGCTT CAACAACATTGCAAAGATAGAGAGTTCTATATTGATCTTGTTGAATTAT TTTTGGATGCTGTAAGGCGTACTACCTATGGACAAACATTAGATCACGT TTCTTCATTTCCTAACATCACTCACTTAACAATGGATAGGTATAACTTT ATCACAAAATATAAAACATCGTACTACACTTTCCATTTGCCAGTAGCCA CTGCAATGTATATGGCTGGTATTTACAATACTGAATTGCATCGTCAAGC TAAAAGTGTTTTACTTGAAATGGGACATTACTTTCAAGTTCAGGATGAC TATCTTGATGTGTTTGGTGATGAAGAAGTTATCGGAAAGATAGGTACTG ATATTCAGGAAGGAAAGTGCACATGGCTAGCTATTGTTGCATTTCAAAG AGCTTCACCATCTCAGAGAGAAATTTTAGAGTCCTGCTATGGAAGTAAA GACCCAGAAAAAATTAAAAAAGTGAAGGATACTTTTATAGAAATTGGTG TTCCTGCAGTTTTTCATGCTTATGAAGAAGAAACATATAATTTGATCAC AAGACAAATACAACAATTAAGTCAAGGCCTGCCTCATGAATTATTTCTT ACATTATTACATAAAACATATGGCAGAAAGCAGTAG SEQ ID NO: 3 ATGGCAGCAAGGGCATCGGTAAATCTAAGAGGTTTTTTAGCAAGAGTCG CGCAAAATAAGGAAAATGTTCATGTAAGACATAAGTTGGACACAGAAAT TGACAAATATTATAAGACACTCCACAATGTAGTCATTCCAGATTGTATG GATTTGGTGAAGGAAATACCAGGTTATCCACAAAGGGTTAAAGAGTGCA TTTCACACACCACCCCATCATATTATGACGGGTGGAACTTCAGCATCGA ATTAATGTATAAAACAGTGGCAGATGAACACCATCAAACAGAAAAGAAC TTGGAAAAGTGTAGAATACTCAGAGCCTTGAAGGATATGAGCTATGCGA TGGCAGGTATAGTTGATGACTATGCTGATAAAGGTGAATACAGACATGG TAAGAAGGTTTGGGCTTCCATATGCGAAGGAGGCCAAGAAGCTGCAATC TACGACTCCGTCGCAGTCAACTACTTGATACTACTGATGCTTCATCGCC ACTTCAGGAATGATCCAGGATACAGCAGGCTGTTAGAACTATATAATAT GGTTCCTGGCACAGCAGCGATAGGAAACACGCTGGATATCCTTGACCGT TACAACTCAAACTACAGTGATGATATATGGAAACATACTGTCCAAAACA AAGCAATGAATTCAATATGTACTGCAGGAGGTACAGGCCTAGTTCATGC TGGAGTTATCTGTGATGACCTGATTGCTAAAACTTGTGATGTTTTTCGC TACACTGGACTTCTGTTTCAAGTGTGGGATGATTTCATGGAATACTATG CTTTGCAAGAACAATCTGGTAAAGGTTCTCCAGATAGCGAATATAATAT AAAATCCTGGGCAACTGTGACTGCAATGGCCCACTTTAATGAAGCCCAA GCTAAGGAGTTTAGGGCCTGCTACGGGTCCAGCGATCCAGCCAAAAGAT CAAGAGTGCGGGAGCTGTATGATGAAGTGAATTTACCAGGACTATACAT GGATTATCTTAGAAATATTCATATGACAATGGAAAAAAAAATTAGCATT ATTCCAAATCCAAGAATACGAAGCGCCTGCACTAGCTATATGGAATGGT TGCTCGTTGAACCACCCAACGTTGAAGAACAAATTGAAAGAATAAAAGT GTATTAA SEQ ID NO: 4 MAARAPVHLRGFIARVALNKKNLHARHKLDTDIDKYYYTLHNVIIPDFM DMVKEIPGYPERIKKCVAHTTPSYFEGWAFSTELIYKTVADKQHQTERN LEKCRIIRALMDMSYAMAGILDDYVDKGEFRRGKKVWASVCEGGQEAAI YDSIAVTYLMSLMVKRHFGTDPGYSKLIELFNMVPGTAAIGNTLDILDR HDTNYYDDTMWKHSVQNKAANTVFPAATAGLIHAGVLCDDLLDRTSEVF GYTGHLFQVWDDFMEHYAVKEQSGKGAPDTKYNAKTWATLTAMAHFNEA QAKEFKACYGSTDPAKRSRVRELYDEVNLRGLYIDYLRNTYMVVEEKIS KIPDPRIQSACRSYMDWLLVEPPQDEEEAESVLNN* SEQ ID NO: 5 MPLAKLCAKKLSSPLMKLCYPNLNGKLPFSNLSNILDNSSLKFHSCNPH ITCRGLSTVALRPQTITKDDKRDFMAVFPDIVRDLTQLNPGISDLSTLI SKIMQYNVSGGKKVRGLTVVYSYRMLAPDHALTPENIRLAQILGWCVEM LQGFFLVIDDLADQSITRRGRPCWYRNPDVGLRAGSDALLIQSGTFQLL QQHCKDREFYIDLVELFLDAVRRTTYGQTLDHVSSFPNITHLTMDRYNF ITKYKTSYYTFHLPVATAMYMAGIYNTELHRQAKSVLLEMGHYFQVQDD YLDVFGDEEVIGKIGTDIQEGKCTWLAIVAFQRASPSQREILESCYGSK DPEKIKKVKDTFIEIGVPAVFHAYEEETYNLITRQIQQLSQGLPHELFL TLLHKTYGRKQ
[0284] To functionally characterize these genes, both full length cDNAs were cloned into the bacterial expression vector pEXP5 generating an N-terminal histidine fusion tag. When tested for TPS activity, partially purified recombinant NvIDS1 protein converted (E,E)-FPP to (Z)-α-bisabolene as the main product (
[0285] Tissue and Sex Specificity of NvTPS and NvFPPS Gene Expression. The sex pheromone of N. viridula is released by mature males from unicellular pheromone glands located in epithelial cells of the abdominal sternites (Cribb et al. 2006. J Morphol 267:831-840). To determine to what extent the TPS activity found in crude lysates of this tissue (
[0286] Enzyme Activity in Crude Protein Assay. Enzyme activity was measured in crude protein extract from whole male and female bugs to determine possible products from enzymes that accept (E,E)-FPP. The supernatant from homogenized bugs was incubated with the substrate and analyzed products extracted by hexane using GC-MS. Chromatographs show (Z)-α-bisabolene present in crude protein from males but not females (see e.g.
[0287] Sequence Comparison and Phylogenetic Analysis of N. viridula IDS and TPS with Other IDS-Like Proteins from Pentatomidae. NvTPS maintains the non-aromatic residues at the fourth and fifth positions upstream of the first aspartate-rich motif (FARM) similar to HB and BMSB but shows a phenylalanine at the fourth position upstream of the second aspartate-rich motif (SARM) (
[0288] An alignment of several proteins used for phylogenetic comparison showed low sequence identities between IDS-type TPSs and the more highly conserved IDS (FPPS) proteins (
[0289] N. viridula Produces the Sesquiterpene Pheromone Precursor (Z)-α-bisabolene. This Example can demonstrate identification NvTPS as an IDS-type TPS, which produces the cyclic sesquiterpene (Z)-α-bisabolene as the presumed precursor of the N. viridula sex pheromone iso-mers trans- and cis-(Z)-α-bisabolene epoxide. The (S) configuration of the identified α-bisabolene matched those of trans- and cis-epoxides and thus provided an unequivocal support for its role as an intermediate in the biosynthesis of the N. viridula sex pheromone.
[0290] (E,E)-FPP, the substrate of NvTPS, is most likely provided by NvFPPS, which was identified as a true trans-IDS enzyme. Conversion of the NvTPS product (Z)-α-bisabolene to trans- or cis-(Z)-α-bisabolene epoxide is presumably catalyzed by a cytochrome P450 epoxidase activity. Similar epoxidations occur in the biosynthesis of fatty acid-derived pheromones and the final step in juvenile hormone biosynthesis (Belles et al. 2005. J Chem Ecol. 27:2397-2423; Blomquist and Vogt. 2003. Insect pheromone biochemistry and molecular biology. The biosynthesis and detection of pheromones and plant volatiles. Elsevier, London). This Example focused on the southeastern United States ecotype of N. viridula, which releases a pheromone with a 3:1 ratio of trans:cis-(Z)-α-bisabolene epoxide (Aldrich et al. 1987. J Exp. Zool 244:171-175). By contrast, a French ecotype emits a 2:1 ratio (Brezot et al. 1994. J Chem Ecol. 20:4133-3147 and Brezot et al. 1993 J Chem Ecol), while the pheromone of a Brazilian ecotype contains no cis isomer (Baker et al. 1987. J Chem Soc Chem Commun: 414-416). It is likely that these ecotype-specific variations in pheromone isomeric composition are generated by differences in product specificity of the final P450 epoxidation step.
[0291] High expression of NvTPS in cells lining the abdominal sternites of N. viridula mature males was observed (
[0292] Evolution of Terpene Synthase Genes in Pentatomidae and Other Insect Lineages. The demonstrated identification of an α-bisabolene producing TPS enzyme in N. viridula is in agreement with similar findings of a homologous TPS enzyme in M. histrionica (Lancaster et al. 2018. PNAS 1150: 115: E8534-E8641), and supports the notion that TPS enzymes have evolved from IDS proteins for de novo biosynthesis of sesquiterpene pheromones in stink bugs. Since similar findings have been reported for the biosynthesis of sesquiterpene and monoterpene aggregation pheromones in P. striolata and Ips pini, respectively, it is likely that TPS homologs have emerged throughout the evolution of different insect lineages. Volatile terpenes are released by insects not only as aggregation and sex pheromones but also exhibit important functions as alarm pheromones such as (E)-β-farnesene in aphids (Pickett et al. 2013. Nat. Prod. Rep 30:1277-1283) or α-farnesene in advanced termites (Sobotnik et al. 2008. J Chem Ecol: 34:478-486). Moreover, terpenes serve as defensive compounds as in the case of papilionid larvae, which release blends of monoterpenes and sesquiterpenes from special organs called osmeteria to ward off predators (Honda 1981. J. Chem Ecol. 7:1089-1113; Omura et al. 2006. J Chem Ecol. 32:1999-2012). Based on the common use of specialized terpenes in insect interactions, it was hypothesized that IDS-derived TPS enzymes have been recruited by various insects in the evolution of distinct intra- and inter-specific communication signals. This can be supported by similar findings of biosynthetic enzymes in the formation of iridoid defense metabolites in larvae of chrysomelid beetles (Bodemann et al. 2012. Proc RSoc B. 279:4126-4134).
[0293] Recent studies of sesquiterpene pheromone biosynthesis in M. histrionica (Lancaster et al. 2018. PNAS 1150: 115: E8534-E8641) and P. striolata (Beran et al. 2016. PNAS. 113:2922-2927), together with the phylogenetic comparison of insect IDS and TPS proteins presented here, suggest that the clades of bona fide IDS enzymes and proteins with TPS function diverged early from a progenitor with trans-IDS activity. It is possible that a clade encompassing all insect TPSs has descended from a common TPS ancestor that emerged from this trans-IDS progenitor; however, the current results provide only weak support for a monophyletic evolution of insect TPS proteins, and more homologs from diverse insect lineages have to be identified to corroborate this assumption.
[0294] Sequence comparisons among the IDS-type TPS proteins in pentatomids show that the TPS from N. viridula is only 38% identical to that of M. histrionica and a putative TPS (IDS-1) from H. halys. NvTPS also shares only 17-19% identity with the TPS enzymes from P. striolata and I. pini indicating plasticity and diversification in the functional evolution of these enzymes similar to those observed for TPS enzymes from other organisms (Chen et al. 2011. Plant J 66:212-229; Dickschat 2016. Nat Prod Rep. 33:87-110). An evolutionary analysis of FPPS and TPS proteins from P. striolata and other insects confirmed that selection of members of the TPS clade is under more relaxed constraints in contrast to a strong purifying selection among true FPPS proteins (Beran et al. 2016. PNAS. 113:2922-2927). Furthermore, in Phyllotreta species, TPSs have diversified into small gene families. This sequence diversification, although at a limited scale, resembles that of plants and microbes; however, it is not apparent in all species since I. pini and the investigated pentatomids seem to have evolved only single TPS proteins with function in pheromone biosynthesis.
[0295] The structural changes underlying the transition from IDS to TPS function in insects are currently unknown. Sequence comparisons demonstrate distinct amino acid differences between bona fide IDS and TPS proteins as indicated for residues at the FARM and SARM motifs (