Fused [1,2,4]Thiadiazine Derivatives Which Act as KAT Inhibitors of the MYST Family
20210380548 · 2021-12-09
Inventors
- Benjamin Joseph Morrow (Parkville, AU)
- Richard Charles Foitzik (Parkville, AU)
- Michelle Ang Camerino (Parkville, AU)
- H. Rachel Lagiakos (Parkville, AU)
- Scott Raymond Walker (Parkville, AU)
- Ylva Elisabet Bergman Bozikis (Parkville, AU)
- Graeme Irvine Stevenson (Parkville, AU)
- Anthony Nicholas Cuzzupe (Mount Eliza, AU)
- Paul Anthony Stupple (Parkville, AU)
Cpc classification
C07D417/12
CHEMISTRY; METALLURGY
C07D285/24
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
International classification
Abstract
A compound of formula (I):
##STR00001##
which inhibits the activity of one or more KATs of the MYST family, i.e., TIP60, KAT6B, MOZ, HBO1, and MOF.
Claims
1. A compound of formula I: ##STR00312## wherein: R.sup.N is H or Me; X.sup.4 is selected from CY and N; X.sup.1, X.sup.2 and X.sup.3 are each selected from CH and N, where none or one of X.sup.1, X.sup.2, X.sup.3 and X.sup.4 are N; Y is selected from the group consisting of: H; halo; cyano; R.sup.2, where R.sup.2 is selected from CH.sub.3, CH.sub.2F, CHF.sub.2 and CF.sub.3; ethynyl; cyclopropyl; OR.sup.3, where R.sup.3 is selected from H, CH.sub.3, CH.sub.2F, CHF.sub.2 and CF.sub.3; NR.sup.N1R.sup.N2, where R.sup.N1 and R.sup.N2 are independently selected from H and CH.sub.3; COQ.sup.1, where Q.sup.1 is selected from C.sub.1-4 alkyl, OH, OC.sub.1-4 alkyl and NR.sup.N1R.sup.N2; NHSO.sub.2Q.sup.3, where Q.sup.3 is C.sub.1-3 alkyl; pyridyl; C.sub.5 heteroaryl, which may be substituted by a group selected from C.sub.1-3 alkyl, which itself may be substituted by OH or CONR.sup.N1R.sup.N2; SO.sub.2Me; C.sub.1-3 alkyl, substituted by NHZ, where Z is H, Me, SO.sub.2Me, or COMe; and C.sub.1-3 alkyl, substituted by OH; Cy is selected from pyridyl, oxazolyl, cyclohexyl, and optionally substituted phenyl, where the optional substituents are selected from the group consisting of: R.sup.2; OR.sup.5, where R.sup.5 is selected from H, CH.sub.3, CH.sub.2F, CHF.sub.2, CF.sub.3 and cyclopropyl; benzyloxy; halo; cyano; amino; C.sub.5 heteroaryl, optionally substituted by methyl, CH.sub.2OH, CH.sub.2OCH.sub.3 or ═O; phenyl; pyridyl, optionally substituted with methyl; COQ.sup.5, where Q.sup.5 is selected from OH and NR.sup.N1R.sup.N2; and CH.sub.2OQ.sup.6, where Q.sup.6 is H or Me; R.sup.1 is selected from the group consisting of: F; phenyl; pyridyl; C.sub.5 heteroaryl, optionally substituted by methyl, CH.sub.2OCH.sub.3, CH.sub.2CF.sub.3, CHF.sub.2, NH.sub.2, or ═O; C.sub.9 heteroaryl; OH; OMe; OPh; COQ.sup.4, where Q.sup.4 is selected from OH, C.sub.1-3 alkyloxy, NR.sup.N5R.sup.N6, where R.sup.N5 is selected from H and Me, and R.sup.N6 is selected from C.sub.1-4 alkyl, which itself may be substituted by CONHMe, or where R.sup.N5 and R.sup.N6 together with the N atom to which they are bound form a C.sub.4-6 N-containing heterocyclyl group, (CH.sub.2).sub.n1CONR.sup.N7R.sup.N8, where n1 is 1 to 3, and R.sup.N7 and R.sup.N8 are independently selected from H and Me, and O(CH.sub.2).sub.n2CONR.sup.N9R.sup.N10, where n2 is 1 or 3 And and R.sup.N9 and R.sup.N10 are independently selected from H and Me; (CH.sub.2).sub.n OQ.sup.7, where n is 1 or 2 and Q.sup.7 is H or Me; NHCO.sub.2Q.sup.8, where Q.sup.8 is C.sub.1-3 alkyl; and OCONR.sup.N5R.sup.N6; R.sup.4 is selected from H, F and methyl; or R.sup.1 and R.sup.4 together with the carbon atom to which they are bound may form a C.sub.4-6 cycloalkyl; and when Cy is pyridyl, cyclohexyl or substituted phenyl, R.sup.1 may additional be selected from H.
2. A compound according to claim 1, wherein X.sup.1, X.sup.2 and X.sup.3 are CH and X.sup.4 is Cy.
3. A compound according to claim 1, wherein: (a) X.sup.1 is N; or (b) X.sup.2 is N; or (c) X.sup.3 is N; or (d) X.sup.4 is N.
4. A compound according to claim 1, wherein Y is selected from the group consisting of: (a) H; (b) halo; (c) I; (d) F; (e) cyano; (f) CH.sub.3; (g) CH.sub.2F; (h) CHF.sub.2; (i) CF.sub.3; (j) ethynyl; and (k) cyclopropyl.
5-16. (canceled)
17. A compound according to claim 1, wherein Y is OR.sup.3.
18-22. (canceled)
23. A compound according to claim 1, wherein Y is NR.sup.N1R.sup.N2, and (a) R.sup.N1 and R.sup.N2 are both H; (b) R.sup.N1 and R.sup.N2 are both Me; or (c) R.sup.N1 is H and R.sup.N2 is Me.
24-26. (canceled)
27. A compound according to claim 1, wherein Y is COQ.sup.1.
28-35. (canceled)
36. A compound according to claim 1, wherein Y is NHSO.sub.2Q.sup.3.
37. (canceled)
38. A compound according to claim 1, wherein Y is pyridyl.
39. A compound according to claim 1, wherein Y is C.sub.5 heteroaryl, which is optionally substituted, wherein the substituent group on the C.sub.5 heteroaryl is selected from unsubstituted C.sub.1-3 alkyl, C.sub.1-3 alkyl substituted by OH, and C.sub.1-3 alkyl substituted by CONR.sup.N1R.sup.N2.
40-44. (canceled)
45. A compound according to claim 1, wherein Y is SO.sub.2Me.
46. A compound according to claim 1, wherein Y is C.sub.1-3 alkyl, substituted by NHZ, where Z is H, Me, SO.sub.2Me, or COMe, or Y is C.sub.1-3 alkyl, substituted by OH.
47-52. (canceled)
53. A compound according to claim 1, wherein R.sup.1 is selected from the group consisting of: (a) H; (b) F; (c) phenyl; (d) pyridyl; (e) C.sub.5 heteroaryl, optionally substituted by methyl, CH.sub.2OCH.sub.3, CH.sub.2CF.sub.3, CHF.sub.2, NH.sub.2, or ═O; (f) C.sub.9 heteroaryl; (g) OH; (h) OMe; (i) OPh; (j) COQ.sup.4; (k) (CH.sub.2).sub.nOQ.sup.7; (l) NHCO.sub.2Q.sup.8, where Q.sup.8 is C.sub.1-3 alkyl; and (m) OCONR.sup.N5R.sup.N6.
54-88. (canceled)
88. A compound according to claim 1, wherein R.sup.4 is H.
89. (canceled)
90. (canceled)
91. A compound according to claim 1, wherein R.sup.1 and R.sup.4 together with the carbon atom to which they are bound form a C.sub.4-6 cycloalkyl.
92-94. (canceled)
95. A compound according to claim 1, wherein Cy is selected from the group consisting of: (a) pyridyl; (b) oxazolyl; (c) cyclohexyl; and (d) unsubstituted phenyl.
96-98. (canceled)
99. A compound according to claim 1, wherein Cy is phenyl bearing a single substituent.
100-102. (canceled)
103. A compound according to claim 99, wherein the phenyl substituent is selected from the group consisting of: a) CH.sub.3; b) CH.sub.2F; c) CHF.sub.2; d) CF.sub.3; e) OCH.sub.3; f) OCH.sub.2F; g) OCHF.sub.2; h) OCF.sub.3; and i) O-cyclopropyl.
104. (canceled)
105. A compound according to claim 99, wherein the phenyl substituent is selected from the group consisting of: (a) benzyloxy; (b) halo; (c) cyano; (d) NH.sub.2; (e) C.sub.5 heteroaryl, optionally substituted by methyl, CH.sub.2OH, CH.sub.2OCH.sub.3 or ═O; (f) phenyl; (g) pyridyl, optionally substituted with methyl; (h) CO.sub.2H; (i) CO.sub.2Me; (j) CONR.sup.N1R.sup.N2, wherein: i) R.sup.N1 and R.sup.N2 are both H; or ii) R.sup.N1 and R.sup.N2 are both Me; or iii) R.sup.N1 is H and R.sup.N2 is Me; (k) CH.sub.2OH; and (l) CH.sub.2OMe.
106-124. (canceled)
125. A compound according to claim 1, wherein R.sup.1 is H and Cy has a substituent in the 2-position, selected from OCHF.sub.2 and a C.sub.5 heteroaryl group selected from oxazolyl, pyrazolyl and triazolyl.
126. A compound according to claim 1, wherein R.sup.1 is selected from oxazolyl, methyl-oxadiazolyl and pyrazolyl and Cy bears no substituent in the 2-position.
127-129. (canceled)
128. (canceled)
130. A pharmaceutical composition comprising a compound according to claim 1 and a pharmaceutically acceptable excipient.
131. A method of treatment of cancer, comprising administering to a patient in need of treatment, a compound according to claim 1.
132. A method according to claim 131, wherein the compound is administered simultaneously or sequentially with radiotherapy and/or chemotherapy
133-136. (canceled)
Description
EXAMPLES
[0292] The following examples are provided solely to illustrate the present invention and are not intended to limit the scope of the invention, as described herein.
[0293] Acronyms
[0294] For convenience, many chemical moieties are represented using well known abbreviations, including but not limited to, methyl (Me), ethyl (Et), n-propyl (nPr), isopropyl (iPr), n-butyl (nBu), tert-butyl (tBu), phenyl (Ph), benzyl (Bn), methoxy (MeO), ethoxy (EtO), trimethylsilyl (TMS), tert-butyldimethylsilyl (TBDMS) and acetyl (Ac).
[0295] For convenience, many chemical compounds are represented using well known abbreviations, including but not limited to, methanol (MeOH), deuterated methanol (d.sub.4-MeOD, methanol-d.sub.4) ethanol (EtOH), isopropanol (i-PrOH), ether or diethyl ether (Et.sub.2O), ethyl acetate (EtOAc), acetic acid (AcOH), acetonitrile (MeCN or ACN), dichloromethane (methylene chloride, DCM), trifluoroacetic acid (TFA), dimethylformamide (DMF), tetrahydrofuran (THF), dimethylsulfoxide (DMSO), deuterated chloroform (CDCl3, chloroform-d), diethylamine (DEA), deuterated dimethylsulfoxide (d.sub.6-DMSO, DMSO-d.sub.6), N-ethyl-N′-(3-dimethylaminopropyl)carbodiimide hydrochloride (EDCI.HCl, EDCI, EDCI.HCl), meta-chloroperoxybenzoic acid (mCPBA), 1,1′-bis(diphenylphosphino)ferrocene (dppf), tert-butyloxycarbonyl (Boc, BOC), 2-(trimethylsilyl)ethoxymethyl (SEM), triethylamine (Et.sub.3N or TEA), 2-(1H-7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate (HATU), 4-dimethylaminopyridine (DMAP), N,N-diisopropylethylamine (DIPEA or DIEA), 1,1′-bis(diphenylphosphino)ferrocene dichloropalladium (II) (PdCl.sub.2(dppf)), trans-dichlorobis(triphenylphosphine)palladium(II) (PdCl.sub.2(PPh.sub.3).sub.2), tris(dibenzylideneacetone) dipalladium(0) (Pd.sub.2(dba).sub.3), tetrakis(triphenylphosphine)palladium(0) (Pd(PPh.sub.3).sub.4), propylphosphonic anhydride (T3P), hexamethylphosphoramide (HMPA), 1,2-dichloroethane (DCE), benzyl (Bn) and 1-hydroxybenzotriazole (HOBt), petroleum ether (pet. ether), 1,8-diazabicyclo[5.4.0]undec-7-ene (DBU), lithium bis(trimethylsilyl)amide (LHMDS or LiHMDS), acetylacetonate (acac), carbonyldiimidazole (CDI), methyl tert-butyl ether (MTBE), diisopropyl azodicarboxylate (DIAD), tetrabutylammonium fluoride (TBAF), methanesulfonyl chloride (MsCl).
[0296] In addition, TLC refers to thin layer chromatography.
[0297] Other abbreviations: overnight (o/n), retention time (rt, RT or R.sub.t), minute(s) (min), hour(s) (h), room temperature (r.t., RT), concentrated (conc.), atmosphere (atm), aqueous (aq.), saturated (sat.), equivalent(s) (eq).
[0298] General Experimental Details
[0299] Unless otherwise stated the following generalisations apply. .sup.1H NMR spectra were recorded on a Bruker Ultrashield Plus (400 MHz) or a Bruker AVANCE (400 MHz). The multiplicity of a signal is designated by the following abbreviations: s, singlet; d, doublet; t, triplet; q, quartet; dd, doublet of doublets; dt, doublet of triplets; tt, triplet of triplets; br, broad; m, multiplet. All observed coupling constants, J, are reported in Hertz (Hz). Exchangeable protons are not always observed.
[0300] LCMS data was generated using either an Agilent 6100 Series Single Quad LCMS-A:, an Agilent 1260 Infinity Series UPLC/MS (LCMS-B) an Agilent 1200 Series Quad LCMS (LCMS-F) or Agilent 1200. Chlorine isotopes are reported as .sup.35Cl, Bromine isotopes are reported as either .sup.79Br or .sup.81Br or both .sup.79Br/.sup.61Br.
[0301] LCMS Method A (LCMS-A):
[0302] Instrument: Agilent 6100 Series Single Quad LC/MS
[0303] Agilent 1200 Series HPLC
[0304] Pump: 1200 Series G1311A Quaternary pump
[0305] Autosampler: 1200 Series G1329A Thermostatted Autosampler
[0306] Detector: 1200 Series G1314B Variable Wavelength Detector
[0307] LC Conditions:
[0308] Reverse Phase HPLC analysis
[0309] Column: Luna C8 (2) 5 μm 50×4.6 mm 100 Å
[0310] Column temperature: 30° C.
[0311] Injection Volume: 5 μL
[0312] Solvent A: Water 0.1% Formic Acid
[0313] Solvent B: MeCN 0.1% Formic Acid
[0314] Gradient: 5-100% solvent B over 10 min
[0315] Detection: 254 nm or 214 nm
[0316] MS Conditions:
[0317] Ion Source: Quadrupole
[0318] Ion Mode: Multimode-ES
[0319] Drying gas temp: 300° C.
[0320] Vaporizer temperature: 200° C.
[0321] Capillary voltage (V): 2000 (positive)
[0322] Capillary voltage (V): 4000 (negative)
[0323] Scan Range: 100-1000
[0324] Step size: 0.1 sec
[0325] Acquisition time: 10 min
[0326] LCMS Method B (LCMS-B):
[0327] Instrument: Agilent 1260 Infinity Series UPLC/MS
[0328] Pump: 1260 Infinity G1312B Binary pump
[0329] Autosampler: 1260 Infinity G1367E 1260 HiP ALS
[0330] Detector: 1290 Infinity G4212A 1290 DAD
[0331] LC Conditions:
[0332] Reverse Phase HPLC analysis
[0333] Column: Poroshell 120 EC-C18 2.7 μm 50×3.0 mm
[0334] Column temperature: 35° C.
[0335] Injection Volume: 1 μL
[0336] Solvent A: Water 0.1% Formic Acid
[0337] Solvent B: MeCN 0.1% Formic Acid
[0338] Gradient: 5-100% solvent B over 3.8 min
[0339] Detection: monitored at 254 nm and 214 nm
[0340] MS Conditions:
[0341] Ion Source: Quadrupole
[0342] Ion Mode: API-ES
[0343] Drying gas temp: 350° C.
[0344] Capillary voltage (V): 3000 (positive)
[0345] Capillary voltage (V): 3000 (negative)
[0346] Scan Range: 100-1000
[0347] Step size: 0.1 sec
[0348] Acquisition time: 5 min
[0349] LCMS Method C (LCMS-C):
[0350] LC model: Agilent 1200
[0351] (Pump type: Binary Pump, Detector type: DAD)
[0352] MS model: Agilent G6110A Quadrupole
[0353] LC Conditions:
[0354] Column: Xbridge-C18, 2.5 μm, 2.1×30 mm
[0355] Column temperature: 30° C.
[0356] Acquisition of wavelength: 214 nm, 254 nm
[0357] Mobile phase: A: 0.07% HCOOH aqueous solution, B: MeOH
[0358] MS Conditions:
[0359] MS: Ion source: ES+ (or ES−) MS range: 50-900 m/z
[0360] Fragmentor: 60 Drying gas flow: 10 L/min
[0361] Nebulizer pressure: 35 psi Drying gas temperature: 350° C.
[0362] Vcap: 3.5 kV
TABLE-US-00002 Gradient Table: Flow (mL/min) T (min) A (%) B (%) 0.5 0.0 70 30 0.5 0.2 70 30 0.5 1.8 5 95 0.5 2.4 5 95 0.5 2.6 70 30 0.5 3.5 70 30
[0363] Sample Preparation:
[0364] The sample was dissolved in methanol, the concentration about 0.11-1 mg/mL, then filtered through syringe filter with 0.22 μm. (Injection volume: 1-10 μL)
[0365] LCMS Method D (LCMS-D):
[0366] LC model: Agilent 1200
[0367] (Pump type: Binary Pump, Detector type: DAD)
[0368] MS model: Agilent G6110A Quadrupole
[0369] LCMS Conditions:
[0370] LC: Column: Xbridge-C18, 2.5 μm, 2.1×30 mm
[0371] Column temperature: 30° C.
[0372] Acquisition of wavelength: 214 nm, 254 nm
[0373] Mobile phase: A: 0.07% HCOOH aqueous solution, B: MeOH
[0374] MS Conditions:
[0375] MS: Ion source: ES+ (or ES−) MS range: 50-900 m/z
[0376] Fragmentor: 60 Drying gas flow: 10 L/min
[0377] Nebulizer pressure: 35 psi Drying gas temperature: 350° C.
[0378] Vcap: 3.5 kV
TABLE-US-00003 Gradient Table: Flow (mL/min) T (min) A (%) B (%) 0.5 0.0 70 30 0.5 0.3 70 30 0.5 0.6 50 50 0.5 0.9 40 60 0.5 1.2 30 70 0.5 3.2 5 95 0.5 3.5 5 95 0.5 4.0 70 30 0.5 5.0 70 30
[0379] Sample Preparation:
[0380] The sample was dissolved in methanol, the concentration about 0.11-1 mg/mL, then filtered through the syringe filter with 0.22 μm. (Injection volume: 1-10 μL)
[0381] LCMS Method F (LCMS-F)
[0382] Instrument: Agilent 1200 series LC
[0383] Agilent 6120 Quadrupole Mass Detector
[0384] Agilent G1968D Active Splitter
[0385] LC Conditions:
[0386] Reverse Phase HPLC analysis
[0387] Column: Agilent Eclipse XDB-C18 5 μm 4.6×150 mm
[0388] Injection loop volume: 900 μL
[0389] QPump Solvent A: Water plus 0.1% formic acid
[0390] QPump Solvent B: Acetonitrile plus 0.1% formic acid
[0391] QPump Gradient: 5-100% B over 10 min
[0392] Flow rate: 1 mL/min
[0393] Detection: 254 nm
[0394] MS Conditions:
[0395] Ion Source: Quadrupole
[0396] Ion Mode: ES
[0397] Vaporiser Temp: 200° C.
[0398] Gas Temp: 300° C.
[0399] Capillary voltage positive (V): 4000
[0400] Capillary voltage negative (V): 4000
[0401] Scan Range: 100-700 Amu
[0402] Acquisition time: 10 min
[0403] Isocratic Pump (make-up flow):
[0404] Flow rate: 0.5 mL/min
[0405] Solvent: 50:50 water: acetonitrile plus 0.1% formic acid
[0406] LC-MS Method SYN-P-M (ES+)/SYN-N-M (ES−)
[0407] LC model: Agilent 1200; Pump type: Binary Pump, Detector type: DAD
[0408] MS model: Agilent G6110A Quadrupole
[0409] LC Conditions
[0410] LC: Column: Xbridge-C18, 2.5 μm, 2.1×30 mm
[0411] Column temperature: 30° C. [0412] Acquisition of wavelength: 214 nm, 254 nm [0413] Mobile phase: A: 0.07% HCOOH aqueous solution, B: MeOH [0414] Run time: 5 min
[0415] MS Conditions
[0416] Ion source: ES+ (or ES−) MS range: 50-900 m/z
[0417] Fragmentor: 60 Drying gas flow: 10 L/min
[0418] Nebulizer pressure: 35 psi Drying gas temperature: 350° C.
[0419] Vcap: 3.5 kV
TABLE-US-00004 Gradient Table Gradient Flow A B Method Name (LCMS) (ml/min) T (min) (% yield) (% yield) SYN-P-M (ES+) 0.5 0.0 70 30 or 0.5 0.3 70 30 SYN-N-M (ES−) 0.5 0.6 50 50 0.5 0.9 40 60 0.5 1.2 30 70 0.5 3.2 5 95 0.5 3.5 5 95 0.5 4.0 70 30 0.5 5.0 70 30
[0420] Sample preparation: The sample was dissolved in methanol, approximate concentration 0.11˜1 mg/mL, then filtered through the syringes filter with 0.22 μm. (Injection volume: 1˜10 μL)
[0421] Preparative RP-HPLC:
[0422] Agilent 1260 Infinity HPLC system
[0423] UV detection at 210 nm and 254 nm
[0424] Gradient or isocratic elution through a Phenomenex Luna C8 (2) column 100 Å Axia (250×21.2 mm; particle size 5 μm)
[0425] Flow rate: 10 mL/min
[0426] Gradients are as specified in the individual examples.
[0427] Analytical thin-layer chromatography was performed on Merck silica gel 60 F254 aluminium-backed plates which were visualised using fluorescence quenching under UV light or a basic KMnO.sub.4 dip or Ninhydrin dip.
[0428] Preparative thin-layer chromatography (preparative TLC or prep. TLC) was performed using Tklst (China), grand grade: (HPTLC): 8±2 μm>80%; (TLC): 10-40 μm. Type: GF254. Compounds were visualised by UV (254 nm).
[0429] Flash chromatography was performed using a Biotage Isolera purification system using either Grace, SepaFlash® or RediSep® silica cartridges.
[0430] Column chromatography was performed using Tklst (China), grand grade, 100-200 meshes silica gel.
[0431] Microwave irradiation was achieved using a CEM Explorer SP Microwave Reactor.
[0432] Where necessary, anhydrous solvents were purchased from Sigma-Aldrich or dried using conventional methods.
[0433] Additional Cartridges used are as follows:
[0434] Phase Separator:
[0435] Manufacturer: Biotage
[0436] Product: ISOLUTE® Phase Separator (3 mL unless otherwise stated)
[0437] SCX and SCX-2 Cartridges:
[0438] Manufacturer: Biotage
[0439] Product: ISOLUTE® SCX 1 g, (6 mL SPE Column unless otherwise stated)
[0440] Manufacturer: Biotage
[0441] Product: ISOLUTE® SCX-2 1 g (6 mL Column)
[0442] Manufacturer: Silicycle
[0443] Product: SCX-2 500 mg or 5 g or 10 g
[0444] Manufacturer: Agilent
[0445] Product: Bond Elut® SCX 10 g
[0446] Sample Extraction Cartridge:
[0447] Manufacturer: Waters Product: Oasis® HLB 35 cc (6 g) LP extraction cartridge
[0448] Si-Amine Cartridges:
[0449] Manufacturer: Agilent
[0450] Product: Bond Elut NH2 10 g
[0451] Synthesis of Intermediates
(i) Ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I2)
[0452] ##STR00021##
a) Ethyl 2-oxo-2-((2-sulfamoylphenyl)amino)acetate (I1)
[0453] To solution of 2-aminobenzenesulfonamide (10.000 g, 58.070 mmol) in THF (500 mL), at 0° C., was added NEt.sub.3 (8.50 mL, 60.973 mmol) followed by the dropwise addition of ethyl chlorooxoacetate (6.81 mL, 60.973 mmol) over 10 min. This was allowed to slowly warm to ambient temperature o/n. The precipitate was removed by filtration and the filtrate was concentrated in vacuo. The resulting solid was slurried in warm EtOAc (50 mL), then filtered. The solid material was washed with a further portion of EtOAc (50 mL), then air dried to reveal ethyl 2-oxo-2-((2-sulfamoylphenyl)amino)acetate (12.399 g, 78% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO): δ 10.77 (s, 1H), 8.25 (dd, J=8.3, 1.1 Hz, 1H), 7.89 (dd, J=8.0, 1.5 Hz, 1H), 7.69 (s, 2H), 7.69-7.64 (m, 1H), 7.37 (ddd, J=8.0, 7.4, 1.2 Hz, 1H), 4.32 (q, J=7.1, 7.1, 7.1 Hz, 2H), 1.33 (t, J=7.1, 7.1 Hz, 3H). LC-MS (LCMS:B): rt 3.409 min; m/z 271.1 [M−H] (−ve); no corresponding product ions present in +ve mode.
b) Ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I2)
[0454] To dry EtOH (200 mL), under a nitrogen atmosphere, was added NaH (60% dispersion in mineral oil, 1.463 g, 36.580 mmol) cautiously. This was allowed to stir for 15 min, upon which ethyl 2-oxo-2-(2-sulfamoylphenylamino)acetate (11) (8.300 g, 30.483 mol) was added. This stirred for a further 3 h, upon which water (400 mL) was added and the pH adjusted to 3 using 2N aqueous HCl. The EtOH was removed in vacuo, and the precipitate filtered. The solid was washed with water, then air dried to reveal ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (5.575 g, 72% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO): δ 12.74 (s, 1H), 7.88-7.85 (m, 1H), 7.79-7.72 (m, 2H), 7.54 (ddd, J=8.2, 6.3, 2.1 Hz, 1H), 4.40 (q, J=7.1, 7.1, 7.1 Hz, 2H), 1.36 (t, J=7.1, 7.1 Hz, 3H). LC-MS (LCMS:B): rt 3.349 min; m/z 255.1 [M+H].sup.+.
(ii) Ethyl 7-bromo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I5)
[0455] ##STR00022##
a) 2-Aminobenzenesulfonamide (I3)
[0456] A mixture of 2-nitrobenzenesulfonamide (50 g, 245 mmol), zinc dust (81 g, 1.24 mol) and NH.sub.4Cl (66 g, 1.24 mol) in EtOH (750 mL) and water (200 mL) was heated at 80° C. overnight then allowed to cool to r.t. The mixture was filtered and the solid was washed with DCM (20 mL). The filtrate was washed with brine, dried over sodium sulfate, filtered and concentrated to give the product (35 g, 82% yield) as a yellow solid. LCMS (ES-API): R.sub.t 0.38 min; m/z 173.1 [M+H].sup.+.
b) 2-Amino-5-bromobenzenesulfonamide (I4)
[0457] To a solution of 2-aminobenzenesulfonamide (I3) (20 g, 116 mmol) in CH.sub.3COOH (200 mL) at r.t. was added a solution of Br.sub.2 (10.9 g, 68 mmol) in CH.sub.3COOH (200 mL) and the mixture was stirred at r.t. for 20 min then poured into ice-water (400 mL). The mixture was filtered and the solid was washed with water (100 mL). The combined filtrates were concentrated to give the product as a brown solid (17.2 g, 59% yield). LCMS (ES-API): R.sub.t 1.11 min; m/z 250.9/252.9 [M+H].sup.+.
c) Ethyl 7-bromo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I5)
[0458] To a solution of 2-amino-5-bromobenzenesulfonamide (I4) (10 g, 39.8 mmol) and ethyl carbonocyanidate (39.5 g, 398 mmol) in CH.sub.3COOH (100 mL) at r.t. was added conc. HCl (10 mL) and the mixture was heated at 80° C. for 3 h then poured into ice-water (200 mL) and stirred for 1 h. The mixture was filtered and the solid was washed with water (100 mL). The combined filtrates were concentrated to give the product as a white solid (8 g, 60% yield). LCMS (ES-API): R.sub.t 1.78 min; m/z 332.9/334.9 [M+H].sup.+.
(iii) Ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I7)
[0459] ##STR00023##
a) 2-Amino-5-iodobenzenesulfonamide (I6)
[0460] To a solution of 2-aminobenzenesulfonamide (I3) (3 g, 17.4 mmol) in CHCl.sub.3 (150 mL) at −20° C. was added a solution of ICI (1.98 g, 12.2 mmol) in CHCl.sub.3 (150 mL) and the mixture was stirred at −20° C. for 30 min. The mixture was filtered and the solid was washed with CHCl.sub.3 (50 mL) and 2 M aqueous NaHCO.sub.3 (50 mL) then dried to give the product as a brown solid (3.3 g, 63% yield). LCMS (ES-API) R.sub.t 1.34 min; m/z 298.9 [M+H].sup.+.
b) Ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I7)
[0461] To a solution of 2-amino-5-iodobenzenesulfonamide (I6) (2 g, 6.7 mmol) and ethyl carbonocyanidate (6.5 g, 67 mmol) in CH.sub.3COOH (40 mL) at r.t. was added conc. HCl (2 mL) and the mixture was heated at 80° C. for 3 h then poured into ice-water (50 mL). The mixture was stirred for 1 h, filtered and the solid was washed with water (50 mL) then air dried to give the product as a brown solid (1.9 g, 75% yield). LCMS (ES-API) R.sub.t 2.26 min; m/z 380.9 [M+H].sup.+. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.8 (brs, 1H), 8.12 (d, J=2.0 Hz, 1H), 8.08 (dd, J=8.8, 2.0 Hz, 1H), 7.57 (d, J=8.8 Hz, 1H), 4.40 (t, J=7.2 Hz, 2H), 1.36 (t, J=7.2 Hz, 3H).
(iv) Ethyl 2H-pyrido[3,4-e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I13)
[0462] ##STR00024##
a) 3-Nitropyridine-4-thiol (I8)
[0463] A mixture of 4-chloro-3-nitropyridine (15 g, 94.6 mmol) and NaSH.H.sub.2O (14 g, 189 mmol) in MeOH (100 mL) was stirred at r.t. for 10 min then heated at 60° C. for 10 min. The solvent was removed and the residue was dissolved in water and acidified to pH 6 with 1 M aqueous HCl. The resulting precipitate was collected by filtration, washed with water and air dried to give the product (10 g, 69% yield) as a yellow solid. LCMS (ES-API): R.sub.t 0.31 min; m/z 43.0 [M+H].sup.+.
b) S-(3-Nitropyridin-4-yl)thiohydroxylamine (I9)
[0464] To a 28% solution of aqueous NaClO (300 mL) at −10° C. was added conc. NH.sub.4OH (60 mL) dropwise with stirring. After 20 min, a solution of 3-nitropyridine-4-thiol (I8) (17 g, 0.11 mol) in 2 M aqueous NaOH (60 mL) was added and stirring was continued for a further 1 h. The precipitate was collected by filtration and air dried to give the product (12 g, 67% yield) as a yellow solid. LCMS (ES-API): R.sub.t 0.57 min; m/z 172.0 [M+H].sup.+.
c) 3-Nitropyridine-4-sulfinamide (I10)
[0465] To a mixture of S-(3-nitropyridin-4-yl)thiohydroxylamine (I9) (9.0 g, 52.6 mmol) in DCM (200 mL) at −5° C. was added m-CPBA (17 g, 78.9 mmol) in portions and the mixture was stirred at r.t. for 3 h. The mixture was concentrated and the residue was purified by column chromatography (EtOAc/Pet. Ether=1:1) to give the product (2.5 g, 25% yield) as a yellow solid. LCMS (ES-API): R.sub.t 0.35 min; m/z 187.9 [M+H].sup.+.
d) 3-Nitropyridine-4-sulfonamide (I11)
[0466] To a suspension of 3-nitropyridine-4-sulfinamide (I10) (2.0 g, 10.68 mmol) and water (1.92 g, 107 mmol) in ACN (60 mL) at 0° C. was added iodosylbenzene (2.59 g, 11.75 mmol) and the mixture was allowed to warm to r.t. and stirred for 2 h. The mixture was concentrated and the residue was purified by column chromatography (MeOH/DCM=1:80) to give the product (1.75 g, 81% yield) as a yellow solid. LCMS (ES-API): R.sub.t 0.36 min; m/z 203.9 [M+H].sup.+.
e) 3-Aminopyridine-4-sulfonamide (I12)
[0467] A mixture of 3-nitropyridine-4-sulfonamide (I11) (2.0 g, 9.89 mmol) and 10% Pd/C (200 mg) in EtOH (60 mL) was heated at 50° C. under 1 atm of H.sub.2 for 16 h. The mixture was filtered through Celite® and the filtrate was concentrated to give the product (1.2 g, 70% yield) as a white solid. LCMS (ES-API): R.sub.t 0.30; m/z 174.0 [M+H].sup.+.
f) Ethyl 2H-pyrido[3,4-e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I13)
[0468] A mixture of 3-aminopyridine-4-sulfonamide (I12) (500 mg, 2.89 mmol), ethyl 2-ethoxy-2-iminoacetate (629 mg, 4.34 mmol) and DBU (879 mg, 5.78 mmol) in EtOH (10 mL) was heated in a microwave at 135° C. for 30 min then allowed to cool to r.t. The mixture was concentrated and the residue was dissolved in water, acidified to pH 2 with 1 M aqueous HCl and extracted with EtOAc. The organic layer was washed with water and brine, dried over Na.sub.2SO.sub.4, filtered, concentrated and the residue was purified by preparative TLC (MeOH/DCM=1:20) to give the product (50 mg, 7% yield) as a yellow solid. LCMS (ES-API): R.sub.t 0.51 min; m/z 255.9 [M+H].sup.+. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 13.2 (brs, 1H), 9.09 (s, 1H), 8.81 (d, J=5.2 Hz, 1H), 7.88 (d, J=5.2 Hz, 1H), 4.42 (t, J=7.2 Hz, 2H), 1.37 (t, J=7.2 Hz, 3H).
(v) Ethyl 2H-pyrido[4,3-e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I14)
[0469] ##STR00025##
[0470] A mixture of 4-chloropyridine-3-sulfonamide (500 mg, 2.6 mmol), ethyl 2-ethoxy-2-iminoacetate (565 mg, 3.9 mmol) and DBU (790 mg, 5.2 mmol) in ethanol (10 mL) was heated in a sealed tube at 150° C. for 0.5 h then cooled to r.t. The mixture was diluted with water (5 mL), adjusted to pH 5 with 1 M aqueous HCl and exacted with DCM (10 mL×3). The combined organic extracts were washed with brine, dried over sodium sulfate and concentrated. The residue was purified by preparative TLC (MeOH/DCM=1:20, v/v) to give the product as a yellow solid (100 mg, 15% yield). LCMS (ES-API) R.sub.t 0.47 min; m/z 256 [M+H].sup.+. .sup.1H NMR (400 MHz, d.sub.6-DMSO), 9.05 (s, 1H), 8.76 (d, J=5.6 Hz, 1H), 7.64 (d, J=5.6 Hz, 1H), 4.40 (q, J=7.2 Hz, 2H), 1.37 (t, J=7.2 Hz, 3H).
(vi) Ethyl 2H-pyrido[2,3-e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I16)
[0471] ##STR00026##
a) 2-Chloropyridine-3-sulfonamide (I15)
[0472] A solution of 2-chloropyridine-3-sulfonyl chloride (3 g, 14.1 mmol) in dioxane (50 mL) was added to a solution of conc. NH.sub.4OH (50 mL) at 0° C. and the mixture was stirred at r.t. for 2 h then extracted with DCM (3×10 mL). The combined organic extracts were washed with brine, dried over sodium sulfate, filtered and concentrated. The residue was purified by column chromatography (MeOH/CHCl.sub.3=0:100-1:10) to give the product as a yellow solid (2.4 g, 88% yield). LCMS (ES-API): R.sub.t 1.79 min; m/z 193/195 [M+H].sup.+.
b) Ethyl 2H-pyrido[2,3-e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I16)
[0473] A mixture of 2-chloropyridine-3-sulfonamide (I15) (50 mg, 0.26 mmol), ethyl 2-ethoxy-2-iminoacetate (56 mg, 0.39 mmol) and DBU (79 mg, 0.52 mmol) in ethanol (5 mL) was heated in a sealed tube at 130° C. for 0.5 h then cooled to r.t. The mixture was diluted with water (5 mL), adjusted to pH 5 with 1 M aqueous HCl and extracted with DCM (10 mL×3).
[0474] The combined organic extracts were washed with brine, dried over sodium sulfate, filtered and concentrated. The residue was purified by preparative TLC (MeOH/DCM=1:20) to give the product as a yellow solid (10 mg, 15% yield). LCMS (ES-API) R.sub.t 0.51 min; m/z 256.1 [M+H].sup.+. .sup.1H NMR (400 MHz, d.sub.6-DMSO) 8.81 (dd, J=4.8, 2.0 Hz, 1H), 8.43 (dd, J=8.0, 1.6 Hz, 1H), 7.63 (dd, J=8.0, 4.8 Hz, 1H), 4.41 (q, J=7.2 Hz, 2H), 1.37 (t, J=7.2 Hz, 3H).
(vii) Ethyl 2H-pyrido[3,2-e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I21)
[0475] ##STR00027##
a) 2-(Benzylthio)-3-nitropyridine (I17)
[0476] A mixture of 2-chloro-3-nitropyridine (10 g, 63.1 mmol), phenylmethanethiol (8.6 g, 69.4 mmol) and K.sub.2CO.sub.3 (9.6 g, 69.4 mmol) in EtOH (300 mL) and water (60 mL) was stirred at r.t. overnight. Water was added with stirring and the resulting precipitate was collected by filtration, washed with water and dried under reduced pressure to give the product (10 g, 65% yield) as a yellow solid. LCMS (ES-API): R.sub.t 2.96 min; m/z 247.0 [M+H].sup.+.
b) 3-Nitropyridine-2-sulfonyl Chloride (I18)
[0477] To a mixture of 2-(benzylthio)-3-nitropyridine (I17) (6 g, 24.4 mmol) in water (24 mL), AcOH (12 mL) and DCM (84 mL) at r.t. was added 1,3-dichloro-5,5-dimethylimidazolidine-2,4-dione (14.4 g, 73.1 mmol). The mixture was stirred at r.t. for 16 h then poured into water and extracted with DCM. The organic extract was washed with water, brine, dried over Na.sub.2SO.sub.4, filtered and concentrated to give the product (5 g), which was used directly in the next step without further purification.
c) 3-Nitropyridine-2-sulfonamide (I19)
[0478] A solution of 3-nitropyridine-2-sulfonyl chloride (I18) (5 g, 22.5 mmol) in DCM (100 mL) was added dropwise to a solution of conc. NH.sub.4OH (100 mL) at 0° C. with stirring. The mixture was stirred for 30 min then concentrated and the residue was purified by column chromatography (MeOH/DCM=1:30) to give the product (2.2 g, 44% for two steps) as a yellow solid. LCMS (ES-API): R.sub.t 0.43 min; m/z 204.0 [M+H].sup.+.
d) 3-Aminopyridine-2-sulfonamide (I20)
[0479] A mixture of 3-nitropyridine-2-sulfonamide (I19) (1.0 g, 4.92 mmol) and 10% Pd/C (100 mg) in EtOH (20 mL) was heated at 50° C. under 1 atm of H.sub.2 for 16 h. The mixture was filtered through Celite and the filtrate was concentrated to give the product (0.7 g, 82% yield) as a yellow solid. LCMS (ES-API): R.sub.t 0.28 min; m/z 714.0 [M+H].sup.+.
e) Ethyl 2H-pyrido[3,2-e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I21)
[0480] A mixture of 3-aminopyridine-2-sulfonamide (I20) (500 mg, 2.89 mmol), ethyl 2-ethoxy-2-iminoacetate (629 mg, 4.34 mmol) and DBU (879 mg, 5.78 mmol) in EtOH (10 mL) was heated at 125° C. in a microwave for 25 min then cooled to r.t. The mixture was concentrated and the residue was diluted with water, acidified to pH 2 with 1 M aqueous HCl and extracted with EtOAc. The organic layer was washed with water, brine, dried over Na.sub.2SO.sub.4, filtered and concentrated. The residue was purified by prep. TLC (MeOH/DCM=1:20) to give the desired product (120 mg, 16% yield) as a yellow solid. LCMS (ES-API): R.sub.t 0.39 min; m/z 256.0 [M+H].sup.+. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.8 (brs, 1H), 8.70 (dd, J=4.4 Hz, 1.2 Hz, 1H), 8.17 (dd, J=8.4 Hz, 1.2 Hz, 1H), 7.81 (dd, J=8.4, 4.8 Hz, 1H), 4.41 (q, J=7.2 Hz, 2H), 1.36 (t, J=7.1 Hz, 3H).
(viii) Methyl 7-(trifluoromethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I24)
[0481] ##STR00028##
a) 5-(Trifluoromethyl)-2-((3,4,5-trimethoxybenzyl)amino)benzenesulfonamide (I22)
[0482] 2-Chloro-5-(trifluoromethyl)benzenesulfonamide (1.34 g, 5.16 mmol) and 3,4,5-trimethoxybenzylamine (4.0 mL, 23 mmol) were heated at 130° C. overnight. The mixture was cooled and added to water (200 mL) with the aid of DMF (2 mL). The mixture was adjusted to pH 5 with acetic acid and sonicated. The mixture was filtered, the collected solid washed with water (2×50 mL) and air dried. Chromatography (40 g silica cartridge, 0-100% ethyl acetate/hexanes) gave the product as a solid (1.52 g, 70% yield). LCMS-A rt 5.93 min; m/z (negative ion) 419.1 [M−H]. .sup.1H NMR (400 MHz, DMSO-d6) δ 7.88 (dd, J=2.2, 0.9 Hz, 1H), 7.68 (s, 2H), 7.61 (dd, J=8.9, 2.4 Hz, 1H), 6.92-6.84 (m, 2H), 6.74 (s, 2H), 4.47 (d, J=5.9 Hz, 2H), 3.73 (s, 6H), 3.62 (s, 3H).
b) 2-Amino-5-(trifluoromethyl)benzenesulfonamide (I23)
[0483] 5-(Trifluoromethyl)-2-((3,4,5-trimethoxybenzyl)amino)benzenesulfonamide (I22) (1.878 g, 4.27 mmol) was dissolved in TFA (10 mL) and stirred at room temperature overnight. The mixture was concentrated in vacuo, the residue diluted with water (30 mL) and adjusted to pH 13 with 20% w/v aqueous sodium hydroxide. The mixture was filtered, the gummy precipitate washed with water (50 mL), and the precipitate transferred to a flask with ethanol. The mixture was concentrated in vacuo. Chromatography (40 g silica cartridge, 0-100% ethyl acetate/hexanes) gave the product as a yellow solid (766 mg, 75% yield). LCMS-A rt 5.31 min; m/z (negative ion) 239.0 [M−H]. .sup.1H NMR (400 MHz, DMSO-d6) δ 7.83-7.78 (m, 1H), 7.56-7.50 (m, 1H), 7.45 (s, 2H), 6.93 (dd, J=8.7, 0.9 Hz, 1H), 6.49 (s, 2H).
c) Methyl 7-(trifluoromethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I24)
[0484] Methyl 2,2,2-trimethoxyacetate (0.521 mL, 3.58 mmol), 2-amino-5-(trifluoromethyl)benzenesulfonamide (I23) (172 mg, 0.716 mmol), 4-methylbenzenesulfonic acid (0.025 g, 0.14 mmol) and methanol (0.5 mL) were heated in the microwave (120° C./30 min). The mixture was cooled to room temperature and filtered to give the product as a white solid (52 mg). Additional product was recovered by chromatography of the filtrate (0-60% ethyl acetate/hexanes) (55 mg). Total product 107 mg, 47% yield. LCMS-B rt 3.13 min; m/z (negative ion) 306.8 [M−H]. .sup.1H NMR (400 MHz, DMSO-d6) δ 8.21-8.19 (m, 1H), 8.12 (dd, J=8.9, 2.1 Hz, 1H), 7.96 (d, J=8.8 Hz, 1H), 3.95 (s, 3H). 19F NMR (376 MHz, DMSO-d6) δ −61.03.
(ix) 2-(Oxazol-2-yl)-2-phenylethanamine (I27)
[0485] ##STR00029##
a) 2-Benzyloxazole (I25)
[0486] To a solution of 1H-1,2,3-triazole (26.8 g, 388 mmol) in sulfolane (500 mL) at 0° C. was added 2-phenylacetyl chloride (50 g, 323 mmol) and K.sub.2CO.sub.3 (67 g, 485 mmol) and the mixture was stirred at r.t. for 20 min, then heated at 165° C. for 30 min. The mixture was cooled to r.t. and partitioned between water (3000 mL) and ether (500 mL). The layers were separated and the aqueous phase was extracted with ether (3×1000 mL). The combined organic extracts were washed with water, brine, dried over sodium sulfate, filtered and concentrated. The residue was purified by column chromatography (Petroleum ether/EtOAc=30:1-5:1) to give the desired product (25 g, 51% yield) as a yellow oil. LCMS (ES-API): R.sub.t 2.78 min; m/z 160.1 [M+H].sup.+.
b) 2-(2-(Oxazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione (I26)
[0487] To a solution of 2-benzyloxazole (I25) (10 g, 62.8 mmol) in THF (350 mL) at −78° C. under nitrogen was added LHMDS (1 M solution in THF, 75.4 mL, 75.4 mmol) dropwise. A solution of 2-(bromomethyl)isoindoline-1,3-dione (18.1 g, 75.4 mmol) in THF (50 mL) was then added dropwise and the mixture allowed to warm slowly to r.t. and stirred overnight. The mixture was diluted with a saturated aqueous NH.sub.4Cl solution (300 mL) and water (150 mL), then extracted with DCM (1000 mL×3). The combined organic extracts were dried over anhydrous sodium sulphate, filtered, concentrated and purified by column chromatography (Petroleum ether/EtOAc=20:1-5:1) to give the desired product (5 g, 25% yield) as a white solid. LCMS (ES-API): R.sub.t 2.62 min; m/z 319.1 [M+H].sup.+.
c) 2-(Oxazol-2-yl)-2-phenylethanamine (I27)
[0488] To a solution of 2-(2-(oxazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione (I26) (4.2 g, 13.2 mmol) in ethanol (30 mL) was added hydrazine hydrate (2.7 g, 42.2 mmol) and the mixture was heated at 80° C. under nitrogen for 3 h. The mixture was filtered and the solid was washed with ethanol (30 mL). The filtrate was concentrated under reduced pressure and the residue was partitioned between DCM (50 mL) and saturated aqueous NaHCO.sub.3 (50 mL). The layers were separated and the aqueous layer was extracted with DCM (100 mL×3). The combined organic extracts were washed with brine, dried over anhydrous sodium sulphate, filtered and concentrated to give the title product (1.4 g, 56% yield) as a yellow oil. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 7.99 (d, J=0.6 Hz, 1H), 7.34-7.30 (m, 2H), 7.27-7.20 (m, 3H), 7.17 (s, 1H), 4.18 (dd, J=8.3, 6.3 Hz, 1H), 3.24-3.23 (m, 1H), 3.03-2.98 (m, 1H). LCMS (ES-API): R.sub.t 2.23 min; m/z 189.1 [M+H].sup.+.
(x) 2H-Benzo[e][1,2,4]thiadiazine-3-carbonyl chloride 1,1-dioxide (I30)
[0489] ##STR00030##
a) Ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I2—Alternate Synthesis)
[0490] A mixture of 2-aminobenzenesulfonamide (I3) (17 g, 98.22 mmol) and ethyl cyanoacetate (16 g, 197.4 mmol) in acetic acid (150 mL) and conc. HCl (15 mL) was heated at 80° C. under N.sub.2 for 3 h. Most of the solvent was removed and then water (300 mL) was added. The resulting mixture was stirred at 0° C. for 2 h and the resulting precipitate was collected by filtration and washed with water. The solid was dissolved in EtOAc, washed with water and dried over Na.sub.2SO.sub.4 The solvent was removed and the residue was purified by silica gel column chromatography (DCM/MeOH=100:1-40:1) to give the desired product (7.2 g, 29% yield) as a white solid. LCMS (ES-API): R.sub.t 0.66 min; m/z 255.0 [M+H].sup.+.
b) 2H-Benzo[e][1,2,4]thiadiazine-3-carboxylic Acid 1,1-dioxide (I29)
[0491] A mixture of ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (10 g, 39.3 mmol) in 2 M aqueous LiOH (50 mL) was stirred at r.t. for 3 h. The mixture was diluted with water (100 mL) and washed with EtOAc (×2) then adjusted pH 1-2 and extracted with DCM (100 mL×2). The organic layers were combined, washed with water, brine and dried over Na.sub.2SO.sub.4. The solvent was removed to give the desired product (6 g, 67% yield) as a light yellow solid. LCMS (ES-API): R.sub.t 0.34 min; m/z 227.0 [M+H].sup.+.
c) 2H-Benzo[e][1,2,4]thiadiazine-3-carbonyl chloride 1,1-dioxide (I30)
[0492] A mixture of 2H-benzo[e][1,2,4]thiadiazine-3-carboxylic acid 1,1-dioxide (I29) (2.5 g, 11.05 mmol) and SOCl.sub.2 (20 mL) was heated at 85° C. for 2 h. The mixture was then concentrated to give the desired product which was used directly in the next step.
(xi) 3-(1,1-Dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoyl chloride (I37)
[0493] ##STR00031## ##STR00032##
a) Benzyl 3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanoate (I31)
[0494] To a solution of benzyl 2-phenylacetate (11.3 g, 50 mmol) in dry THF (100 mL) at −78° C. under nitrogen was added LiHMDS (2.5 M in THF, 40 mL, 100 mmol) dropwise over 25 min. A solution of 2-(bromomethyl)isoindoline-1,3-dione (14.4 g, 60 mmol) in THF (100 mL) was then added dropwise and the mixture was stirred at −78° C. for 2 h, then allowed to warm to r.t. and stirred overnight. The mixture was diluted with water (100 mL) and extracted with EtOAc (100 mL×3). The combined organic extracts were dried over sodium sulfate, filtered and concentrated. The residue was purified by column chromatography (DCM/MeOH=100:0-100:1) to give the desired product (12.5 g, 65% yield) as a white solid. LCMS (ES-API): R.sub.t 2.78 min; m/z 386.1 [M+H].sup.+.
b) 3-(1,3-Dioxoisoindolin-2-yl)-2-phenylpropanoic Acid (I32)
[0495] A mixture of benzyl 3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanoate (I31) (8 g, 20.76 mmol) and 10% Pd/C (800 mg) in EtOAc (100 mL) and THF (100 mL) was heated at 45° C. under H.sub.2 (1 atm) overnight. The mixture was filtered and the filtrate was concentrated to give the desired product (6 g, 98% yield) as a white solid. LCMS (ES-API): R.sub.t 2.34 min; m/z 296.1 [M+H].sup.+.
c) 3-Amino-2-phenylpropanoic Acid Hydrochloride (I33)
[0496] To a solution of 3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanoic acid (I32) (6 g, 20.3 mmol) in ethanol (200 mL) was added hydrazine hydrate (1.93 g, 39.6 mmol) and the mixture was heated at 80° C. for 1 h. The solvent was removed, water (200 mL) was added and the mixture was again concentrated. The residue was diluted with water (200 mL) then adjusted to pH 2 with conc. HCl and stirred at r.t. for 30 min. The mixture filtered and the filtrate was concentrated to give the desired product (3.2 g, 95% yield) as a white solid. LCMS (ES-API): R.sub.t 2.49 min; m/z 166.1 [M+H].sup.+.
d) Methyl 3-amino-2-phenylpropanoate Hydrochloride (I34)
[0497] Thionyl chloride (2 mL) was added dropwise to methanol (20 mL) at 0° C. followed by 3-amino-2-phenylpropanoic acid hydrochloride (I33) (1.6 g, 9.69 mmol) and the mixture was heated at reflux for 3 h. The solvent was removed and the residue was washed with EtOAc and dried to give the desired product (1.2 g, 57% yield) as a white solid, which was used directly in the next step.
e) Methyl 3-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoate (I35; 112)
[0498] To a solution of methyl 3-amino-2-phenylpropanoate hydrochloride (I34) (400 mg, 2.23 mmol) in THF (30 mL) at 0° C. under N.sub.2 was added NaHCO.sub.3 (1.87 g, 22.3 mmol) and the mixture was stirred for 15 min. 2H-Benzo[e][1,2,4]thiadiazine-3-carbonyl chloride 1,1-dioxide (I30) (1.09 g, 4.46 mmol) was then added and stirring was continued at r.t. for 30 min. TEA (2.25 g, 223 mmol) was then added and the mixture was stirred for 10 min. Additional 2H-benzo[e][1,2,4]thiadiazine-3-carbonyl chloride 1,1-dioxide (I30) (1.09 g, 4.46 mmol) was added and stirring was continued at r.t. for 30 min. The mixture was partitioned between EtOAc (200 mL) and water (200 mL), the layers were separated and the organic phase was washed with water, 1 M aqueous HCl, brine, dried over sodium sulfate, filtered and concentrated. The residue was purified by prep. TLC (DCM/MeOH=50:1) to give the desired product (280 mg, 32% yield) as a light yellow solid. LCMS (ES-API): R.sub.t 2.17 min; m/z 388.1 [M+H].sup.+.
f) 3-(1,1-Dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoic Acid (I36; 154)
[0499] To a solution of Methyl 3-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoate (135; 112) (560 mg, 1.445 mmol) in DCM (20 mL) was added 2 M aqueous NaOH (20 mL) and the mixture was stirred at r.t. for 2 h. The layers were separated and the aqueous layer was washed with DCM (50 mL) then adjusted to pH 2 with 2 M aqueous HCl. The resulting precipitate was collected by filtration and dried to give the desired product (230 mg, 43% yield) as a white solid. LCMS (ES-API): R.sub.t 2.47 min; m/z 374.1 [M+H].sup.+.
g) 3-(1,1-Dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoyl Chloride (I37)
[0500] A solution of 3-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoic acid (136) (100 mg, 0.268 mmol) in thionyl chloride (10 mL) was heated at 90° C. for 3 h. The solvent was removed and the residue was used next step without further purification.
(ix) 2-(Oxazol-2-yl)-2-phenylethanamine (I27)—Alternative Preparation
[0501] ##STR00033##
a) 2-(2-(Oxazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione (I26)
[0502] A mixture of 3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanoic acid (I32) (3.00 g, 10.2 mmol) and thionyl chloride (10 mL) was stirred at 80° C. under an atmosphere of nitrogen for 3 h. The mixture was cooled to r.t. and excess thionyl chloride was evaporated in vacuo. The solid residue was dissolved in sulfolane (10 mL) before 1H-1,2,3-triazole (0.83 mL, 14 mmol) and K.sub.2CO.sub.3 (2.81 g, 20.3 mmol) were added, and the mixture stirred at 150° C. under an atmosphere of nitrogen for 30 min. After returning to room temperature, water was added (40 mL) and the aqueous layer was extracted with EtOAc (3×50 mL). The combined organics were washed with brine, dried (MgSO.sub.4), filtered and the solvent removed in vacuo. The crude solid was purified by column chromatography (Biotage Isolera, 80 g SiO.sub.2 cartridge, 0-40% EtOAc in petroleum benzine 40-60° C.) to give the title compound as a white solid (5.37 g, ˜60% purity, quantitative yield assumed for next step); .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.06-8.00 (m, 1H), 7.81 (s, 4H), 7.31-7.21 (m, 5H), 7.19-7.13 (m, 1H), 4.76-4.67 (m, 1H), 4.31-4.17 (m, 2H); LCMS-B: rt 3.30 min; m/z 319.1 [M+H].sup.+.
b) 2-(Oxazol-2-yl)-2-phenylethan-1-amine (I27)
[0503] Hydrazine hydrate (50-60%, 2.53 mL, ˜41 mmol) was added to a suspension of 2-(2-(oxazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione (I26) (5.37 g, ˜60% purity, 10.1 mmol) in EtOH (100 mL). The mixture was stirred at 80° C. for 3.5 h, cooled to room temperature and the volatiles removed in vacuo. The solid was suspended in aq. HCl (2 M, ˜50 mL) and H.sub.2O (˜50 mL) and the precipitate removed by filtration. The aqueous filtrate was washed with DCM (3×75 mL) and then brought to pH ˜14 with the addition of aq. NaOH (2 M).
[0504] The aqueous layer was extracted with DCM (3×75 mL), the organics combined, washed with brine, dried (MgSO.sub.4), filtered and the solvent removed in vacuo to give the title compound as a colourless oil (0.951 g, 50% yield); .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.04-7.94 (m, 1H), 7.35-7.29 (m, 2H), 7.26-7.20 (m, 3H), 7.19-7.16 (m, 1H), 4.18 (dd, J=8.4, 6.2 Hz, 1H), 3.24 (dd, J=12.8, 8.4 Hz, 1H), 3.08-2.94 (m, 1H), exchangeable NH.sub.2 protons not observed; LCMS-B: rt 0.98 min; m/z 189.1 [M+H].sup.+.
(xii) N-(2-Amino-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide Hydrochloride (I41)
[0505] ##STR00034##
a) tert-Butyl (2-(1,3-dioxoisoindolin-2-yl)-1-phenylethyl)carbamate (I38)
[0506] A mixture of 3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanoic acid (I32) (5 g, 16.9 mmol), DPPA (5.59 g, 20.3 mmol), Boc.sub.2O (7.39 g, 33.9 mmol) and TEA (11.8 mL, 84.6 mmol) in t-BuOH (50 mL) and dioxane (80 mL) was heated at 100° C. overnight. The solvent was removed to give a residue which was purified by silica gel chromatography (Petroleum ether/EtOAc=100:1-3:1) to give the desired product (4.5 g, 73% yield) as a white solid. LCMS (ES-API): R.sub.t 0.2.84 min; m/z 389.1 [M+Na].sup.+.
b) tert-Butyl (2-amino-1-phenylethyl)carbamate (I39)
[0507] To a solution of tert-butyl (2-(1,3-dioxoisoindolin-2-yl)-1-phenylethyl)carbamate (I38) (11 g, 30.0 mmol) in EtOH (400 mL) was added NH.sub.4.H.sub.2O (4 mL, 60.0 mmol) and the mixture was heated at 80° C. for 2 h under N.sub.2 atmosphere. The mixture was filtered and the solid was washed with more ethanol (2 mL). The combined filtrates were concentrated and purified by chromatography (DCM/MeOH=50:1) to give the product (2.85 g, 40% yield) as a yellow oil. LCMS (ES-API): R.sub.t 0.90 min; m/z 237.2 [M+H].sup.+.
c) tert-Butyl (2-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-1-phenylethyl)carbamate (I40)
[0508] To a solution of tert-butyl (2-amino-1-phenylethyl)carbamate (I39) (2.85 g, 12.0 mmol), 2H-benzo[e][1,2,4]thiadiazine-3-carboxylic acid 1,1-dioxide (I29) (1.23 g, 5.0 mmol), EDCI (3.5 g, 18.1 mmol) and HOBT (2.45 g, 18.1 mmol) in DMF (50 mL) was added TEA (4.8 g, 48.2 mmol) and the mixture was stirred at r.t. overnight. The mixture was diluted with sat. aq. NaHCO.sub.3 (30 mL) and extracted with DCM (3×50 mL). The combined organic extracts were washed with water (50 mL), brine (50 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated. The residue was purified by column chromatography (DCM/MeOH=70:1) to give the product (0.73 g, 13% yield) as a yellow solid. LCMS (ES-API): R.sub.t 2.54 min; m/z 445.1 [M+H].sup.+.
d) N-(2-Amino-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide Hydrochloride (I41)
[0509] To a mixture of tert-butyl (2-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-1-phenylethyl)carbamate (I40) (600 mg, 1.35 mmol) in DCM (6 mL) was added 2 M HCl in EtOAc (18 mL) and the mixture was stirred at r.t. for 2 h. The mixture was concentrated to give the product (500 mg, 97% yield) as an off-white solid. LCMS (ES-API): R.sub.t 0.60 min; m/z 345.1 [M+H].sup.+.
(xiii) N-(3-Amino-2-phenylpropyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide Hydrochloride (I46)
[0510] ##STR00035##
a) 4-(1,3-Dioxoisoindolin-2-yl)-3-phenylbutanoic Acid (I42)
[0511] A solution of 4-amino-3-phenylbutanoic acid (2.6 g, 14.5 mmol) and phthalic anhydride (2.3 g, 15.2 mmol) in EtOH (50 mL) was heated at reflux for 3 h. The mixture was concentrated and the residue was purified by chromatography (DCM/MeOH=100:1) to give the product (8.1 g, 62% yield) as an off-white solid. LCMS (ES-API): R.sub.t 2.12 min; m/z 310.1 [M+H].sup.+.
b) tert-Butyl (3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropyl)carbamate (I43)
[0512] A solution of 4-(1,3-dioxoisoindolin-2-yl)-3-phenylbutanoic acid (I42) (8.1 g, 26.2 mmol), DPPA (7.9 g, 28.8 mmol), Boc.sub.2O (11.4 g, 52.4 mmol) and TEA (13.2 g, 130.9 mmol) in t-BuOH/dioxane (30 mL/80 mL) was heated at 100° C. overnight. The mixture was concentrated and the residue was dissolved in EtOAc (200 mL), washed with water (3×100 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated. The residue was purified by chromatography (Petroleum ether/EtOAc=10:1) to give the product (3.0 g, 30% yield) as a white solid. LCMS (ES-API): R.sub.t 1.83 min; m/z 381.2 [M+H].sup.+.
c) tert-Butyl (3-amino-2-phenylpropyl) Carbamate (I44)
[0513] To a solution of tert-butyl (3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropyl)carbamate (I43) (900 mg, 2.36 mmol) in EtOH (30 mL) was added N.sub.2H.sub.4.H.sub.2O (120 mg, 2.36 mmol) and the mixture was heated at 80° C. for 2 h. The mixture was filtered and the solid was washed with more ethanol (2 mL). The combined filtrates were concentrated and the residue was purified by chromatography (DCM/MeOH=50:1) to give the product (300 mg, 51% yield) as yellow oil. LCMS (ES-API): R.sub.t 0.83 min; m/z 251.2 [M+H].sup.+.
d) tert-Butyl (3-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropyl)carbamate (I45)
[0514] To a solution of tert-butyl (3-amino-2-phenylpropyl)carbamate (I44) (250 mg, 1.0 mmol) in DCM (20 mL) was added NaHCO.sub.3 (840 mg, 10.0 mmol) and the mixture was stirred at r.t. for 10 min. 2H-Benzo[e][1,2,4]thiadiazine-3-carbonyl chloride 1,1-dioxide (I30) (1.23 g, 5.0 mmol) was added and stirring was continued at r.t. for 1 h. The mixture was diluted with DCM (30 mL) and washed with water (2×50 mL), 1 M aqueous HCl (50 mL), brine (50 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated to give the product (300 mg, 66% yield) as a light yellow solid. LCMS (ES-API): R.sub.t 2.27 min; m/z 459.2 [M+H].sup.+.
e) N-(3-Amino-2-phenylpropyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide Hydrochloride (I46)
[0515] To a solution of tert-butyl (3-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropyl)carbamate (I45) (300 mg, 0.65 mmol) in EtOAc (1 mL) was added 2 M HCl in EtOAc (3 mL) and the mixture was stirred at r.t. for 2 h. The mixture was concentrated to give the product (220 mg, 85% yield) as an off-white solid. LCMS (ES-API): R.sub.t 0.57 min; m/z 359.1 [M+H].sup.+.
(xiv) 4-(1,1-Dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-3-phenylbutanoic Acid (I51)
[0516] ##STR00036##
a) 4-((tert-Butoxycarbonyl)amino)-3-phenylbutanoic Acid (I47)
[0517] To a solution of 4-amino-3-phenylbutanoic acid (3.0 g, 16.7 mmol) in 1 M aqueous NaOH (35 mL) and t-BuOH (25 mL) at 0° C. was added (Boc).sub.2O (3.65 g, 116.7 mmol) portion-wise and mixture was stirred at r.t. over the weekend. The mixture was washed with pentane (80 mL×2) and extracted with ether (80 mL×3). The combined ether extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated to give the desired product (3.4 g, 73% yield) as a white solid. LCMS: R.sub.t 2.43 min, m/z 302.1 [M+Na].sup.+
b) Methyl 4-((tert-butoxycarbonyl)amino)-3-phenylbutanoate (I48)
[0518] A mixture of 4-((tert-butoxycarbonyl)amino)-3-phenylbutanoic acid (I47) (2.793 g, 10 mmol) and K.sub.2CO.sub.3 (2.76 g, 20 mmol) in THF (50 mL) was stirred at r.t. for 15 min. Methyl iodide (3.01 g, 20 mmol) was then added and stirring was continued at r.t. overnight. The mixture was diluted with DCM (500 mL), washed with water (×2) and the organic phase was dried over Na.sub.2SO.sub.4, filtered and concentrated. The residue was purified by silica gel chromatography (Petroleum ether/EtOAc=100:1-30:1) to give the desired product (2.5 g, 85% yield) as a white solid. LCMS: R.sub.t 12.16 min, m/z 316.2 [M+Na].sup.+
c) Methyl 4-amino-3-phenylbutanoate Hydrochloride (I49)
[0519] A mixture of methyl 4-((tert-butoxycarbonyl)amino)-3-phenylbutanoate (I48) (2.5 g, 8.52 mmol) and 2 M HCl/EtOAc (100 mL) was stirred at r.t. for 3 h. The solvent was removed and the residue was washed with EtOAc to give the desired product (1.5 g, 91% yield) as a white solid, which was used directly in the next step.
d) Methyl 4-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-3-phenylbutanoate (I50)
[0520] To a solution of methyl 4-amino-3-phenylbutanoate hydrochloride (I49) (1.5 g, 7.76 mmol) and 2H-benzo[e][1,2,4]thiadiazine-3-carboxylic acid 1,1-dioxide (I29) (2.63 g, 11.64 mmol) in DCM (100 mL) at r.t. was added triethylamine (3.14 g, 31.0 mmol) and HATU (4.43 g, 11.64 mmol) and the mixture was stirred at r.t. overnight. The solvent was removed and the residue was purified by silica gel chromatography (DCM/MeOH=100:0-100:1) to give the desired product (1.2 g, 58% yield) as a white solid. LCMS: R.sub.t min, m/z 402 [M+H].sup.+
e) 4-(1,1-Dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-3-phenylbutanoic Acid (I51)
[0521] A mixture of methyl 4-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-3-phenylbutanoate (I50) (1.2 g, 3 mmol) in 2 M NaOH (100 mL) was stirred at r.t. for 3 h. The mixture was adjusted to pH 2-3 with conc. HCl and the resulting precipitate was collected by filtration, washed with twice with water and dried to give the desired product (600 mg, 52% yield) as a white solid. LCMS: R.sub.t 12.16 min, m/z 388.1 [M+H].sup.+
(xv) (2-(2-Aminoethyl)phenyl)methanol (I52)
[0522] ##STR00037##
[0523] To a solution of methyl 2-(cyanomethyl)benzoate (3 g, 17.1 mmol) in THF (50 mL) was added a 1 M solution of BH.sub.3.THF in THF (51.3 mL, 51.3 mmol) and the mixture was heated at 70° C. under N.sub.2 for 16 h. After cooling to r.t., the mixture was adjusted to pH 5 with 1 M HCl, diluted with water (20 mL) and washed with EtOAc (30 mL×3). The aqueous layer was adjusted to pH 9 with 1 M NaOH and then extracted with EtOAc (30 mL×3). The combined organic extracts were concentrated to give the product (1.5 g, 57% yield) as a yellow oil. LCMS (ES-API): R.sub.t 2.34 min; m/z 152.1 [M+H].sup.+.
(xvi) 7-Iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylic Acid 1,1-dioxide (I53)
[0524] ##STR00038##
[0525] To a solution of ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I7) (200 mg, 0.53 mmol) in THF (10 mL), MeOH (1 mL) and H.sub.2O (0.1 mL) was added LiOH.H.sub.2O (67 mg, 1.59 mmol) and the mixture was stirred at r.t. overnight. Most of the organic solvent was removed under reduced pressure and the aqueous residue was adjusted to pH 5 with 1 M aq HCl and extracted with DCM (10 mL×3). The combined extracts were dried over Na.sub.2SO.sub.4 and concentrated to give the product (150 mg, 80% yield) as a yellow solid. LCMS (ES-API): R.sub.t 1.0 min; m/z 353.1 [M+H].sup.+.
(xvii) N-(2-(hydroxymethyl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (109)
[0526] See below
(xviii) 2-(2-(7-Iodo-1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)ethyl)benzoic Acid (I55; 155)
[0527] ##STR00039##
[0528] To a solution of N-(2-(hydroxymethyl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (109) (200 mg, 0.4 mmol) in acetone (10 mL) at r.t. was added
[0529] Jones reagent (10 mL) and the mixture was heated at 40° C. for 16 h then concentrated under reduced pressure. The residue was diluted with water (10 mL), the solid was collected by filtration, washed with diethyl ether (20 mL) and dried to give the product as a white solid (115 mg, 55% yield). .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.8 (brs, 1H), 9.27 (m, 1H), 8.15-8.00 (m, 2H), 7.83 (m, 1H), 7.59 (d, J=6.4 Hz, 1H), 7.46 (m, 1H), 7.37-7.24 (m, 2H), 3.55 (m, 2H), 3.22 (m, 2H). LCMS (ES-API) R.sub.t 2.72 min; m/z 497.6 [M−H].sup.−.
(xix) Ethyl 2-((4-fluoro-2-sulfamoylphenyl)amino)-2-oxoacetate (I56)
[0530] ##STR00040##
[0531] To solution of 2-amino-5-fluorobenzenesulfonamide (0.200 g, 1.052 mmol) in THF (10 mL), at 0° C., was added NEt.sub.3 (0.154 mL, 1.104 mmol) followed by the dropwise addition of ethyl chlorooxoacetate (0.123 mL, 1.104 mmol) over 10 min. The mixture was allowed to slowly warm to ambient temperature for 48 h. The precipitate was removed by filtration and the filtrate was concentrated in vacuo to give the product (0.320 g, 90% purity, 94% yield) as a white solid. LCMS-B: r.t. 3.059 min; m/z 289.0 [M−H].sup.−. .sup.1H NMR (400 MHz, d-DMSO) δ 10.63 (s, 1H), 8.25 (dd, J=9.1, 4.9 Hz, 1H), 7.84 (s, 2H), 7.65 (dd, J=8.4, 3.0 Hz, 1H), 7.58 (ddd, J=9.1, 8.0, 3.1 Hz, 1H), 4.32 (q, J=7.1 Hz, 2H), 1.32 (t, J=7.1 Hz, 3H).
(xx) Ethyl 7-fluoro-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate (I57)
[0532] ##STR00041##
[0533] To solution of ethyl 2-((4-fluoro-2-sulfamoylphenyl)amino)-2-oxoacetate (I56) (0.320 g, 90% purity, 0.992 mmol) in dry EtOH (10 mL) under an atmosphere of nitrogen, was added NaH (60% dispersion in mineral oil, 0.079 g, 1.984 mmol) in portion. The reaction was then stirred at room temperature for 20 h. The reaction was quenched with water (10 mL) and acidified to pH 3 with 1M HCl. The EtOH was removed in vacuo and the precipitate was collected by filtration. The solid was washed with water then air dried to give the desired product ethyl 7-fluoro-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (0.069 g, 26% yield) as a white solid. LCMS-B: r.t. 3.409 min; m/z 271.0 [M−H].sup.−. .sup.1H NMR (400 MHz, d-DMSO) δ 7.85 (dd, J=9.2, 4.6 Hz, 1H), 7.79 (dd, J=7.6, 2.8 Hz, 1H), 7.67 (td, J=8.8, 2.9 Hz, 1H), 4.40 (q, J=7.1 Hz, 2H), 1.35 (t, J=7.1 Hz, 3H).
(xxi) (2-(2-(2-Aminoethyl)phenyl)-2H-1,2,3-triazol-4-yl)methanol (I60)
[0534] ##STR00042##
a) 4-((Benzyloxy)methyl)-2H-1,2,3-triazole I58
[0535] To a solution of ((prop-2-yn-1-yloxy)methyl)benzene (1.46 g, 10.0 mmol) in DMF (20 mL) and EtOH (2.5 mL) was added CuI (380 mg, 2 mmol) and azidotrimethylsilane (2.3 g, 20 mmol) and the mixture was heated at 130° C. under N.sub.2 for 18 h. The mixture was diluted with water and extracted with EtOAc (200 mL). The combined organic extracts were washed with water (100 mL×3), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=5/1) to give the title compound (900 mg, 50%) as a yellow oil. LCMS-D: R.sub.t 1.42 min; m/z 190.1 [M+H].sup.+.
b) 2-(2-(4-((Benzyloxy)methyl)-2H-1,2,3-triazol-2-yl)phenyl)acetonitrile I59
[0536] A mixture of 4-((benzyloxy)methyl)-2H-1,2,3-triazole 158 (1.7 g, 9.0 mmol), 2-(2-iodophenyl)acetonitrile (3.0 g, 12.0 mmol), Fe(acac).sub.3 (1.1 g, 3.0 mmol), CuO (720 mg, 0.9 mmol) and Cs.sub.2CO.sub.3 (6.0 g, 18.0 mmol) in DMF (60 mL) was heated at 90° C. under N.sub.2 for 30 h. The mixture was diluted with water and extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (1.4 g, 51%) as a yellow oil. LCMS-D: R.sub.t 2.87 min; m/z 305.1 [M+H].sup.+.
c) (2-(2-(2-Aminoethyl)phenyl)-2H-1,2,3-triazol-4-yl)methanol I60
[0537] To a solution of 2-(2-(4-((benzyloxy)methyl)-2H-1,2,3-triazol-2-yl)phenyl)acetonitrile 159 (700 mg, 2.3 mmol) in MeOH (30 mL) was added 10% Pd/C (200 mg) and the mixture was stirred at RT under a H.sub.2 atmosphere overnight. The catalyst was removed by filtration through Celite and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=10/0 to 10/1) to give the title compound (300 mg, 60%) as a yellow oil. LCMS-D: R.sub.t 0.33 min; m/z 219.1 [M+H].sup.+.
xxii) 2-(5-(Difluoromethyl)-1,3,4-oxadiazol-2-yl)-2-phenylethan-1-amine Trifluoroacetate (I63)
[0538] ##STR00043##
a) tert-Butyl (3-hydrazinyl-3-oxo-2-phenylpropyl)carbamate I61
[0539] To a solution of 3-((tert-butoxycarbonyl)amino)-2-phenylpropanoic acid (2.65 g, 10.0 mmol) in dry THF (30 mL) was added CDI (1.93 g, 12.0 mmol) and the mixture was stirred at RT under N.sub.2 for 90 min. Hydrazine monohydrate (1.5 g, 30.0 mmol) was then added and stirring was continued at RT for 18 h. The mixture was diluted with water and extracted with EtOAc (200 mL). The combined organic extracts were washed with water, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (3.0 g, >100%) as a white solid, which was used in the next step without further purification. LCMS-D: R.sub.t 2.29 min; m/z 302.0 [M+Na].sup.+.
b) tert-Butyl (2-(5-(difluoromethyl)-1,3,4-oxadiazol-2-yl)-2-phenylethyl)carbamate I62
[0540] A mixture of tert-butyl (3-hydrazinyl-3-oxo-2-phenylpropyl)carbamate I61 (240 mg, 0.86 mmol), trifluoroacetic anhydride (449 mg, 2.58 mmol) and imidazole (176 mg, 2.58 mmol) in DCM (10 mL) was heated at 50° C. under N.sub.2 overnight. The reaction was quenched with a saturated aqueous NH.sub.4Cl solution and the mixture was extracted with DCM (50 mL×3). The combined organic extracts were washed with a saturated aqueous NaHCO.sub.3 solution, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (170 mg, 58%) as a colorless oil. LCMS-D: R.sub.t 2.69 min; m/z 362.0 [M+Na].sup.+.
c) 2-(5-(Difluoromethyl)-1,3,4-oxadiazol-2-yl)-2-phenylethan-1-amine Trifluoroacetate I63
[0541] To a solution of tert-butyl (2-(5-(difluoromethyl)-1,3,4-oxadiazol-2-yl)-2-phenylethyl)carbamate I62 (60 mg, 0.18 mmol) in DCM (3 mL) was added TFA (1.0 mL) and the mixture was stirred at RT for 2 h. The mixture was concentrated under reduced pressure to give the title compound (85 mg, >100%) as a yellow oil, which was used directly in the next step with further purification. LCMS-D: R.sub.t 0.51 min; m/z 240.0 [M+H].sup.+.
xxiii) 2-Phenyl-2-(1,3,4-thiadiazol-2-yl)ethan-1-amine Hydrochloride (I66)
[0542] ##STR00044##
a) tert-Butyl (3-(2-formylhydrazinyl)-3-oxo-2-phenylpropyl)carbamate I64
[0543] A mixture of 3-((tert-butoxycarbonyl)amino)-2-phenylpropanoic acid (2.0 g, 7.5 mmol), formic hydrazide (510 mg, 8.5 mmol), EDCI.HCl (2.1 g, 11.3 mmol), HOBt (2.0 g, 15.0 mmol) and Et.sub.3N (2.3 g, 22.5 mmol) in DMF (30 mL) was stirred at RT overnight. The mixture was diluted with water and extracted with DCM. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=30/1 to 10/1) to give the title compound (800 mg, 34%) as a yellow oil. LCMS-D: R.sub.t 2.87 min; m/z 308.1 [M+H].sup.+.
b) tert-Butyl (2-phenyl-2-(1,3,4-thiadiazol-2-yl)ethyl)carbamate I65
[0544] To a solution of tert-butyl (3-(2-formylhydrazinyl)-3-oxo-2-phenylpropyl)carbamate I64 (600 mg, 1.95 mmol) in THF (30 mL) was added Lawesson's reagent (2.4 g, 5.85 mmol) and the mixture was heated at 40° C. overnight. The mixture was diluted with water and extracted with DCM. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=30/1) to give the title compound (200 mg, 34%) as a yellow oil. LCMS-D: R.sub.t 0.71 min; m/z 306.1 [M+H].sup.+.
c) 2-Phenyl-2-(1,3,4-thiadiazol-2-yl)ethan-1-amine Hydrochloride I66
[0545] To a solution of tert-butyl (2-phenyl-2-(1,3,4-thiadiazol-2-yl)ethyl)carbamate I65 (60 mg, 0.18 mmol) in DCM (10 mL) was added TFA (2.0 mL) and the mixture was stirred at RT overnight. 1 M aqueous HCl was added and the mixture was washed with EtOAc. The aqueous layer was concentrated under reduced pressure to give the title compound (260 mg, 98%) as a white solid. LCMS-CLCMS-C: R.sub.t 10.62 min; m/z 206.1 [M+H].sup.+.
xxiv) 3-(Methylamino)-3-oxopropyl 3-amino-2-phenylpropanoate Hydrochloride (I69)
[0546] ##STR00045##
a) 3-Hydroxy-N-methylpropanamide I67
[0547] A mixture of ethyl 3-hydroxypropanoate (2.0 g, 16.9 mmol) and MeNH.sub.2 (30% (v/v) solution in methanol, 45 mL) was heated at 85° C. for 36 h. The mixture was concentrated under reduced pressure to give the title compound (1.5 g, 88%) as an oil. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.28 (br s, 1H), 4.84 (br s, 1H), 3.82 (t, J=5.8 Hz, 2H), 2.75 (d, J=4.8 Hz, 3H), 2.42 (t, J=5.8 Hz, 2H).
b) 3-(Methylamino)-3-oxopropyl 3-((tert-butoxycarbonyl)amino)-2-phenylpropanoate I68
[0548] A mixture of 3-((tert-butoxycarbonyl)amino)-2-phenylpropanoic acid (500 mg, 1.8 mmol), 3-hydroxy-N-methylpropanamide I67 (1.1 g, 9.5 mmol), EDCI.HCl (542 mg, 2.83 mmol) and DMAP (350 mg, 1.8 mmol) in DCM (100 mL) was stirred at RT overnight. The mixture was concentrated under reduced pressure and the residue was purified by silica gel chromatography to give the title compound (500 mg, 75%) as an oil. LCMS-D: R.sub.t 2.13 min; m/z 251.3 [M-Boc+2H].sup.+.
c) 3-(Methylamino)-3-oxopropyl 3-amino-2-phenylpropanoate Hydrochloride I69
[0549] To a solution of 3-(methylamino)-3-oxopropyl 3-((tert-butoxycarbonyl)amino)-2-phenylpropanoate I68 (500 mg, 1.42 mmol) in DCM (30 mL) was added a 2 M solution of HCl in Et.sub.2O (30 mL) and the mixture was stirred at RT overnight. The mixture was concentrated under reduced pressure and the residue was recrystallised from water and dried under reduced pressure to give the title compound (400 mg, 97%) as a white solid. LCMS-D: R.sub.t 0.24 min; m/z 251.3 [M+H].sup.+.
xxv) 4-(Methylamino)-4-oxobutyl 3-amino-2-phenylpropanoate Trifluoroacetate (I72)
[0550] ##STR00046##
a) 4-Hydroxy-N-methylbutanamide I70
[0551] Dihydrofuran-2(3H)-one (334 mg, 4.0 mmol) was added to a 2 M solution of methylamine in THF (20.0 mL, 40.0 mmol) in a pressure tube at −78° C. The flask was sealed and the mixture was stirred at RT overnight. The mixture was then concentrated under reduced pressure to give the title compound (350 mg, 75%) as a red solid. LCMS-CLCMS-C: R.sub.t 0.33 min; m/z 118.1 [M+H].sup.+.
b) 4-(Methylamino)-4-oxobutyl 3-((tert-butoxycarbonyl)amino)-2-phenylpropanoate I71
[0552] A mixture of 3-((tert-butoxycarbonyl)amino)-2-phenylpropanoic acid (500 mg, 1.88 mmol), 4-hydroxy-N-methylbutanamide I70 (331 mg, 2.83 mmol), EDCI.HCl (434 mg, 2.26 mmol) and DMAP (23 mg, 0.19 mmol) in DCM (20 mL) was stirred at RT overnight. The mixture was diluted with water (100 mL), extracted with DCM (60 mL×3) and the combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated. The residue was purified by prep. TLC (DCM/MeOH=300/1 to 100/1) to give the title compound (400 mg, 80%) as a yellow oil. LCMS-D: R.sub.t 1.85 min; m/z 387.1 [M+Na].sup.+, 265.1 [M-Boc+2H].sup.+.
c) 4-(Methylamino)-4-oxobutyl 3-amino-2-phenylpropanoate Trifluoroacetate I72
[0553] To a solution of 4-(methylamino)-4-oxobutyl 3-((tert-butoxycarbonyl)amino)-2-phenylpropanoate I71 (220 mg, 0.55 mmol) in DCM (2 mL) was added TFA (1.0 mL) and the mixture was stirred at RT for 3 h. The mixture was concentrated under reduced pressure to give the title compound (330 mg, >100%) as a yellow oil, which was used in the next step without further purification. LCMS-D: R.sub.t 0.31 min; m/z 265.1 [M+H].sup.+ for the free base.
xxvi) 2-(2-Methoxyphenyl)-2-(oxazol-2-yl)ethan-1-amine (I76)
[0554] ##STR00047##
a) 2-(2-Methoxyphenyl)acetyl Chloride I73
[0555] To a solution of 2-(2-methoxyphenyl)acetic acid (10 g, 60.2 mmol) in DCM (100 mL) was added oxalyl chloride (15 mL, 180.5 mmol) dropwise followed by DMF (3 drops) and the mixture was stirred at RT under N.sub.2 for 2 h. The mixture was concentrated under reduced pressure to give the title compound (11 g, 100%) as a red oil. LCMS-D: R.sub.t 2.28 min; m/z 181.0 [M−Cl+MeOH].sup.+.
b) 2-(2-Methoxybenzyl)oxazole I74
[0556] To a mixture of 1,2,3-triazole (5.4 g, 78.3 mmol) and K.sub.2CO.sub.3 (13.5 g, 97.8 mmol) in sulfolane (100 mL) at 0° C. was added 2-(2-methoxyphenyl)acetyl chloride I73 (12 g, 65.2 mmol) and the mixture was heated at 165° C. for 1 h. After cooling to RT, the mixture was diluted with water (500 mL) and extracted with Et.sub.2O (500 mL×3). The combined organic extracts were washed with water (500 mL×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1 to 6/1) to give the title compound (8.0 g, 65%) as a yellow oil. LCMS-D: R.sub.t 2.36 min; m/z 190.0 [M+H].sup.+, 212.0 [M+Na].sup.+.
c) 2-(2-(2-Methoxyphenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I75
[0557] To a solution of 2-(2-methoxybenzyl)oxazole I74 (1.0 g, 5.3 mmol) in dry THF (20 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 6.4 mL, 6.4 mmol) dropwise. The mixture was stirred at −78° C. for 1 h, then added to a solution 2-(bromomethyl)isoindoline-1,3-dione (1.5 g, 6.34 mmol) in dry THF (20 mL) at −78° C. under N.sub.2. The mixture was allowed to warm to RT and stirred overnight. The reaction was quenched with a saturated aqueous NH.sub.4Cl solution and the mixture was extracted with DCM (200 mL×3). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1 to 6/1) to give the title compound (200 mg, 11%) as a green solid. LCMS-D: R.sub.t 2.50 min; m/z 349.0 [M+H].sup.+.
d) 2-(2-Methoxyphenyl)-2-(oxazol-2-yl)ethan-1-amine I76
[0558] A suspension of 2-(2-(2-methoxyphenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I75 (200 mg, 0.57 mmol) and hydrazine hydrate (86 mg, 1.72 mmol) in EtOH (10 mL) was heated at 80° C. under N.sub.2 for 3 h. The mixture was filtered and the filter cake was washed with EtOH (2 mL). The filtrate was concentrated under reduced pressure to give the title compound (100 mg, 80%) as a yellow oil. LCMS-D: R.sub.t 0.41 min; m/z 219.1 [M+H].sup.+.
xxvii) 2-(2-(Difluoromethoxy)phenyl)-2-(oxazol-2-yl)ethan-1-amine (I80)
[0559] ##STR00048##
a) 2-(2-Isopropoxyphenyl)acetyl Chloride I77
[0560] To a solution of 2-(2-(difluoromethoxy)phenyl)acetic acid (2.0 g, 9.89 mmol) in DCM (20 mL) was added oxalyl chloride (3 mL, 29.67 mmol) dropwise followed by DMF (3 drops) and the mixture was stirred at RT for 3 h. The mixture was concentrated under reduced pressure to give the title compound (2.2 g, 100%) as a red oil. LCMS-D: R.sub.t 2.02 min; m/z 239.0 [M−Cl+MeO+Na].sup.+
b) 2-(2-(Difluoromethoxy)benzyl)oxazole I78
[0561] To a mixture of 1,2,3-triazole (1.0 g, 4.53 mmol) and K.sub.2CO.sub.3 (0.94 g, 6.80 mmol) in sulfolane (30 mL) at 0° C. was added 2-(2-isopropoxyphenyl)acetyl chloride I77 (1.0 g, 4.53 mmol) and the mixture was heated at 165° C. under N.sub.2 for 1 h. After cooling to RT, the mixture was diluted with water (100 mL) and extracted with Et.sub.2O (100 mL×3). The combined organic extracts were washed with water (100 mL), brine (100 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1 to 6/1) to give the title compound (800 mg, 78%) as a yellow oil. LCMS-D: R.sub.t 1.74 min; m/z 226.0 [M+H].sup.+.
c) 2-(2-(2-(Difluoromethoxy)phenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I79
[0562] To a solution of 2-(2-(difluoromethoxy)benzyl)oxazole I78 (1.1 g, 4.88 mmol) in dry THF (30 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 6.0 mL, 6.0 mmol) dropwise. The mixture was stirred at −78° C. for 1 h, then added to a solution of 2-(bromomethyl)isoindoline-1,3-dione (1.41 g, 5.86 mmol) in dry THF (20 mL) at −78° C. under N.sub.2. The mixture was allowed to warm to RT and stirred overnight. The reaction was quenched with a saturated aqueous NH.sub.4Cl solution (50 mL) and the mixture was extracted with DCM (50 mL×3). The combined organic extracts were washed with brine (50 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1 to 6/1) to give the title compound (360 mg, 19%) as a yellow solid. LCMS-D: R.sub.t 2.21 min; m/z 385.0 [M+H].sup.+.
d) 2-(2-(Difluoromethoxy)phenyl)-2-(oxazol-2-yl)ethan-1-amine I80
[0563] A suspension of 2-(2-(2-(difluoromethoxy)phenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I79 (360 mg, 0.94 mmol) and hydrazine hydrate (0.15 mL, 2.81 mmol) in EtOH (20 mL) was heated at 80° C. under N.sub.2 for 3 h. The mixture was filtered and the filter cake was washed with EtOH (2 mL). The filtrate was concentrated under reduced pressure to give the title compound (150 mg, 63%) as a yellow oil. LCMS-D: R.sub.t 0.34 min; m/z 255.0 [M+H].sup.+
xxviii) 2-(5-(Methoxymethyl)-1,3,4-oxadiazol-2-yl)-2-phenylethan-1-amine trifluoroacetate (I84)
[0564] ##STR00049##
a) tert-Butyl (3-(2-(2-methoxyacetyl)hydrazinyl)-3-oxo-2-phenylpropyl)carbamate I82
[0565] To a solution of tert-butyl (3-hydrazinyl-3-oxo-2-phenylpropyl)carbamate I61 (515 mg, 1.84 mmol) in THF (50 mL) was added pyridine (292 mg, 3.69 mmol) and 2-methoxyacetyl chloride (240 mg, 2.21 mmol) and the mixture was stirred at RT overnight. The mixture was concentrated under reduced pressure and the residue was diluted with water (100 mL) and extracted with DCM (100 mL×3). The combined organic extracts were washed with brine (100 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (230 mg, 36%) as a yellow oil. LCMS-CLCMS-C: R.sub.t 1.60 min; m/z 352.0 [M+H].sup.+.
b) tert-Butyl (2-(5-(methoxymethyl)-1,3,4-oxadiazol-2-yl)-2-phenylethyl)carbamate I83
[0566] To a solution of tert-butyl (3-(2-(2-methoxyacetyl)hydrazinyl)-3-oxo-2-phenylpropyl)carbamate I82 (30 mg, 0.085 mmol) in THF (2 mL) was added Burgess reagent (41 mg, 0.17 mmol) and the mixture was heated at 120° C. under microwave irradiation for 30 min. The procedure was repeated once on the same scale and once using tert-butyl (3-(2-(2-methoxyacetyl)hydrazinyl)-3-oxo-2-phenylpropyl)carbamate I82 (150 mg, 0.60 mmol) and Burgess reagent (711 mg, 2.98 mmol) in THF (3 mL). The three reaction mixtures were combined, diluted with water (50 mL) and extracted with DCM (50 mL×3). The combined organic extracts were washed with brine (40 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (70 mg, 27%) as a yellow oil. LCMS-D: R.sub.t 1.96 min; m/z 356.0 [M+Na].sup.+.
c) 2-(5-(Methoxymethyl)-1,3,4-oxadiazol-2-yl)-2-phenylethan-1-amine trifluoroacetate I84
[0567] A solution of tert-butyl (2-(5-(methoxymethyl)-1,3,4-oxadiazol-2-yl)-2-phenylethyl)carbamate I83 (70 mg, 0.21 mmol) and TFA (2 mL) in DCM (1 mL) was stirred at RT for 2 h. The mixture was concentrated under reduced pressure to give the title compound (60 mg, 82%) as a yellow oil, which was used in the next step without further purification. LCMS-C: R.sub.t 0.87 min; m/z 233.9 [M+H].sup.+ for the free base.
xxix) 2-(3-Iodophenyl)-2-(oxazol-2-yl)ethan-1-amine (I88)
[0568] ##STR00050##
a) 2-(3-Iodophenyl)acetyl Chloride I85
[0569] To a solution of 2-(3-iodophenyl)acetic acid (10.0 g, 38 mmol) in DCM (50 mL) was added oxalyl chloride (10.0 mL, 115 mmol) and DMF (1 mL) and the mixture was stirred at RT for 5 h. The mixture was concentrated under reduced pressure to give the title compound (10.0 g, 94%) as a yellow oil, which was used directly in the next step.
b) 2-(3-Iodobenzyl)oxazole I86
[0570] To a mixture of 1,2,3-triazole (3.0 g, 43.2 mmol) and K.sub.2CO.sub.3 (7.3 g, 53.0 mmol) in sulfolane (80 mL) was added a solution of 2-(3-iodophenyl)acetyl chloride I85 (10.0 g, 36.0 mmol) in sulfolane (20 mL) and the mixture was heated at 165° C. under N.sub.2 for 1 h. After cooling to RT, the mixture was diluted with water and extracted with Et.sub.2O. The combined organic extracts were concentrated under reduced pressure and the residue was purified by silica gel chromatography (Pet. ether/EtOAc=50/1 to 20/1 to 10/1) to give the title compound (6.0 g, 58%) as a yellow oil. LCMS-C: R.sub.t 2.13 min; m/z 285.9 [M+H].sup.+.
c) 2-(2-(3-Iodophenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I87
[0571] To a solution of 2-(3-iodobenzyl)oxazole I86 (6.0 g, 21 mmol) in dry THF (100 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 25.0 mL, 25.0 mmol) dropwise and the mixture was stirred at −78° C. for 45 min. A solution of 2-(bromomethyl)isoindoline-1,3-dione (6.0 g, 25.0 mmol) in dry THF (60 mL) was then added dropwise at −78° C. and the mixture was allowed to warm to RT and stirred overnight. The mixture was diluted with water, extracted with EtOAc and the combined organic extracts were concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=30/1 to 10/1) to give the title compound (1.8 g, 19%) as a yellow oil. LCMS-C: R.sub.t 2.33 min; m/z 445.1 [M+H].sup.+.
d) 2-(3-Iodophenyl)-2-(oxazol-2-yl)ethan-1-amine I88
[0572] A suspension of 2-(2-(3-iodophenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I87 (1.8 g, 4.0 mmol) and hydrazine monohydrate (600 mg, 12.0 mmol) in EtOH (30 mL) was heated at 80° C. under N.sub.2 overnight. After cooling to RT, the mixture was diluted with water and extracted with DCM. The combined organic extracts were concentrated under reduced pressure to give the title compound (760 mg, 63%) as a yellow oil. LCMS-C: R.sub.t 0.36 min; m/z 315.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.02 (s, 1H), 7.64-7.60 (m, 2H), 7.28-7.24 (m, 1H), 7.19 (s, 1H), 7.13 (t, J=8.0 Hz, 1H), 4.22-4.16 (m, 1H), 3.25-3.18 (m, 1H), 3.04-2.98 (m, 1H).
xxx) 5-(2-Amino-1-phenylethyl)-1,3,4-oxadiazol-2-amine hydrochloride (I90)
[0573] ##STR00051##
a) tert-Butyl(2-(5-amino-1,3,4-oxadiazol-2-yl)-2-phenylethyl)carbamate I89
[0574] To a solution of tert-butyl(3-hydrazinyl-3-oxo-2-phenylpropyl)carbamate I61 (130 mg, 0.5 mmol) in 1,4-dioxane (5 mL) was added a solution of NaHCO.sub.3 (42 mg, 0.5 mmol) in water (1.5 mL) and a white suspension was formed. Bromoacetonitrile (53 mg, 0.5 mmol) was then added portion wise and the mixture was stirred at RT overnight. The reaction was scaled up accordingly using tert-butyl(3-hydrazinyl-3-oxo-2-phenylpropyl)carbamate (1 mmol) and the reaction mixtures were combined, concentrated under reduced pressure to remove most of the 1,4-dioxane and the aqueous residue was extracted with EtOAc (100 mL). The organic extract was washed with a saturated aqueous NaHCO.sub.3 solution, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (400 mg, 88%) as a white solid. LCMS-DLCMS-D: R.sub.t 2.38 min, m/z 305.1 [M+H].sup.+.
b) 5-(2-Amino-1-phenylethyl)-1,3,4-oxadiazol-2-amine hydrochloride I90
[0575] A mixture of tert-butyl(2-(5-amino-1,3,4-oxadiazol-2-yl)-2-phenylethyl)carbamate I89 (183 mg, 0.6 mmol) and a 2 M solution of HCl in 1,4-dioxane (10 mL) was stirred at RT under N.sub.2 for 2 h. The mixture was then concentrated under reduced pressure to give the title compound (120 mg, 83%) as a white solid. LCMS-D: R.sub.t 0.28 min, m/z 205.1 [M+H].sup.+.
xxxi) 5-(2-Amino-1-phenylethyl)-1,3,4-oxadiazol-2(3H)-one Hydrochloride I92
[0576] ##STR00052##
a) tert-Butyl (2-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)-2-phenylethyl)carbamate I91
[0577] To a solution of tert-butyl(3-hydrazinyl-3-oxo-2-phenylpropyl)carbamate I61 (320 mg, 1.15 mmol) and DIPEA (297 mg, 2.3 mmol) in DCM (12 mL) at 0° C. under N.sub.2 was added a solution of triphosgene (137 mg, 0.46 mmol) in DCM (8 mL) and the mixture was stirred for 15 min, then allowed to warm to RT and stirred overnight. The mixture was diluted with DCM (50 mL), washed with a saturated aqueous NaHCO.sub.3 solution, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (170 mg, 49%) as a white solid. LCMS-D: R.sub.t 2.43 min, m/z 328.0 [M+Na].sup.+.
b) 5-(2-Amino-1-phenylethyl)-1,3,4-oxadiazol-2(3H)-one Hydrochloride I92
[0578] A mixture of tert-butyl (2-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)-2-phenylethyl)carbamate I91 (110 mg, 0.36 mmol) and a 2 M solution of HCl in 1,4-dioxane (10 mL) was stirred at RT overnight. The mixture was then concentrated under reduced pressure to give the title compound (110 mg, >100%) as a white solid, which was used directly in the next step. LCMS-D: R.sub.t 0.27 min, m/z 206.1 [M+H].sup.+.
xxxii) 2-(3-Methoxyphenyl)-2-(oxazol-2-yl)ethan-1-amine (I96)
[0579] ##STR00053##
a) 2-(3-Methoxyphenyl)acetyl Chloride I93
[0580] To a solution of 2-(3-methoxyphenyl)acetic acid (10.0 g, 60.0 mmol) and DMF (3 drops) in DCM (100 mL) at 0° C. under N.sub.2 was added oxalyl chloride (23.0 g, 180 mmol) and the mixture was stirred for 3 h. The solvent was removed under reduced pressure to give the title compound (11.0 g, 100%) as a yellow oil. LCMS-D: R.sub.t 2.17 min, m/z 181.0 [M−Cl+MeO+H].sup.+.
b) 2-(3-Methoxybenzyl)oxazole I94
[0581] To a mixture of 1,2,3-triazole (5.00 g, 72.0 mmol) and K.sub.2CO.sub.3 (13.0 g, 90.0 mmol) in sulfolane (150 mL) at 0° C. was added 2-(3-methoxyphenyl)acetyl chloride I93 (11.0 g, 60.0 mmol) dropwise and the mixture was heated at 165° C. for 1 h. After cooling to RT, MTBE (400 mL) was added and the mixture was washed with water (500 mL×3), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1) to give the title compound (5.2 g, 50%) as a yellow oil. LCMS-D: R.sub.t 2.24 min, m/z 190.0 [M+H].sup.+.
c) 2-(2-(3-Methoxyphenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I95
[0582] To a solution of 2-(3-methoxybenzyl)oxazole I94 (5.2 g, 27.5 mmol) in dry THF (80 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 33.0 mL, 33.0 mmol) dropwise. The mixture was stirred at −78° C. for 45 min, then added to a solution of 2-(bromomethyl)isoindoline-1,3-dione (7.9 g, 33 mmol) in dry THF (120 mL) at −78° C. under N.sub.2 and the mixture was stirred at −78° C. overnight. The solvent was removed under reduced pressure and the residue was diluted with DCM (200 mL), washed with a saturated aqueous NaHCO.sub.3 solution (100 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=4/1) to give the title compound (2.69 g, 28%) as a yellow solid. LCMS-D: R.sub.t 2.58 min, m/z 349.1 [M+H].sup.+.
d) 2-(3-Methoxyphenyl)-2-(oxazol-2-yl)ethan-1-amine I96
[0583] A suspension of 2-(2-(3-methoxyphenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione 195 (2.69 g, 7.70 mmol) and hydrazine monohydrate (1.20 g, 23.0 mmol) in EtOH (50 mL) was stirred at 80° C. under N.sub.2 for 3 h. The mixture was then filtered and the filtrate was concentrated under reduced pressure to give the title compound (1.4 g, 80%) as a yellow oil. LCMS-D: R.sub.t 0.43 min, m/z 219.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.04-7.96 (m, 1H), 7.23 (t, J=8.0 Hz, 1H), 7.18 (s, 1H), 6.87-6.74 (m, 3H), 4.16 (dd, J=8.3, 6.2 Hz, 1H), 3.72 (s, 3H), 3.28-3.19 (m, 1H), 3.06-2.98 (m, 1H).
xxxiii) 2-Fluoro-2-(oxazol-2-yl)-2-phenylethanamine (I99)
[0584] ##STR00054##
a) 2-(Fluoro(phenyl)methyl)oxazole I97
[0585] To a solution of 2-benzyloxazole 125 (15.1 g, 95.0 mmol) in dry THF (150 mL) at −78° C. under N.sub.2 was added t-BuLi (1.3 M solution in heptane, 81.0 mL, 105 mmol) dropwise. The mixture stirred at −78° C. for 45 min, then added to a solution of N-fluorobenzenesulfonimide (39.0 g, 124 mmol) in dry THF (100 mL) at −78° C. under N.sub.2 and the mixture was stirred at −78° C. overnight. The reaction was quenched with a saturated aqueous NH.sub.4Cl solution (100 mL) and the mixture was extracted with EtOAc (300 mL). The organic extract was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=28/1) to give the title compound (10.2 g, 63%) as a red oil. LCMS-D: R.sub.t 1.25 min, m/z 178.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.21 (s, 1H), 7.55-7.41 (m, 5H), 7.32 (s, 1H), 6.84 (d, J=24.0 Hz, 1H).
b) 2-(2-Fluoro-2-(oxazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione I98
[0586] To a solution of 2-(fluoro(phenyl)methyl)oxazole I97 (3.54 g, 20 mmol) in dry THF (30 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 24.0 mL, 24.0 mmol) dropwise. The mixture was stirred at −78° C. for 45 min, then added to a solution of 2-(bromomethyl)isoindoline-1,3-dione (5.76 g, 24.0 mmol) in dry THF (60 mL) at −78° C. under N.sub.2 and the mixture was stirred at −78° C. overnight. The mixture was diluted with water, extracted with EtOAc and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=5/1) to give the title compound (520 mg, 8%) as a white solid. LCMS-D: R.sub.t 2.12 min, m/z 337.0 [M+H].sup.+.
c) 2-Fluoro-2-(oxazol-2-yl)-2-phenylethanamine I99
[0587] A suspension of 2-(2-fluoro-2-(oxazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione I98 (520 mg, 1.5 mmol) and hydrazine monohydrate (225 mg, 4.5 mmol) in EtOH (10 mL) was heated at 80° C. under N.sub.2 for 3 h. The mixture was concentrated under reduced pressure and the residue was dissolved in EtOAc (100 mL), washed with water (50 mL×3), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (250 mg, 80%) as a yellow oil. LCMS-D: R.sub.t 0.28 min, m/z 207.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.21-8.16 (m, 1H), 7.48-7.26 (m, 6H), 3.58-3.44 (m, 1H), 3.39-3.25 (m, 1H).
xxxiv) 2-Phenyl-2-(5-(2,2,2-trifluoroethyl)-1,3,4-oxadiazol-2-yl)ethanamine (I102)
[0588] ##STR00055##
a) tert-Butyl (3-oxo-2-phenyl-3-(2-(3,3,3-trifluoropropanoyl)hydrazinyl)propyl)carbamate I100
[0589] To a solution of tert-butyl (3-hydrazinyl-3-oxo-2-phenylpropyl)carbamate I61 (558 mg, 2.0 mmol) and pyridine (320 mg, 4.0 mmol) in dry THF (20 mL) at RT was added a solution of 3,3,3-trifluoropropanoyl chloride (580 mg, 4.0 mmol) in dry THF (5 mL) dropwise and the mixture was stirred for 2 h. The mixture was concentrated under reduced pressure and the residue was diluted with EtOAc (50 mL), washed with 1 M aqueous HCl, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (610 mg, 80%) as a white solid. LCMS-D: R.sub.t 1.62 min, m/z 412.1 [M+Na].sup.+.
b) tert-Butyl (2-phenyl-2-(5-(2,2,2-trifluoroethyl)-1,3,4-oxadiazol-2-yl)ethyl)carbamate I101
[0590] A suspension of tert-butyl (3-oxo-2-phenyl-3-(2-(3,3,3-trifluoropropanoyl) hydrazinyl)propyl)carbamate I100 (312 mg, 0.8 mmol) and Burgess reagent (760 mg, 3.2 mmol) in dry THF (12 mL) was stirred at 160° C. in a sealed tube overnight. The mixture was diluted with DCM (100 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (50 mg, 17%) as a yellow solid. LCMS-D: R.sub.t 2.30 min, m/z 372.1 [M+H].sup.+.
c) 2-Phenyl-2-(5-(2,2,2-trifluoroethyl)-1,3,4-oxadiazol-2-yl)ethanamine I102
[0591] To a solution of tert-butyl (2-phenyl-2-(5-(2,2,2-trifluoroethyl)-1,3,4-oxadiazol-2-yl) ethyl)carbamate I101 (50 mg, 0.13 mmol) in DCM (10 mL) was added TFA (1 mL) and the mixture was stirred at RT overnight. The mixture was diluted with DCM (50 mL), washed with a saturated aqueous NaHCO.sub.3 solution and concentrated under reduced pressure to give the title compound (20 mg, 60%) as a yellow solid. LCMS-D: R.sub.t 0.25 min, m/z 272.0 [M+H].sup.+.
xxxv) 2-(2-Iodophenyl)-2-(oxazol-2-yl)ethanamine (I106)
[0592] ##STR00056##
a) 2-(2-Iodophenyl)acetyl Chloride I103
[0593] To a solution of 2-(2-iodophenyl)acetic acid (15.7 g, 60 mmol) and DMF (3 drops) in DCM (100 mL) at 0° C. under N.sub.2 was added oxalyl chloride (23 g, 180 mmol) dropwise and the mixture was stirred for 3 h. The mixture was concentrated under reduced pressure to give the title compound (16.8 g, 100%) as a brown oil. LCMS-D: R.sub.t 2.14 min, m/z 276.9 [M−Cl+MeO+H].sup.+.
b) 2-(2-Iodobenzyl)oxazole I104
[0594] To a mixture of 1,2,3-triazole (5.0 g, 72.0 mmol) and K.sub.2CO.sub.3 (13.0 g, 90.0 mmol) in sulfolane (200 mL) at 0° C. was added 2-(2-iodophenyl)acetyl chloride I103 (16.8 g, 60.0 mmol) and the mixture was heated at 165° C. for 45 min. After cooling to RT, the mixture was diluted with water, extracted with MTBE (500 mL×3) and the combined organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1) to give the title compound (9.5 g, 55%) as a yellow oil. LCMS-D: R.sub.t 1.98 min, m/z 285.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.00 (d, J=1.0 Hz, 1H), 7.87 (dd, J=7.8, 1.3 Hz, 1H), 7.41-7.32 (m, 2H), 7.12 (d, J=0.9 Hz, 1H), 7.07-7.00 (m, 1H), 4.23 (s, 2H).
c) 2-(2-(2-Iodophenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I105
[0595] To a solution of 2-(2-iodobenzyl)oxazole I104 (9.1 g, 32 mmol) in dry THF (100 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 38.4 mL, 38.4 mmol) dropwise. The mixture was stirred at −78° C. for 45 min, then added to a solution of 2-(bromomethyl)isoindoline-1,3-dione (9.2 g, 38.4 mmol) in dry THF (150 mL) and the mixture was stirred at −78° C. under N.sub.2 overnight. The mixture was diluted with water, extracted with EtOAc and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=2/1) to give the title compound (4.6 g, 32%) as a yellow solid. LCMS-D: R.sub.t 2.33 min, m/z 444.9 [M+H].sup.+.
d) 2-(2-Iodophenyl)-2-(oxazol-2-yl)ethanamine I106
[0596] A suspension of 2-(2-(2-iodophenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione 1105 (4.6 g, 11.0 mmol) and hydrazine monohydrate (1.7 g, 33 mmol) in EtOH (120 mL) was heated at 80° C. under N.sub.2 for 3 h. The mixture was filtered and the filtrate was concentrated under reduced pressure to give the title compound (2.7 g, 79%) as an orange oil. LCMS-D: R.sub.t 0.28 min, m/z 314.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.03 (d, J=1.0 Hz, 1H), 7.89 (dd, J=8.0, 1.4 Hz, 1H), 7.38-7.31 (m, 1H), 7.21 (s, 1H), 7.11 (dd, J=7.8, 1.7 Hz, 1H), 7.05-6.98 (m, 1H), 4.52-4.44 (m, 1H), 3.25-3.15 (m, 1H), 3.05-2.97 (m, 1H).
xxxvi) (2-(2-Amino-1-(oxazol-2-yl)ethyl)phenyl)methanol trifluoroacetate Salt (I110)
[0597] ##STR00057##
a) tert-Butyl (2-(2-iodophenyl)-2-(oxazol-2-yl)ethyl)carbamate I107
[0598] A suspension of 2-(2-iodophenyl)-2-(oxazol-2-yl)ethanamine I106 (628 mg, 2.0 mmol), Boc.sub.2O (873 mg, 4.0 mmol) and Et.sub.3N (606 mg, 6.0 mmol) in DCM (20 mL) was stirred at RT for 3 h. The mixture was diluted with water, extracted with DCM (100 mL) and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=4/1) to give the title compound (700 mg, 84%) as a yellow oil. LCMS-C: R.sub.t 2.31 min, m/z 414.9 [M+H].sup.+.
b) Methyl 2-(2-((tert-butoxycarbonyl)amino)-1-(oxazol-2-yl)ethyl)benzoate I108
[0599] A mixture of tert-butyl (2-(2-iodophenyl)-2-(oxazol-2-yl)ethyl)carbamate I107 (700 mg, 1.7 mmol), Pd(dppf)Cl.sub.2.DCM (140 mg, 0.17 mmol), Et.sub.3N (500 mg, 5 mmol) and MeOH (30 mL) was heated at 100° C. under a CO atmosphere (0.1 MPa) overnight. The mixture was diluted with water, extracted with DCM (100 mL) and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (460 mg, 77%) as a yellow oil. LCMS-C: R.sub.t 2.19 min, m/z 347.0 [M+H].sup.+.
c) tert-Butyl(2-(2-(hydroxymethyl)phenyl)-2-(oxazol-2-yl)ethyl)carbamate I109
[0600] To a solution of methyl 2-(2-((tert-butoxycarbonyl)amino)-1-(oxazol-2-yl)ethyl) benzoate I108 (460 mg, 1.33 mmol) in dry THF (20 mL) was added LiBH.sub.4 (2 M solution in THF, 1.33 mL, 2.66 mmol) and the mixture was stirred at RT for 2 h. The mixture was diluted with DCM (100 mL), washed with water, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (400 mg, 98%) as a yellow oil. LCMS-C: R.sub.t 1.37 min, m/z 319.0 [M+H].sup.+.
d) (2-(2-Amino-1-(oxazol-2-yl)ethyl)phenyl)methanol Trifluoroacetate Salt I110
[0601] A solution of tert-butyl (2-(2-(hydroxymethyl)phenyl)-2-(oxazol-2-yl)ethyl) carbamate I109 (100 mg, 0.3 mmol) in TFA (1 mL) was stirred at RT for 2 h. The mixture was then concentrated under reduced pressure to give the title compound (66 mg, 67%) as a yellow oil. LCMS-C: R.sub.t 0.38 min, m/z 219.0 [M+H].sup.+.
xxxvii) 2-Phenyl-2-(thiazol-2-yl)ethanamine (I113)
[0602] ##STR00058##
a) 2-Benzylthiazole I111
[0603] A suspension of 2-phenylethanethioamide (10.0 g, 66.0 mmol) and 2-chloroacetaldehyde (26.0 g, 132 mmol) in EtOH (150 mL) was heated at 100° C. under N.sub.2 overnight. The mixture was diluted with EtOAc (500 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=10/1) to give the title compound (3.88 g, 33%) as a yellow oil. LCMS-C: R.sub.t 1.52 min, m/z 176.0 [M+H].sup.+.
b) 2-(2-Phenyl-2-(thiazol-2-yl)ethyl)isoindoline-1,3-dione I112
[0604] To a solution of 2-benzylthiazole I111 (3.88 g, 22.1 mmol) in dry THF (60 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 26.5 mL, 26.5 mmol) dropwise. The mixture was stirred at −78° C. for 45 min, then added to a solution of 2-(bromomethyl)isoindoline-1,3-dione (6.38 g, 26.5 mmol) in dry THF (60 mL) at −78° C. under N.sub.2 and the mixture was stirred at −78° C. overnight. The mixture was diluted with EtOAc (300 mL), washed with water, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=2/1) to give the title compound (2.9 g, 39%) as a yellow solid. LCMS-C: R.sub.t 2.23 min, m/z 335.0 [M+H].sup.+.
c) 2-Phenyl-2-(thiazol-2-yl)ethanamine I113
[0605] A suspension of 2-(2-phenyl-2-(thiazol-2-yl)ethyl)isoindoline-1,3-dione I112 (2.9 g, 8.68 mmol) and hydrazine monohydrate (1.3 g, 26.0 mmol) in EtOH (120 mL) was heated at 80° C. under N.sub.2 overnight. The mixture was then filtered and the filtrate was concentrated under reduced pressure to give the title compound (1.4 g, 80%) as a yellow oil. LCMS-C: R.sub.t 0.33 min, 205.0 [M+H].sup.+.
xxxviii) 2-(2-(Methoxymethyl)phenyl)-2-(oxazol-2-yl)ethanamine Trifluoroacetate (I115)
[0606] ##STR00059##
a) tert-Butyl(2-(2-(methoxymethyl)phenyl)-2-(oxazol-2-yl)ethyl)carbamate I114
[0607] To a solution of tert-butyl (2-(2-(hydroxymethyl)phenyl)-2-(oxazol-2-yl)ethyl)carbamate I109 (100 mg, 0.30 mmol) in CH.sub.3CN (10 mL) was added Ag.sub.2O (350 mg, 1.5 mmol) and CH.sub.3I (426 mg, 3.0 mmol) and the mixture was stirred at RT overnight. The mixture was diluted with DCM (100 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (40 mg, 40%) as a yellow oil. LCMS-C: R.sub.t 2.28 min, m/z 333.1 [M+H].sup.+.
b) 2-(2-(Methoxymethyl)phenyl)-2-(oxazol-2-yl)ethanamine trifluoroacetate I115
[0608] A solution of tert-butyl(2-(2-(methoxymethyl)phenyl)-2-(oxazol-2-yl)ethyl)carbamate I114 (40 mg, 0.12 mmol) in TFA (1 mL) was stirred at RT for 2 h. The mixture was then concentrated under reduced pressure to give the title compound (23 mg, 56%) as a yellow oil. LCMS-C: R.sub.t 0.35 min, m/z 233.0 [M+H].sup.+.
xxxix) 2-Amino-1-cyclohexylethanol Hydrochloride I116
[0609] ##STR00060##
[0610] To a solution of 2-amino-1-phenylethanol (274 mg, 2.0 mmol) in EtOH (20 mL) was added PtO.sub.2 (45 mg, 0.2 mmol) and conc. aqueous HCl (1 mL) and the mixture was heated at 120° C. under a H.sub.2 atmosphere (3 MPa) overnight. The mixture was filtered and the filtrate was concentrated under reduced pressure to give the title compound (57 mg, 16%) as a yellow oil, which was used directly in the next step without further purification. LCMS-C: R.sub.t 0.32 min, m/z 144.1 [M+H].sup.+.
xl) (1-(Pyridin-2-yl)cyclopentyl)methanamine I118
[0611] ##STR00061##
a) 1-(Pyridin-2-yl)cyclopentanecarbonitrile I117
[0612] To a solution of NaH (60% dispersion in mineral oil, 800 mg, 20 mmol) in DMSO (10 mL) at 15° C. under N.sub.2 was added a solution of 2-(pyridin-2-yl)acetonitrile (1.18 g, 10 mmol) and 1,4-dibromobutane (2.16 g, 10 mmol) in Et.sub.2O (10 mL) and DMSO (2 mL) dropwise over 1 h. The mixture was then allowed to warm to RT and stirred for 24 h. The reaction was carefully quenched by dropwise addition of isopropanol (5 mL) followed by water (10 mL). The mixture was stirred for 10 min, then extracted with EtOAc (200 mL) and the organic layer was washed with water, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (1.72 g, 100%) as a brown oil. LCMS-C: R.sub.t 1.11 min, m/z 173.0 [M+H].sup.+.
b) (1-(Pyridin-2-yl)cyclopentyl)methanamine I118
[0613] To a solution of 1-(pyridin-2-yl)cyclopentanecarbonitrile I117 (344 mg, 2 mmol) in THF (10 mL) was added LiAlH.sub.4 (2.5 M solution in THF, 1.6 mL, 4 mmol) and the mixture was stirred at RT for 2 h. The mixture was diluted with water (5 mL), extracted with EtOAc (100 mL) and the organic extract was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (200 mg, 60%) as a yellow oil. LCMS-C: R.sub.t 0.33 min, m/z 177.1 [M+H].sup.+.
xli) (1-(Pyridin-2-yl)cyclohexyl)methanamine (I120)
[0614] ##STR00062##
a) 1-(Pyridin-2-yl)cyclohexanecarbonitrile I119
[0615] To a solution of NaH (60% dispersion in mineral oil, 800 mg, 20 mmol) in DMSO (10 mL) at 15° C. under N.sub.2 was added a solution of 2-(pyridin-2-yl)acetonitrile (1.18 g, 10 mmol) and 1,5-dibromopentane (2.3 g, 10 mmol) in Et.sub.2O (80 mL) and DMSO (2 mL) dropwise over 1 h. The mixture was allowed to warm to RT and stirred for 24 h. The reaction was carefully quenched by dropwise addition of isopropanol (5 mL) followed by water (10 mL). The mixture was stirred for 10 min, then extracted with EtOAc (200 mL) and the organic layer was washed with water, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (1.86 g, 100%) as a brown oil. LCMS-C: R.sub.t 1.87 min, m/z 187.0 [M+H].sup.+.
b) (1-(Pyridin-2-yl)cyclohexyl)methanamine I120
[0616] To a solution of 1-(pyridin-2-yl)cyclohexanecarbonitrile I119 (372 mg, 2 mmol) in THF (10 mL) was added LiAlH.sub.4 (2.5 M solution in THF, 1.6 mL, 4 mmol) and the mixture was stirred at RT for 2 h. The mixture was diluted with water (5 mL), extracted with EtOAc (100 mL) and the organic extract was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (240 mg, 60%) as a yellow oil. LCMS-C: R.sub.t 0.35 min, m/z 191.1 [M+H].sup.+.
xlii) 2-Phenyl-2-(pyridin-2-yl)ethanamine (I121)
[0617] ##STR00063##
[0618] A mixture of 2-phenyl-2-(pyridin-2-yl)acetonitrile (100 mg, 0.5 mmol) and Raney nickel (20 mg) in conc. aqueous NH.sub.4OH (2 mL) was heated at 50° C. under a H.sub.2 atmosphere overnight. The mixture was then filtered and the filtrate was partitioned between EtOAc and water. The layers were separated and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (50 mg, 49%). LCMS-C: R.sub.t 0.36 min, m/z 199.1 [M+H].sup.+
xliii) 2-(4-Fluorophenyl)-2-(oxazol-2-yl)ethanamine I124
[0619] ##STR00064##
a) 2-(4-Fluorobenzyl)oxazole I122
[0620] To a mixture of 1,2,3-triazole (10 g, 0.14 mol) and K.sub.2CO.sub.3 (25 g, 0.18 mmol) in sulfolane (300 mL) at 0° C. was added 2-(4-fluorophenyl)acetyl chloride (20 g, 0.12 mol) dropwise and the mixture was heated at 165° C. for 1 h. After cooling to RT, the mixture was diluted with MTBE (500 mL), washed with brine, then dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1) to give the title compound (10.5 g, 51%) as a red solid. LCMS-D: R.sub.t 1.40 min; m/z 178.0 [M+H].sup.+.
b) 2-(2-(4-Fluorophenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I123
[0621] To a solution of 2-(4-fluorobenzyl)oxazole I122 (10 g, 56 mmol) in THF (200 mL) at −78° C. under N.sub.2 was LiHMDS (1 M solution in THF, 67.2 mL, 67.2 mmol) dropwise. The mixture was stirred for 45 min at −78° C., then added dropwise to a solution of 2-(bromomethyl)isoindoline-1,3-dione (16.1 g, 67.2 mmol) in THF (200 mL) at −78° C. and the mixture was stirred at −78° C. overnight. The mixture was diluted with water, extracted with EtOAc (500 mL×3) and the combined organic extracts were dried over Na.sub.2SO, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=8/1 to 4/1) to give the title compound (3.0 g, 16%) as a white solid, which was used directly in the next step.
c) 2-(4-Fluorophenyl)-2-(oxazol-2-yl)ethanamine I124
[0622] A suspension of 2-(2-(4-fluorophenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I123 (1.0 g, 3.0 mmol) and hydrazine monohydrate (451 mg, 9.0 mmol) in EtOH (50 mL) was heated at 80° C. for 3 h. The mixture was filtered and the solid was washed with EtOH (50 mL). The filtrate was then concentrated under reduced pressure to give the title compound (532 mg, 87%) as a yellow oil. LCMS-C: R.sub.t 0.29 min; m/z 207.0 [M+H].sup.+.
xliv) 2-(3-Chlorophenyl)-2-(oxazol-2-yl)ethanamine (I128)
[0623] ##STR00065##
a) 2-(3-Chlorophenyl)acetyl chloride I125
[0624] To a solution of 2-(3-chlorophenyl)acetic acid (20.0 g, 0.12 mol) and DMF (0.2 mL) in DCM (100 mL) was added oxalyl chloride (45.7 g, 0.36 mol) dropwise and the mixture was stirred at RT for 1 h. The mixture was then concentrated under reduced pressure to give the title compound (10.0 g, 45%) as a red oil. LCMS-C: R.sub.t 2.03 min; m/z 185.0 [M−Cl+MeO+H].sup.+.
b) 2-(3-Chlorobenzyl)oxazole I126
[0625] To a mixture of 1,2,3-triazole (8.8 g, 0.13 mol) and K.sub.2CO.sub.3 (23.5 g, 0.17 mol) in sulfolane (300 mL) at 0° C. was added 2-(3-chlorophenyl)acetyl chloride I125 (20.0 g, 0.11 mol) dropwise and the mixture was heated at 165° C. for 1 h. After cooling to RT, the mixture was diluted with MTBE (500 mL) and washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=10/1) to give the title compound (10.7 g, 53%) as a yellow oil. LCMS-C: R.sub.t 1.96 min; m/z 194.0 [M+H].sup.+.
c) 2-(2-(3-Chlorophenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I127
[0626] To a solution of 2-(3-chlorobenzyl)oxazole I126 (10.0 g, 51.6 mmol) in dry THF (200 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 62.0 mL, 62.0 mmol). The mixture was stirred at −78° C. for 45 min, then added to a solution of 2-(bromomethyl)isoindoline-1,3-dione (14.9 g, 62.0 mmol) in THF (200 mL) at −78° C. and the mixture was stirred at −78° C. overnight. The mixture was diluted with water and extracted with EtOAc (500 mL×3). The combined organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=8/1 to 4/1) to give the title compound (6.8 g, 37%) as a white solid. LCMS-C: R.sub.t 2.31 min; m/z 352.9 [M+H].sup.+.
d) 2-(3-Chlorophenyl)-2-(oxazol-2-yl)ethanamine I128
[0627] A suspension of 2-(2-(3-chlorophenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I127 (1.0 g, 2.8 mmol) and hydrazine monohydrate (426 mg, 8.5 mmol) in EtOH (50 mL) was heated at 80° C. for 3 h. The mixture was then filtered and the solid was washed with EtOH (50 mL). The filtrate was concentrated under reduced pressure to give the title compound (0.56 g, 89%) as a yellow oil. LCMS-C: R.sub.t 0.31 min; m/z 223.0 [M+H].sup.+.
xlv) 5-(2-(2-Aminoethyl)phenyl)-3-methyl-1,3,4-oxadiazol-2(3H)-one Trifluoroacetate (I131)
[0628] ##STR00066##
a) tert-Butyl 2-(4-methyl-5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)phenethylcarbamate I130
[0629] A mixture of tert-butyl 2-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)phenethylcarbamate I129 (see below) (200 mg, 0.66 mmol), K.sub.2CO.sub.3 (181 mg, 1.31 mmol) and CH.sub.3I (186 mg, 1.31 mmol) in DMF (10 mL) was stirred at RT under N.sub.2 overnight. Water was added and the mixture was extracted with EtOAc. The organic extract was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (389 mg, >100%) as a yellow oil, which was used directly in the next step. LCMS-C: R.sub.t 2.17 min; m/z 342.0 [M+Na].sup.+.
b) 5-(2-(2-Aminoethyl)phenyl)-3-methyl-1,3,4-oxadiazol-2(3H)-one Trifluoroacetate I131
[0630] A mixture of tert-butyl 2-(4-methyl-5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)phenethylcarbamate I130 (389 mg, assumed 0.66 mmol) and TFA (5 mL) in DCM (10 mL) was stirred at RT under N.sub.2 overnight. The mixture was concentrated under reduced pressure to give the title product (210 mg, 95%) as a yellow oil. LCMS-C: R.sub.t 0.34 min; m/z 220.0 [M+H].sup.+.
xlvi) N-Methyl-2-(oxazol-2-yl)-2-phenylethan-1-amine (I133)
[0631] ##STR00067##
a) N-(2-(Oxazol-2-yl)-2-phenylethyl)formamide I132
[0632] A solution of 2-(oxazol-2-yl)-2-phenylethan-1-amine 127 (600 mg, 3.19 mmol) in ethyl formate (15 mL) was heated at 80° C. for 3 h. After cooling to RT, water (50 mL) was added and the mixture was extracted with DCM (50 mL×3). The combined organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (500 mg, 72%), which was used directly in the next step without further purification. LCMS-D: R.sub.t 0.46 min; m/z 217.1 [M+H].sup.+.
b) N-Methyl-2-(oxazol-2-yl)-2-phenylethan-1-amine I133
[0633] A mixture of N-(2-(oxazol-2-yl)-2-phenylethyl)formamide I132 (300 mg, 1.39 mmol) and BH.sub.3.THF (1 M solution in THF, 6 mL, 6 mmol) was heated at 70° C. for 3 h, then allowed to cool to RT, adjusted to pH 5 with 10% aqueous HCl and stirred for 1 h. The mixture was washed with EtOAc (40 mL×3) and the aqueous layer was then adjusted pH 9 with 1 M aqueous NaOH and extracted with EtOAc (40 mL×3). The combined organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (130 mg, 46%) as a yellow oil. LCMS-D: R.sub.t 0.32 min; m/z 203.1 [M+H].sup.+.
xlvii) 2-(2-(1H-Imidazol-1-yl)phenyl)ethan-1-amine dihydrochloride (I135)
[0634] ##STR00068##
a) 2-(2-(1H-Imidazol-1-yl)phenyl)acetonitrile I134
[0635] A mixture of 2-(2-iodophenyl)acetonitrile (600 mg, 2.47 mmol), 1H-imidazole (252 mg, 3.7 mmol), Fe(acac).sub.3 (262 mg, 0.741 mmol), Cs.sub.2CO.sub.3 (1.61 g, 4.94 mmol) and CuO (20 mg, 0.247 mmol) in DMF (15 mL) was heated at 90° C. under N.sub.2 in a sealed tube for 30 h. The mixture was then filtered and the filtrate was diluted with water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic extracts were concentrated under reduced pressure and the residue was purified by silica gel chromatography (DCM/MeOH=15/1) to give the title compound (180 mg, 40%) as a yellow oil. LCMS-D: R.sub.t 2.43 min, m/z 184.0 [M+H].sup.+.
b) 2-(2-(1H-Imidazol-1-yl)phenyl)ethan-1-amine Dihydrochloride I135
[0636] To a solution of 2-(2-(1H-imidazol-1-yl)phenyl)acetonitrile I134 (90 mg, 0.49 mmol) in MeOH (5 mL) was added 10% Pd/C (50 mg) and conc. aqueous HCl (0.2 mL) and the mixture was stirred at RT under a H.sub.2 atmosphere overnight. The mixture was filtered and the filter cake rinsed with MeOH (3 mL×2). The filtrate was concentrated under reduced pressure to give the title compound (80 mg, 63%) as a yellow oil. LCMS-D: R.sub.t 0.89 min, m/z 188.0 [M+H].sup.+.
xlviii) 2-([1,1′-Biphenyl]-2-yl)-2-(oxazol-2-yl)ethanamine (I136)
[0637] ##STR00069##
[0638] To a solution of 2-(2-iodophenyl)-2-(oxazol-2-yl)ethanamine I106 (157 mg, 0.5 mmol) in DMF/H.sub.2O (10 mL/2 mL) was added phenylboronic acid (122 mg, 1 mmol), Pd(PPh.sub.3).sub.4 (57 mg, 0.05 mmol) and Cs.sub.2CO.sub.3 (450 mg, 1.5 mmol) and the mixture was heated at 110° C. under N.sub.2 overnight. The mixture was diluted with EtOAc (100 mL), washed with water (100 mL×5) and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (20 mg, 15%) as a yellow oil. LCMS-C: R.sub.t 0.55 min, m/z 265.0 [M+H].sup.+.
xlix) 5-(2-(2-Aminoethyl)phenyl)-1,3,4-oxadiazol-2(3H)-one (I141)
[0639] ##STR00070##
a) Methyl 2-(2-aminoethyl) Benzoate Hydrochloride I137
[0640] To a solution of methyl 2-(cyanomethyl) benzoate (2.09 g, 11.9 mmol) in MeOH (30 mL) was added 10% Pd/C (1.05 g) and conc. aqueous HCl (5 mL) and the mixture was stirred at RT under a H.sub.2 atmosphere overnight. The mixture was filtered and the filtrate was concentrated under reduced pressure. The residue was suspended in MeOH (5 mL) then diluted with Et.sub.2O (100 mL). The solid was collected by filtration, washed with Et.sub.2O and dried under vacuum to give the title compound (1.25 g 58%) as a white solid. LCMS-D: R.sub.t 0.31 min; m/z 180.1 [M+H].sup.+.
b) Methyl 2-(2-((tert-butoxycarbonyl)amino)ethyl)benzoate I138
[0641] A solution of methyl 2-(2-aminoethyl) benzoate I137 (1.22 g 6.82 mmol), Boc.sub.2O (2.23 g, 10.2 mmol) and Et.sub.3N (2.07 g, 20.5 mmol) in DCM (30 mL) was stirred at RT under N.sub.2 overnight. The mixture was partitioned between water and EtOAc, the layers were separated and the organic layer was washed with water, brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (1.87 g, 98%) as a yellow oil. LCMS-D: R.sub.t 2.27 min; m/z 180.1 [M-Boc+2H].sup.+.
c) 2-(2-((tert-Butoxycarbonyl)amino)ethyl)benzoic Acid I139
[0642] To a solution of methyl 2-(2-((tert-butoxycarbonyl)amino)ethyl)benzoate I138 (1.87 g, 6.72 mmol) in MeOH (18 mL) and water (5 mL) was added NaOH (1.34 g, 33.6 mmol) and the mixture was heated at 50° C. for 5 h. The mixture was partitioned between water and EtOAc, the layers were separated and the organic layer was extracted with water. The combined aqueous layers were acidified to pH 2 with 1 M aqueous HCl and extracted with EtOAc. The organic extract was then dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (986 mg 55%) as a yellow solid. LCMS (ES-API): R.sub.t 1.83 min; m/z 264.1 [M−H].sup.−.
d) tert-Butyl (2-(hydrazinecarbonyl) phenethyl)carbamate I140
[0643] To a solution of 2-(2-((tert-butoxycarbonyl)amino)ethyl)benzoic acid I139 (980 mg, 3.70 mmol) in THF (15 mL) was added CDI (719 mg, 4.44 mmol) and the mixture was stirred at RT for 2 h. Hydrazine monohydrate (555 mg, 11.1 mmol) was then added and the mixture was stirred at RT for a further 5 h. The mixture was partitioned between water and EtOAc, the layers were separated and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (1.00 g, 99%) as a colorless oil. LCMS-D: R.sub.t 0.48 min; m/z 180.1 [M-Boc+2H].sup.+.
e) tert-Butyl (2-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)phenethyl)carbamate I129
[0644] To a solution of tert-butyl (2-(hydrazinecarbonyl) phenethyl)carbamate I140 (1.00 g, 3.69 mmol) in THF (20 mL) was added CDI (1.79 g, 11.1 mmol) and the mixture was heated at reflux for 6 h. The solvent was removed under reduced pressure and the residue was diluted with water. The resulting precipitate was collected by filtration, washed with water and dried under vacuum to give the title compound (900 mg, 80%) as a yellow oil. LCMS-D: R.sub.t 1.91 min; m/z 206.0 [M-Boc+2H].sup.+.
f) 5-(2-(2-Aminoethyl)phenyl)-1,3,4-oxadiazol-2(3H)-one I141
[0645] A mixture of tert-butyl (2-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)phenethyl)carbamate I129 (850 mg, 2.79 mmol) and TFA (8 mL) in DCM (2 mL) was stirred at RT for 5 h. The mixture was concentrated under reduced pressure and the residue was purified by silica gel chromatography (DCM/MeOH=50/1 to 30/1) to give the title compound (380 mg, 66%) as a white solid. LCMS-D: R.sub.t 0.31 min; m/z 206.1 [M+H].sup.+.
I) 2-(Oxazol-2-yl)-2-(p-tolyl)ethan-1-amine (I145)
[0646] ##STR00071##
a) 2-(p-Tolyl)acetyl Chloride I142
[0647] To a solution of 2-(p-tolyl) acetic acid (12.7 g, 84.6 mmol) and DMF (0.2 mL) in DCM (100 mL) was added oxalyl chloride (32.2 g, 254 mmol) dropwise and the mixture was stirred at RT for 1 h. The mixture was then concentrated under reduced pressure to give the title compound (10.1 g, 71%), which was used directly in the next step. LCMS-C: R.sub.t 2.00 min; m/z 165.0 [M−Cl+MeO+H].sup.+.
b) 2-(4-Methylbenzyl)oxazole I143
[0648] To a solution of 1,2,3-1H-triazole (4.9 g, 71.2 mmol) and K.sub.2CO.sub.3 (12.3 g, 88.9 mmol) in sulfolane (150 mL) at RT was added 2-(p-tolyl)acetyl chloride I142 (10.0 g, 59.3 mmol) dropwise and the mixture was heated at 165° C. under N.sub.2 for 1 h. After cooling to RT, the mixture was diluted with water (200 mL) and extracted with diethyl ether (200 mL×3). The combined organic extracts were washed with water, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1 to 15/1) to give the title compound (7.2 g, 70%) as a burgundy colored oil. LCMS-C: R.sub.t 1.77 min; m/z 174.0 [M+H].sup.+.
c) 2-(2-(Oxazol-2-yl)-2-(p-tolyl)ethyl)isoindoline-1,3-dione I144
[0649] To a solution of 2-(4-methylbenzyl)oxazole I143 (7.0 g, 40.5 mmol) in anhydrous THF (200 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 49.0 mL, 49.0 mmol) dropwise. The mixture was stirred at −78° C. for 1 h then added to a solution of 2-(bromomethyl)isoindoline-1,3-dione (11.7 g, 48.6 mmol) in anhydrous THF (100 mL) dropwise. The mixture was then allowed to warm to RT and stirred overnight. The reaction was quenched with a saturated aqueous NH.sub.4Cl solution (50 mL) and the mixture was diluted with water (500 mL) and extracted with EtOAc (500 mL×3). The combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1 to 5/1) to give the title compound (3.5 g, 26%) as a yellow oil. LCMS-C: R.sub.t 2.22 min; m/z 333.0 [M+H].sup.+.
d) 2-(Oxazol-2-yl)-2-(p-tolyl)ethan-1-amine I145
[0650] A mixture of 2-(2-(oxazol-2-yl)-2-(p-tolyl)ethyl)isoindoline-1,3-dione I144 (3.5 g, 10.5 mmol) and hydrazine monohydrate (1.58 g, 31.6 mmol) in EtOH (120 mL) was heated at 80° C. for 3 h. The mixture was then filtered and the filtrate was concentrated under reduced pressure to give the title compound (1.5 g, 70%) as a yellow oil. LCMS-C: R.sub.t 0.38 min; m/z 203.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.99 (d, J=0.8 Hz, 1H), 7.16 (d, J=0.7 Hz, 1H), 7.14-7.08 (m, 4H), 4.13 (m, 1H), 3.21 (m, 1H), 2.98 (m, 1H), 2.26 (s, 3H).
li) 2-(3-Methoxy-5-methylphenyl)-2-(oxazol-2-yl)ethan-1-amine (I150)
[0651] ##STR00072##
a) 2-(3-Methoxy-5-methylphenyl)acetic Acid I146
[0652] To a solution of 1-methoxy-3,5-dimethylbenzene (10.0 g, 73.4 mmol) in THF (400 mL) at −78° C. was added n-BuLi (2.5 M solution in hexane, 38.0 mL, 95.5 mmol) dropwise and the mixture was stirred for 15 min. t-BuOK (1 M solution in THF, 88.0 mL, 88.0 mmol) was then added dropwise followed by 2,2,6,6-tetramethylpiperidine (10.4 g, 73.4 mmol) and the mixture was stirred at −78° C. for 30 min. The reaction was quenched with excess dry ice and the mixture was allowed to RT. The solvent was removed under reduced pressure and the residue was diluted with Et.sub.2O (500 mL×4) and extracted with 2 M aqueous NaOH (3×50 mL). The combined aqueous layers were acidified to pH 1 with 2 M aqueous HCl, extracted with DCM and the organic extract was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (10.0 g, 75%) as a brown oil. LCMS-C: R.sub.t 0.79 min; m/z 181.0 [M+H].sup.+.
b) 2-(3-Methoxy-5-methylphenyl)acetyl Chloride I147
[0653] To a solution of 2-(3-methoxy-5-methylphenyl)acetic acid I146 (1.7 g, 9.5 mmol) in DCM (100 mL) was added oxalyl chloride (3.62 g, 28.5 mmol) dropwise and DMF (1 mL) and the mixture was stirred at RT for 3 h. The mixture was then concentrated under reduced pressure to give the title compound (1.63 g, 86%) as a red solid, which was used directly in the next step.
c) 2-(3-Methoxy-5-methylbenzyl)oxazole I148
[0654] To a solution of 1,2,3-1H-triazole (679 mg, 9.84 mmol) and K.sub.2OO.sub.3(1.70 g, 12.3 mmol) in sulfolane (300 mL) at RT was added 2-(3-methoxy-5-methylphenyl)acetyl chloride I147 (1.63 g, 8.2 mmol) dropwise and the mixture was then heated at 165° C. for 1 h. The mixture was allowed to cool to RT, diluted with water and extracted with diethyl ether. The combined organic layers were washed with water, brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1 to 15/1) to give the title compound (2.31 g, 54%) as a brown oil. LCMS-C: R.sub.t 1.77 min; m/z 204.0 [M+H].sup.+.
d) 2-(2-(3-Methoxy-5-methylphenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I149
[0655] To a solution of 2-(3-methoxy-5-methylbenzyl)oxazole I148 (2.31 g, 11.4 mmol) in anhydrous THF (100 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 13.7 mL, 13.7 mmol) dropwise. The mixture was stirred at −78° C. for 1 h, then added to a solution of 2-(bromomethyl)isoindoline-1,3-dione (3.29 g, 13.7 mmol) in anhydrous THF (100 mL) dropwise. The mixture was allowed to warm to RT and stirred overnight. The reaction was quenched with a saturated aqueous NH.sub.4Cl solution and the mixture was diluted with water and extracted with DCM (500 mL×3). The combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1 to 5/1) to give the title compound (960 mg, 23%) as a yellow oil. LCMS-C: R.sub.t 2.28 min; m/z 363.0 [M+H].sup.+.
e) 2-(3-Methoxy-5-methylphenyl)-2-(oxazol-2-yl)ethan-1-amine I150
[0656] A mixture of 2-(2-(3-methoxy-5-methylphenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione I149 (960 mg, 2.65 mmol) and hydrazine monohydrate (397.5 mg, 7.95 mmol) in EtOH (150 mL) was heated at 80° C. for 3 h. The mixture was then concentrated under reduced pressure and the residue was purified by silica gel chromatography (EtOAc/Pet. ether=50/1 to 2/1) to give the title compound (300 mg, 48%) as a yellow oil. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.00 (s, 1H), 7.17 (s, 1H), 6.72-6.42 (m, 3H), 4.18-3.95 (m, 1H), 3.70 (s, 3H), 3.24-3.17 (m, 1H), 3.08-2.86 (m, 1H), 2.23 (s, 3H).
lii) 2-([1,1′-Biphenyl]-3-yl)-2-(oxazol-2-yl)ethan-1-amine (I151)
[0657] ##STR00073##
[0658] To a solution of 2-(3-iodophenyl)-2-(oxazol-2-yl)ethan-1-amine I88 (100 mg, 0.32 mmol) in DMF (10 mL) and water (2 mL) was added phenylboronic acid (78 mg, 0.64 mmol), Pd(PPh.sub.3).sub.4 (74 mg, 0.064 mmol) and Cs.sub.2CO.sub.3 (622 mg, 1.9 mmol) and the mixture was heated at 110° C. under N.sub.2 overnight. The mixture was diluted with water, extracted with EtOAc and the organic extract was concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1, v/v) to give the title compound (30 mg, 35%) as a yellow solid. LCMS-C: R.sub.t 0.55 min, m/z 265.1 [M+H].sup.+.
liii) 3-Amino-2-cyclohexylpropan-1-ol (I155)
[0659] ##STR00074##
a) 3-((tert-Butyldimethylsilyl)oxy)-2-phenylpropan-1-ol I152
[0660] To a solution of 2-phenylpropane-1,3-diol (5.0 g, 32.9 mmol), TBDMSCI (4.95 g, 32.9 mmol) and DMAP (40 mg, 0.329 mmol) in DCM (60 mL) at 0° C. under N.sub.2 was added Et.sub.3N (3.66 g, 36.2 mmol) and the mixture was stirred at RT for 12 h. The mixture was partitioned between water and DCM, the layers were separated and the organic phase was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=30/1) to give the title compound (2.75 g, 32%) as a colorless oil. LCMS-C: R.sub.t 2.69 min; m/z 267.1 [M+H].sup.+.
[0661] b) 2-(3-((tert-Butyldimethylsilyl)oxy)-2-phenylpropyl)isoindoline-1,3-dione I153 To an ice-cooled solution of 3-((tert-butyldimethylsilyl)oxy)-2-phenylpropan-1-ol I152 (1.4 g, 5.25 mmol), phthalimide (850 mg, 5.78 mmol) and PPh.sub.3 (1.52 g, 5.78 mmol) in THF (20 mL) was added a solution of DIAD (1.17 g, 5.78 mmol) in THF (10 mL) dropwise and the mixture was stirred at RT overnight. The mixture was partitioned between water and EtOAc, the layers were separated and the organic layer was concentrated under reduced pressure to give the title compound (1.2 g, 58%) as a yellow oil, which was used directly in the next step.
c) 3-Amino-2-phenylpropan-1-ol I154
[0662] A mixture of 2-(3-((tert-butyldimethylsilyl)oxy)-2-phenylpropyl)isoindoline-1,3-dione I153 (1.2 g, 3.03 mmol) and hydrazine monohydrate (445 mg, 9.09 mmol) in EtOH (50 mL) was heated at 80° C. for 3.5 h under N.sub.2. The mixture was allowed to cool to RT, partitioned between water and EtOAc, the layers were separated and the organic layer was concentrated under reduced pressure to give the title compound (660 mg, 83%) as a colorless oil. LCMS-C: R.sub.t 0.29 min; m/z 152.0 [M+H].sup.+.
d) 3-Amino-2-cyclohexylpropan-1-ol I155
[0663] A mixture of 3-amino-2-phenylpropan-1-ol I154 (100 mg, 0.66 mmol) and Pt.sub.2O (10 mg) in AcOH (5 mL) was stirred at RT under a H.sub.2 atmosphere for 72 h. The catalyst was removed by filtration and the filtrate was concentrated under reduced pressure to give the title compound (87 mg, 84%) as a colorless oil. LCMS (ES-API): R.sub.t 0.27 min; m/z 158.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) 3.55-3.49 (m, 1H), 3.46-3.39 (m, 1H), 2.78-2.71 (m, 1H), 2.70-2.61 (m, 1H), 1.40-1.28 (m, 2H), 1.20-1.08 (m, 2H), 1.04-0.93 (m, 3H), 0.89-0.83 (m, 5H).
liv) Ethyl 7-(1H-1,2,3-triazol-4-yl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I158)
[0664] ##STR00075##
a) Ethyl 7-((trimethylsilyl)ethynyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I156
[0665] To a mixture of ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I7 (1.0 g, 2.63 mmol), CuI (25 mg, 0.13 mmol) and Pd(PPh.sub.3).sub.2Cl.sub.2(91 mg, 0.13 mmol) in Et.sub.3N (20 mL) and DMF (50 mL) under N.sub.2 was added ethynyltrimethylsilane (1.03 g, 0.1 mmol) and the mixture was stirred at 30° C. overnight. The mixture was partitioned between water and EtOAc, the layers were separated and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=100/1) to give the title compound (350 mg, 38%) as a black solid. LCMS (ES-API): R.sub.t 2.43 min; m/z 351.0 [M+H].sup.+.
b) Ethyl 7-ethynyl-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I157
[0666] To a solution of ethyl 7-((trimethylsilyl)ethynyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I156 (300 mg, 0.86 mmol) in THF (30 mL) was added TBAF (1 M solution in THF, 4.28 mL, 4.28 mmol) and the mixture was heated at 40° C. overnight. The mixture was partitioned between water and EtOAc, the layers were separated and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=100/1) to give the title compound (217 mg, 91%) as an orange solid. LCMS-C: R.sub.t 2.58 min; m/z 279.0 [M+H].sup.+.
c) Ethyl 7-(1H-1,2,3-triazol-4-yl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I158
[0667] A mixture of ethyl 7-ethynyl-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I157 (180 mg, 0.65 mmol), azidotrimethylsilane (111.6 mg, 0.97 mmol) and CuI (37 mg, 0.19 mmol) in DMF (7 mL) and EtOH (1 mL) was heated at 120° C. overnight. The mixture was partitioned between water and EtOAc, the layers were separated and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=20/1) to give the title compound (17 mg, 7%) as an orange oil. LCMS-C: R.sub.t 0.45 min; m/z 321.9 [M+H].sup.+.
lv) Ethyl 7-(methylsulfonyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I161)
[0668] ##STR00076##
a) 2-Chloro-5-(methylsulfonyl)benzenesulfonamide I159
[0669] 1-Chloro-4-(methylsulfonyl)benzene (10.0 g, 5.3 mmol) was slowly added to CISO.sub.3H (63 mL) and the mixture was heated at 100° C. for 1 h. SO.sub.2Cl.sub.2 (3.8 mL) was then added and the mixture was heated at reflux for 2 h, then allowed to cooled to RT and poured into ice-water. The resulting precipitate was collected by filtration and washed with cold water. The solid was dissolved in aqueous NH.sub.4OH solution (10% w/v, 375 mL) and the mixture was stirred at RT for 30 min. The mixture was concentrated under reduced pressure until precipitation occurred and the precipitate was collected by filtration and washed with water. The filter cake was dissolved in an aqueous NaOH solution (10% w/v, 50 mL) and the mixture was adjusted to pH 5 with 6 M aqueous HCl solution. The resulting precipitate was collected by filtration, washed with water and dried to give the title compound (2.0 g, 14%) as a white solid. LCMS-D: R.sub.t 1.5 min, m/z 270.0 [M+H].sup.+.
b) 2-Amino-5-(methylsulfonyl)benzenesulfonamide I160
[0670] A solution of 2-chloro-5-(methylsulfonyl)benzenesulfonamide I159 (1.0 g, 3.7 mmol) in conc. aqueous NH.sub.4OH (200 mL) was stirred at RT for 4 h. The mixture was concentrated under reduced pressure and the residue was adjusted to pH 5 with 6 M aqueous HCl. The resulting precipitate was collected by filtration, washed with water and dried to give the title compound (500 mg, 54%) as a white solid. LCMS-D: R.sub.t 1.70 min, m/z 249.0 [M−H].sup.−.
c) Ethyl 7-(methylsulfonyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I161
[0671] To a solution of 2-amino-5-(methylsulfonyl)benzenesulfonamide I160 (240 mg, 0.96 mmol) and ethyl 2-ethoxy-2-iminoacetate (278 mg, 1.92 mmol) in EtOH (2 mL) was added Et.sub.3N (291 mg, 2.88 mmol) and the mixture was heated at 120° C. under microwave irradiation for 2 h. The solvent was removed under reduced pressure and the residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (50 mg, 16%) as a white solid. LCMS-D: R.sub.t 1.70 min, m/z 333.0 [M+H].sup.+.
lvi) Ethyl 7-chloro-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I162)
[0672] ##STR00077##
[0673] To a solution of 2-amino-5-chlorobenzenesulfonamide (1.0 g, 4.8 mmol) in AcOH (40 mL) was added ethyl carbonocyanidate (4.8 g, 48.0 mmol) and the mixture was stirred at RT under N.sub.2 for 5 min. Concentrated aqueous HCl (1 mL) was then added and the mixture was heated at 85° C. for 4 h. The mixture was concentrated under reduced pressure to remove ˜⅔ of the solvent and then diluted with water (20 mL). The resulting precipitate was collected by filtration and washed with water. The solid was diluted with DCM (60 mL), stirred for 1 h then filtered and the filter cake was rinsed with DCM. The combined filtrates were concentrated under reduced pressure to give the title compound (950 mg, 68%) as a grey solid. LCMS-D: R.sub.t 1.05 min; m/z 288.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.9 (br s, 1H), 7.94 (d, J=2.0 Hz, 1H), 7.84-7.77 (m, 2H), 4.40 (q, J=7.1 Hz, 2H), 1.35 (t, J=7.1 Hz, 3H).
lviii) 7-Chloro-2H-benzo[e][1,2,4]thiadiazine-3-carboxylic Acid 1,1-dioxide (I163)
[0674] ##STR00078##
[0675] To a solution of ethyl 7-chloro-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I162 (560 mg, 1.94 mmol) in MeOH (75 mL) and water (25 mL) at RT was added NaOH (388 mg, 9.7 mmol) and the mixture was stirred at RT for 4 h. Most of the MeOH was removed under reduced pressure and the aqueous residue was diluted with Et.sub.2O (20 mL). The layers were separated and the organic phase was extracted with water (10 mL). The combined aqueous layers were adjusted to pH 2 with 1 M aqueous HCl and the resulting precipitate was collected by filtration and dried to give the title compound (300 mg, 59%) as a white solid. LCMS-C: R.sub.t 0.39 min; m/z 258.9 [M−H].sup.−.
Example 1: 7-Bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1)
[0676] ##STR00079##
[0677] Ethyl 7-bromo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I5) (1.06 g, 3.19 mmol) and 2-(oxazol-2-yl)-2-phenylethanamine (I27) (500 mg, 2.66 mmol) were dissolved in methanol (8 mL) and the mixture was heated in a sealed tube at 130° C. for 3h then cooled to r.t. The mixture was filtered and the filter cake was washed with methanol (5 mL). The combined filtrates were concentrated to give the product (1.00 g, 39% yield) as a white solid. LCMS (ES-API): R.sub.t 2.62 min; m/z 475/477 [M+H].sup.+. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.8 (s, 1H), 9.30 (t, J=5.6 Hz, 1H), 8.05 (s, 1H), 8.01 (d, J=2.0 Hz, 1H), 7.93 (dd, J=8.8 Hz, 2.0 Hz, 1H), 7.76 (d, J=8.4 Hz, 1H), 7.36-7.27 (m, 5H), 7.21 (s, 1H), 4.68 (t, J=7.6 Hz, 1H), 4.05-3.85 (m, 2H).
Example 2: N-(3-Hydroxy-2-phenylpropyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (2)
[0678] ##STR00080##
[0679] 3-(1,1-Dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoic acid (I36) (50 mg, 0.129 mmol) was added into BH.sub.3.THF (2 M in THF, 10 mL) at r.t. under nitrogen and the mixture was stirred at r.t. for 30 min. The solvent was removed under vacuum to give a residue which was purified by preparative TLC (DCM/MeOH=20:1) to give the desired product (25 mg, 54% yield) as a white solid. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.6 (s, 1H), 9.13 (t, J=6.0 Hz, 1H), 7.85-7.79 (m, 2H), 7.74-7.72 (m, 1H), 7.54 (t, J=8.0 Hz, 1H), 7.31-7.21 (m, 5H), 4.84 (t, J=4.8 Hz, 1H), 3.60-3.58 (m, 4H), 3.17-3.10 (m, 1H); LCMS (ES-API): R.sub.t 2.10 min, m/z 360.1 [M+H].sup.+
Example 3: N-(4-Hydroxy-2-phenylbutyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (3)
[0680] ##STR00081##
[0681] 4-(1,1-Dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-3-phenylbutanoic acid (I51) (80 mg, 0.206 mmol) was added into BH.sub.3.THF (2 M in THF, 40 mL) at r.t. under nitrogen and the mixture was stirred at r.t. for 3 h. The solvent was removed under vacuum to give a residue which was purified by preparative TLC (DCM/MeOH=20:1) to give the desired product (40 mg, 52% yield) as a white solid. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.6 (s, 1H), 9.17 (t, J=6.0 Hz, 1H), 7.85 (d, J=8.0 Hz, 1H), 7.80 (d, J=8.0 Hz, 1H), 7.74-7.70 (m, 1H), 7.54 (t, J=8.0 Hz, 1H), 7.31-7.28 (m, 2H), 7.23-7.18 (m, 3H), 4.49 (t, J=4.8 Hz, 1H), 3.03-3.05 (m, 5H), 1.93-1.86 (m, 1H), 1.73-1.62 (m, 1H); LCMS (ES-API): R.sub.t 2.18 min, m/z 374.1 [M+H].sup.+
Example 4: 7-Isocyano-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (4)
[0682] ##STR00082##
[0683] A mixture of 7-bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1) (50 mg, 0.105 mmol), Zn(CN).sub.2 (62 mg, 0.525 mmol), Pd.sub.2(dba).sub.3 (19 mg, 0.021 mmol), Xantphos (18 mg, 0.0315 mmol) and Cs.sub.2CO.sub.3 (171 mg, 0.525 mmol) in DMF (3 mL) was heated at 160° C. in a microwave reactor for 30 min. The mixture was partitioned between dichloromethane and water and the aqueous layer was adjusted to pH 2-3 with aqueous HCl. The layers were separated and the aqueous phase was washed with water, brine and dried over Na.sub.2SO.sub.4. The solvent was removed under vacuum and the residue was purified by preparative TLC (DCM/MeOH=50:1) to give the desired product (25 mg, 57% yield) as a white solid. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.9 (s, 1H), 9.35 (t, J=6.4 Hz, 1H), 8.48 (d, J=1.6 Hz, 1H), 8.15 (dd, J=8.4, 1.6 Hz, 1H), 8.05 (s, 1H), 7.92 (d, J=8.8 Hz, 1H), 7.36-7.27 (m, 5H), 7.21 (s, 1H), 4.69 (t, J=7.6 Hz, 1H), 4.05-3.98 (m, 1H), 3.91-3.85 (m, 1H); LCMS (ES-API): R.sub.t 2.10 min, m/z 422.1 [M+H].sup.+
Example 5: N-(2-(Oxazol-2-yl)-2-phenylethyl)-7-(trifluoromethoxy)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (5)
[0684] ##STR00083##
a) 2-Amino-5-(trifluoromethoxy)benzenesulfonic acid (A2)
[0685] To a solution of 4-(trifluoromethoxy)aniline (20 g, 0.113 mol) in 1, 2, 4-trichlorobenzene (100 mL) at 100° C. was added H.sub.2504 dropwise (95%, 15.2 g). After addition, the mixture was heated at 210° C. for 3 h, cooled to r.t. and then basified with Na.sub.2CO.sub.3 (sat. aq.). The mixture was then washed with DCM and the aqueous layer was acidified to pH 2 with 1 M HCl. The resulting precipitate was collected by filtration and dried to give the product (10 g, 34% yield) as an off-white solid. LCMS (ES-API): R.sub.t 1.25 min; m/z 256.0 [M−H].sup.−.
b) 2-Amino-5-(trifluoromethoxy)benzenesulfonamide (A3)
[0686] To a solution of 2-amino-5-(trifluoromethoxy)benzenesulfonic acid (A2) (3.5 g, 13.61 mmol) in tetrahydrothiophene 1,1-dioxide (15 mL) at r.t. was added POCl.sub.3 (6.26 g, 40.82 mmol) and the mixture was heated at 120° C. for 3 h. After cooling, the mixture was added dropwise to a solution of conc. NH.sub.4OH (100 mL) at 0° C. and stirred for 30 min. The mixture was extracted with EtOAc, the organic layer was dried (Na.sub.2SO.sub.4), filtered, concentrated and purified by column chromatography (EtOAc/Pet. Ether=1:1) to give the product (1.4 g, crude) which was used directly in the next step. LCMS (ES-API): R.sub.t 2.06 min; m/z 257.0 [M+H].sup.+.
c) Ethyl 7-(trifluoromethoxy)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (A4)
[0687] A mixture of 2-amino-5-(trifluoromethoxy)benzenesulfonamide (A3) (800 mg, 3.12 mmol), ethyl 2-ethoxy-2-iminoacetate (680 mg, 4.68 mmol) and TEA (631 mg, 6.24 mmol) in EtOH (20 mL) was heated at 85° C. for 8 h. The mixture was then poured into water and extracted with EtOAc. The organic layer was washed with 1 M HCl, dried (Na.sub.2SO.sub.4), filtered, concentrated and purified by column chromatography (EtOAc/Pet. Ether=1:1) to give the product (200 mg, 19% yield) as a yellow solid. LCMS (ES-API): R.sub.t 2.41 min; m/z 339.0 [M+H].sup.+.
d) N-(2-(Oxazol-2-yl)-2-phenylethyl)-7-(trifluoromethoxy)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (5)
[0688] A mixture of ethyl 7-(trifluoromethoxy)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (A4) (80 mg, 0.24 mmol) and 2-(oxazol-2-yl)-2-phenylethanamine (I27) (45 mg, 0.24 mmol) in EtOH (2 mL) was heated at 130° C. for 2 h. After cooling, the mixture was purified directly by preparative TLC (DCM/MeOH=20:1) to give the product (75 mg, 66% yield) as a white solid. LCMS (ES-API): R.sub.t 2.71 min; m/z 481.0 [M+H].sup.+. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.9 (s, 1H), 9.32 (t, J=5.6 Hz, 1H), 8.05 (s, 1H), 7.95 (d, J=9.2 Hz, 1H), 7.86 (s, 1H), 7.81 (d, J=8.8 Hz, 1H), 7.36-7.26 (m, 5H), 7.21 (s, 1H), 4.68 (t, J=7.6 Hz, 1H), 4.05-3.99 (m, 1H), 3.92-3.86 (m, 1H).
Example 6: N-(2-(2-Methylpyridin-3-yl)phenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (6)
[0689] ##STR00084##
a) 2-(2-(2-Methylpyridin-3-yl)phenyl)acetonitrile (A5)
[0690] (2-Methylpyridin-3-yl)boronic acid (550 mg, 3.2 mmol), 2-(2-bromophenyl)acetonitrile (597 mg, 3.05 mmol), Pd(PPh.sub.3).sub.4 (176 mg, 0.15 mmol) and K.sub.2CO.sub.3 (176 mg, 0.15 mmol) were dissolved in iPrOH (5 mL) and water (2 mL) and the mixture was heated at 80° C. under N.sub.2 for 5h. The mixture was filtered and the solid was washed with DCM (20 mL). The filtrate was washed with brine, dried over sodium sulfate and concentrated. Column chromatography (DCM/MeOH=100:0-20:1) gave the product (300 mg, 45% yield) as a yellow solid. LCMS (ES-API): R.sub.t 0.44 min; m/z 209.1 [M+H].sup.+.
b) 2-(2-(2-Methylpyridin-3-yl)phenyl)ethanamine (A6)
[0691] A mixture of 2-(2-(2-methylpyridin-3-yl)phenyl)acetonitrile (A5) (300 mg, 1.4 mmol), NaOH (I173 mg, 4.3 mmol) and Raney-Ni (100 mg) in THF (5 mL) and water (2 mL) was heated at 60° C. under H.sub.2 for 5 h. The mixture was filtered and the solid was washed with DCM (20 mL). The filtrate was washed with brine, dried over sodium sulfate and concentrated to give the product (200 mg, 65% yield) as a white solid. LCMS (ES-API): R.sub.t 0.29 min; m/z 213.1 [M+H].sup.+.
c) N-(2-(2-Methylpyridin-3-yl)phenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (6)
[0692] A mixture of 2-(2-(2-Methylpyridin-3-yl)phenyl)ethanamine (A6) (35 mg, 0.17 mmol), ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (50 mg, 0.20 mmol) and triethylamine (0.2 mL) in methanol (3 mL) was heated in a sealed tube at 130° C. for 3h. The mixture was allowed to cool to r.t., adjusted to pH 5 with 1 M HCl and extracted with DCM (10 mL×3). The combined organic extracts were washed with brine, dried over sodium sulfate and concentrated to give a residue which was purified by preparative TLC (MeOH/DCM=1:20) to give the product (5 mg, 10% yield) as an off-white solid. LCMS (ES-API): R.sub.t 1.63 min; m/z 421.1 [M+H].sup.+. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.5 (s, 1H), 9.20 (t, J=5.6 Hz, 1H), 8.46 (dd, J=4.8 Hz, 1.6 Hz, 1H), 7.85-7.79 (m, 2H), 7.74-7.70 (m, 1H), 7.54-7.50 (m, 2H), 7.41-7.29 (m, 3H), 7.24-7.21 (m, 1H), 7.11 (d, J=7.2 Hz, 1H), 3.32-3.27 (m, 2H), 2.27-2.65 (m, 1H), 2.58-2.52 (m, 1H), 2.20 (s, 3H).
Example 7: N-(2-(Oxazol-2-yl)phenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide1,1-dioxide (7)
[0693] ##STR00085##
a) 2-(2-(Oxazol-2-yl)phenyl)acetonitrile (A7)
[0694] To a solution of oxazole (1.0 g, 10.2 mmol) in THF (30 mL) at −78° C. was added n-BuLi (2.5 M in hexanes, 6.8 mL, 17.0 mmol) dropwise and the mixture was stirred at −78° C. for 10 min. ZnCl.sub.2 (4.17 g, 30.6 mmol) was added and the mixture was allowed to warm to r.t. Pd(PPh.sub.3).sub.4 (577 mg, 0.5 mmol) and 2-(2-bromophenyl)acetonitrile (2.0 g, 14.3 mmol) were added and the mixture was heated at 60° C. overnight. The reaction was quenched by addition of saturated aqueous ammonium chloride solution (40 mL) and then most of the THF was removed under reduced pressure. The aqueous mixture was extracted with EtOAc (50 mL×3) and the combined extracts were dried over anhydrous sodium sulfate and concentrated. The residue was purified by column chromatography (EtOAc/Pet. ether=1:10) to afford the desired product (120 mg, 7% yield) as yellow oil. LCMS (ES-API): R.sub.t 2.20 min; m/z 185.1 [M+H].sup.+.
b) 2-(2-(Oxazol-2-yl)phenyl)ethanamine (A8)
[0695] To a solution of 2-(2-(oxazol-2-yl)phenyl)acetonitrile (A7) (120 mg, 0.65 mmol) in ethanol (3 mL) was added conc. NH.sub.4OH (1 mL) and Raney Nickel (40 mg, 0.68 mmol) and the mixture was heated at 60° C. under a hydrogen (1 atm) overnight. More ethanol (5 mL) was added and the mixture was filtered. The filtrate was concentrated to afford the desired product (110 mg, 80% yield) as a white solid. LCMS (ES-API): R.sub.t 2.25 min; m/z 189.1 [M+H].sup.+.
c) N-(2-(Oxazol-2-yl)phenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide1,1-dioxide (7)
[0696] To a solution of 2-(2-(oxazol-2-yl)phenyl)ethanamine (A8) (110 mg, 0.58 mmol) in ethanol (3 mL) was added ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (150 mg, 0.58 mmol) and the mixture was heated at 120° C. for 2 h. The mixture was adjusted to ˜pH 3 with 1 M HCl, diluted with water (10 mL) and extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine, dried over anhydrous sodium sulfate, concentrated and the residue was purified by preparative TLC (DCM/EtOAc=15:1) to give the desired product (40 mg, 18% yield) as a white solid. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.6 (s, 1H), 9.38 (t, J=5.8 Hz, 1H), 8.22 (s, 1H), 7.91-7.89 (m, 1H), 7.86-7.84 (m, 1H), 7.81-7.79 (m, 1H), 7.75-7.70 (m, 1H), 7.55-7.50 (m, 1H), 7.46-7.37 (m, 4H), 3.61-3.56 (m, 2H), 3.38-3.37 (m, 2H). LCMS (ES-API): R.sub.t 2.49 min; m/z 397.0 [M+H].sup.+
Example 8: 7-Hydroxy-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (8)
[0697] ##STR00086##
a) (N-(2-(Oxazol-2-yl)-2-phenylethyl)-7-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (A9)
[0698] To a solution of 7-bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1) (400 mg, 0.84 mmol) and bis(pinacolato)diboron (427 mg, 1.68 mmol) in dioxane (20 mL) was added Pd(dppf).sub.2Cl.sub.2 (69 mg, 0.084 mmol) and KOAc (248 mg, 2.52 mmol) and the mixture was heated at 90° C. under N.sub.2 for 3 h. After cooling to r.t., the mixture was adjusted to pH 5 with 1 M HCl and filtered. The filter cake was washed with dioxane (5 mL) and the filtrate was washed with brine, dried over sodium sulfate and concentrated. The residue which was purified by preparative TLC (MeOH/DCM=1:20) to give the product (80 mg, 18% yield) as a white solid. LCMS (ES-API): R.sub.t 2.36 min; m/z 441 [M+H].sup.+ (boronic acid).
b) 7-Hydroxy-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (8)
[0699] To a solution of N-(2-(oxazol-2-yl)-2-phenylethyl)-7-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (A9) (82 mg, 0.16 mmol) in THF (3 mL) and water (0.5 mL) was added NaOH (19 mg, 0.48 mmol) and H.sub.2O.sub.2 (27 mg, 0.79 mmol) and the mixture was stirred at r.t. for 3 h. The mixture was extracted with DCM (3×10 mL) and the combined organic extracts were washed with brine, dried over sodium sulfate and concentrated to give a residue which was purified by prep. TLC (MeOH/DCM=1:20) to give the product (20 mg, 30% yield) as an off-white solid. LCMS (ES-API): R.sub.t 2.28 min; m/z 413.1 [M+H].sup.+. .sup.1H NMR (400 MHz, MeOD) δ 7.85 (s, 1H), 7.46 (d, J=8.8 Hz, 1H), 7.34-7.24 (m, 5H), 7.18-7.11 (m, 3H), 4.61 (t, J=8.0 Hz, 1H), 4.09-3.93 (m, 2H).
Example 9: 7-(1-(2-(Methylamino)-2-oxoethyl)-1H-pyrazol-4-yl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (9)
[0700] ##STR00087##
a) N-Methyl-2-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazol-1-yl)acetamide (A10)
[0701] To a solution of 4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (200 mg, 1.03 mmol) in DMF (10 mL) was added 2-bromo-N-methylacetamide (172 mg, 1.13 mmol) and cesium carbonate (670 mg, 2.06 mmol) and the mixture was heated at 60° C. overnight. The mixture was filtered and the solid was washed with EtOAc. The filtrates were combined and the solvent was removed to give the desired product (160 mg, 59% yield) as a white solid. LCMS (ES-API): R.sub.t 1.89 min; m/z 266.1 [M+H].sup.+.
b) 7-(1-(2-(Methylamino)-2-oxoethyl)-1H-pyrazol-4-yl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (9)
[0702] To a solution of N-methyl-2-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazol-1-yl)acetamide (A10) (70 mg, 0.25 mmol) and 7-bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1) (100 mg, 0.21 mmol) in i-PrOH (3 mL) and toluene (1 mL) was added sodium carbonate (2 M in water, 0.32 mL, 0.63 mmol) and Pd(PPh.sub.3).sub.4 (12 mg, 0.01 mmol) and the mixture was heated at 90° C. under a nitrogen atmosphere overnight. The solvent was removed and the residue was diluted with water and extracted with EtOAc. The organic extract was dried over sodium sulfate, concentrated and the residue was purified by preparative TLC (DCM/MeOH=15:1) to give the desired product (100 mg, 89% yield) as a yellow solid. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.6 (s, 1H), 9.22-9.19 (m, 1H), 8.33 (s, 1H), 8.06-7.93 (m, 5H), 7.78-7.76 (m, 1H), 7.35-7.25 (m, 5H), 7.20 (s, 1H), 4.79 (s, 2H), 4.67 (m, 1H), 4.05-3.97 (m, 1H), 3.92-3.85 (m, 1H), 2.63 (d, J=4.5 Hz, 3H). LCMS (ES-API): R.sub.t 2.37 min, m/z 534.2 [M+H].sup.+
Example 10: 7-(1-(2-Hydroxyethyl)-1H-pyrazol-4-yl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (10)
[0703] ##STR00088##
a) 2-(4-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazol-1-yl)ethanol (A11)
[0704] To a solution of 4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (500 mg, 2.58 mmol) in DMF (7 mL) was added 2-bromoethanol (645 mg, 5.16 mmol) and cesium carbonate (2.52 g, 7.74 mmol) and the mixture was heated at 85° C. for 3 h. More cesium carbonate (2.52 g, 7.74 mmol) and 2-bromoethanol (645 mg, 5.16 mmol) were added and the mixture was again heated at 85° C. overnight. The solvent was removed and the residue was diluted with water and extracted with EtOAc. The organic layer was washed with water and brine, dried over anhydrous sodium sulfate, filtered and the solvent was evaporated to give the desired product (150 mg, 24% yield) as a yellow oil. LCMS (ES-API): R.sub.t 2.0 min; m/z 239.1 [M+H].sup.+.
b) 7-(1-(2-Hydroxyethyl)-1H-pyrazol-4-yl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (10)
[0705] To a solution of 2-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazol-1-yl)ethanol (A11) (70 mg, 0.29 mmol) and 7-bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1) (93 mg, 0.2 mmol) in dioxane (3 mL) was added K.sub.2CO.sub.3 (82 mg, 0.59 mmol) and Pd(dppf)Cl.sub.2 (17 mg, 0.02 mmol) and the mixture heated at 130° C. in a sealed tube for 5 h. Water (20 mL) was added and the mixture was extracted with EtOAc (20 mL×2). The combined organic extracts were dried over sodium sulfate, filtered and concentrated and the residue was purified by prep. TLC (DCM/MeOH=15:1) to give the desired product (10 mg, 10% yield) as a white solid. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.6 (s, 1H), 9.19 (s, 1H), 8.33 (s, 1H), 8.03 (m, 2H), 7.99-7.90 (m, 2H), 7.74-7.72 (m, 1H), 7.36-7.32 (m, 2H), 7.29-7.27 (m, 3H), 7.21 (s, 1H), 4.93 (t, J=5.2 Hz, 1H), 4.67 (m, 1H), 4.15 (t, J=5.4 Hz, 2H), 4.05-3.97 (m, 1H), 3.94-3.86 (m, 1H), 3.79-3.75 (m, 2H). LCMS (ES-API): R.sub.t 2.48 min, m/z 507.1 [M+H]+
Example 11: 7-Amino-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (11)
[0706] ##STR00089##
[0707] To a solution of 7-bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1) (80 mg, 0.17 mmol) and diphenylmethanimine (91.5 mg, 0.51 mmol) in dioxane (5 mL) was added Pd.sub.2(dba).sub.3 (15.4 mg, 0.02 mmol), Xantphos (19.5 mg, 0.03 mmol) and Cs.sub.2CO.sub.3 (164.5 mg, 0.5 mmol) and the mixture was heated at 90° C. under N.sub.2 for 3 h. The mixture was filtered and the solid was washed with dioxane (5 mL). The filtrate was washed with brine, dried over sodium sulfate and concentrated. The residue was dissolved in dioxane (2 mL) and 1 M HCl (2 mL) was added. The mixture was stirred at r.t. for 1 h then extracted with DCM (3×10 mL). The combined organic extracts were washed with brine, dried over sodium sulfate and concentrated. The residue was purified by preparative TLC (MeOH/DCM=1:20) to give the product (10 mg, 10% yield) as a white solid. LCMS (ES-API): R.sub.t 2.17 min; m/z 412.1 [M+H].sup.+. .sup.1H NMR (400 MHz, MeOD) δ 7.87 (s, 1H), 7.26-7.30 (m, 6H), 7.19 (s, 1H), 7.06 (d, J=2.4 Hz, 1H), 7.02-6.99 (m, 1H), 4.63 (t, J=7.2 Hz, 1H), 4.20-3.80 (m, 2H).
Example 12: Methyl 2-(2-(7-iodo-1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)ethyl)benzoate (12)
[0708] ##STR00090##
[0709] To a solution of 2-(2-(7-iodo-1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)ethyl)benzoic acid (155) (20 mg, 0.06 mmol) in MeOH (5 mL) was added H.sub.2SO.sub.4 (1 drop) and the mixture was heated at 60° C. for 3 h. After cooling to r.t., the mixture was diluted with water (5 mL) and extracted with EtOAc (8 mL×3). The combined organic extracts were dried over Na.sub.2SO.sub.4 and concentrated to give the product (20 mg, 40% yield) as a white solid. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.7 (brs, 1H), 9.22 (t, J=5.3 Hz, 1H), 8.09-8.02 (m, 2H), 7.78 (dd, J=8.0, 1.2 Hz, 1H), 7.57 (d, J=8.7 Hz, 1H), 7.54-7.48 (m, 1H), 7.37-7.31 (m, 2H), 3.84 (s, 3H), 3.55-3.49 (m, 2H), 3.16 (t, J=7.0 Hz, 2H). LCMS (ES-API): R.sub.t 2.84 min, m/z 513.7 [M+H].sup.+
Example 13: 7-Iodo-N-(2-(oxazol-2-yl)phenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (13)
[0710] ##STR00091##
[0711] To a solution of 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylic acid 1,1-dioxide (I53) (26 mg, 0.14 mmol) and 2-amino-5-bromobenzenesulfonamide (A8) (50 mg, 0.14 mmol) in DCM (10 mL) was added EDCI (55 mg. 0.28 mmol), HOBt (2 mg, 0.01 mmol) and DIPEA (72 mg, 0.56 mmol) and the mixture was stirred at r.t. overnight. A saturated aqueous NaHCO.sub.3 solution (30 mL) was added and the mixture was extracted with DCM (30 mL×3). The combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4 and concentrated. The residue was purified by prep. TLC (DCM/MeOH=20:1) to give the product (3 mg, 4% yield) as a yellow solid. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.7 (s, 1H), 9.36 (brs, 1H), 8.22 (s, 1H), 8.08 (s, 1H), 8.05 (d, J=8.8 Hz, 1H), 7.90 (d, J=8.8 Hz, 1H), 7.58 (d, J=8.4 Hz, 1H), 7.46-7.38 (m, 4H), 3.60-3.55 (m, 2H), 3.51-3.48 (m, 2H). LCMS (ES-API): R.sub.t 2.8 min m/z 523.0 [M+H].sup.+.
Example 14: 7-Iodo-N-(2-(methoxymethyl)phenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (14)
[0712] ##STR00092##
[0713] To a solution of N-(2-(hydroxymethyl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (109) (60 mg, 0.12 mmol) in ACN (5 mL) was added Ag.sub.2O (150 mg, 0.6 mmol) and CH.sub.31 (180 mg, 1.2 mmol) and the mixture was heated at 50° C. under N.sub.2 overnight. The solids were removed by filtration and the filtrate was concentrated under reduced pressure. The residue was purified by prep. TLC (CH.sub.2Cl.sub.2/MeOH=20:1) to give the product (10 mg, 16% yield) as a white solid. .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.7 (brs, 1H), 9.33 (m, 1H), 8.10-8.05 (m, 2H), 7.61 (d, J=8.7 Hz, 1H), 7.32 (d, J=7.3 Hz, 1H), 7.26-7.20 (m, 3H), 4.48 (s, 2H), 3.47-3.44 (m, 2H), 3.32 (s, 3H), 2.88 (t, J=7.6 Hz, 2H). LCMS (ES-API): R.sub.t 2.75 min; m/z 522.0 [M+H].sup.+.
Example 15: 7-Bromo-N-(2,2-diphenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (15)
[0714] ##STR00093##
a) Ethyl 2-((4-bromo-2-sulfamoylphenyl)amino)-2-oxoacetate (A12)
[0715] A solution of 2-amino-5-bromobenzenesulfonamide (1.00 g, 3.98 mmol) in anhydrous THF (50 mL) under an atmosphere of nitrogen was cooled in an ice-salt bath. Triethylamine (0.58 mL, 4.2 mmol) was added, followed by the dropwise addition of ethyl chlorooxoacetate (0.47 mL, 4.2 mmol). The mixture was returned to room temperature and stirred for 48 h. The precipitate was removed by filtration and the filtrate was concentrated in vacuo to give the product as a white solid (1.75 g, >100% yield). The crude material was used in the next step without further purification: LCMS-A r.t. 5.95 min; m/z 349.0 [M−H].sup.−.
b) Ethyl 7-bromo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I5—Alternate Synthesis)
[0716] Sodium hydride (60% dispersion in mineral oil, 0.191 g, 4.78 mmol) was added to anhydrous EtOH (20 mL) under a nitrogen atmosphere and the mixture was stirred for 10 min. A slurry of ethyl 2-((4-bromo-2-sulfamoylphenyl)amino)-2-oxoacetate (A12) (1.399 g, 3.984 mmol) in anhydrous EtOH (20 mL) was then added and the mixture was stirred for 3 h at room temperature. Water (˜50 mL) was added and the pH was adjusted to ˜3 with aq. HCl (2 M). The mixture was concentrated in vacuo and the precipitate was isolated by filtration. The solid was washed with water and air dried to give the product as a white solid (0.651 g, 49% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.88 (s, 1H), 8.06-8.02 (m, 1H), 7.97-7.92 (m, 1H), 7.75-7.70 (m, 1H), 4.44-4.36 (m, 2H), 1.38-1.33 (m, 3H); LCMS-A r.t. 5.83 min; m/z 331/333 [M−H].sup.−.
c) 7-Bromo-N-(2,2-diphenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (15)
[0717] Ethyl 7-bromo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (15) (500 mg, 1.50 mmol), 2,2-diphenylethan-1-amine (355 mg, 1.80 mmol) and absolute ethanol (5 mL) were heated in the microwave (100° C./30 min). The mixture was cooled to room temperature, filtered, the collected solids washed with ethanol and air dried to give the product as a white solid (582 mg, 80% yield). LCMS-B rt: 3.52 min; m/z (negative ion) 483.7 [M−H]. .sup.1H NMR (400 MHz, DMSO-d6) δ 9.24 (t, J=5.9 Hz, 1H), 7.98 (d, J=2.2 Hz, 1H), 7.92 (dd, J=8.9, 2.2 Hz, 1H), 7.74 (d, J=8.9 Hz, 1H), 7.35-7.25 (m, 8H), 7.24-7.14 (m, 2H), 4.48 (t, J=7.9 Hz, 1H), 3.92 (dd, J=7.9, 5.9 Hz, 2H).
Example 16: N-(2,2-Diphenylethyl)-7-methyl-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (16)
[0718] ##STR00094##
[0719] A mixture of 7-bromo-N-(2,2-diphenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (15) (0.050 g, 0.103 mmol), methylboronic acid (0.012 g, 0.21 mmol) and K.sub.2CO.sub.3 (0.057 g, 0.41 mmol) in dioxane (2 mL) and H.sub.2O (0.5 mL) was bubbled with a stream of nitrogen for 10 min. Pd(dppf)Cl.sub.2.DCM (0.008 g, 0.01 mmol) was then added and the mixture was stirred in the microwave at 100° C. for 30 min. Additional methylboronic acid (0.012 g, 0.21 mmol) and Pd(dppf)Cl.sub.2.DCM (0.008 g, 0.01 mmol) were added, the mixture was bubbled with a stream of nitrogen for 10 min and then stirred in the microwave at 100° C. for 30 min. The volatiles were removed in vacuo before H.sub.2O (5 mL) was added and the aqueous acidified with aq. HCl (2 M). The aqueous phase was extracted with DCM (3×15 mL), the organics were combined, dried (MgSO.sub.4) and the solvent removed in vacuo. The residue was purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (0.013 g, 30% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.56 (s, 1H), 9.21 (t, J=5.9, 5.9 Hz, 1H), 7.68 (d, J=8.5 Hz, 1H), 7.65-7.60 (m, 1H), 7.53 (dd, J=8.6, 1.9 Hz, 1H), 7.35-7.26 (m, 8H), 7.23-7.16 (m, 2H), 4.49 (t, J=7.9, 7.9 Hz, 1H), 3.92 (dd, J=7.9, 5.9 Hz, 2H), 2.38 (s, 3H); LCMS-A rt 6.49 min; m/z 418.1 [M−H].sup.−.
Example 17: 7-Cyclopropyl-N-(2,2-diphenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (17)
[0720] ##STR00095##
[0721] A mixture of 7-bromo-N-(2,2-diphenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (15) (0.050 g, 0.103 mmol), cyclopropyl boronic acid (0.018 g, 0.21 mmol) and K.sub.2OO.sub.3 (0.057 g, 0.41 mmol) in dioxane (2 mL) and H.sub.2O (0.5 mL) was bubbled with a stream of nitrogen for 10 min. Pd(dppf)Cl.sub.2.DCM (0.008 g, 0.01 mmol) was then added and the mixture was stirred in the microwave at 100° C. for 60 min. Additional cyclopropyl boronic acid (0.018 g, 0.21 mmol) and Pd(dppf)Cl.sub.2.DCM (0.008 g, 0.01 mmol) were added and the reaction mixture was bubbled with a stream of nitrogen for 10 min before heating in the microwave at 100° C. for 60 min. Further cyclopropyl boronic acid (0.036 g, 0.42 mmol) and Pd(dppf)Cl.sub.2.DCM (0.008 g, 0.01 mmol) were added and the reaction mixture was bubbled with a stream of nitrogen for 10 min before heating in the microwave at 110° C. for 60 min. The volatiles were removed in vacuo before H.sub.2O (5 mL) was added and the aqueous phase acidified with aq. HCl (2 M). The aqueous phase was extracted with DCM (3×15 mL), the organics combined, dried (MgSO.sub.4) and the solvent removed in vacuo. The residue was purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (0.015 g, 33% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.56 (s, 1H), 9.25-9.13 (m, 1H), 7.67 (d, J=8.7 Hz, 1H), 7.53 (d, J=2.0 Hz, 1H), 7.38 (dd, J=8.7, 2.1 Hz, 1H), 7.33-7.27 (m, 8H), 7.22-7.16 (m, 2H), 4.48 (t, J=7.9, 7.9 Hz, 1H), 3.92 (dd, J=7.9, 5.9 Hz, 2H), 2.14-2.03 (m, 1H), 1.08-0.94 (m, 2H), 0.79-0.68 (m, 2H); LCMS-B rt 3.45 min; m/z 446.1 [M+H].sup.+.
Example 18: N-(2,2-diphenylethyl)-7-(1-methyl-1H-pyrazol-4-yl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (18)
[0722] ##STR00096##
[0723] A mixture of 7-bromo-N-(2,2-diphenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (15) (0.050 g, 0.10 mmol), 1-methylpyrazole-4-boronic acid, pinacol ester (0.043 g, 0.21 mmol) and K.sub.2CO.sub.3 (0.057 g, 0.41 mmol) in dioxane (2 mL) and H.sub.2O (0.5 mL) was bubbled with a stream of nitrogen for 10 min. Pd(dppf)Cl.sub.2.DCM (0.008 g, 0.01 mmol) was then added and the mixture was stirred in the microwave at 100° C. for 60 min. The volatiles were removed in vacuo before H.sub.2O (5 mL) was added and the aqueous phase acidified with aq. HCl (2 M). The aqueous layer was extracted with DCM (3×15 mL), the organics combined, dried (MgSO.sub.4) and the solvent removed in vacuo. The residue was purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (0.019 g, 38% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.61 (s, 1H), 9.20 (t, J=6.0, 6.0 Hz, 1H), 8.32 (s, 1H), 8.00 (s, 1H), 7.95 (d, J=2.0 Hz, 1H), 7.92 (dd, J=8.6, 2.1 Hz, 1H), 7.76 (d, J=8.7 Hz, 1H), 7.34-7.27 (m, 8H), 7.22-7.17 (m, 2H), 4.49 (t, J=7.9, 7.9 Hz, 1H), 3.93 (dd, J=7.9, 5.9 Hz, 2H), 3.86 (s, 3H); LCMS-B rt 3.34 min; m/z 484.1 [M−H].sup.−.
Example 19: N-(2,2-diphenylethyl)-7-methoxy-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (19)
[0724] ##STR00097##
[0725] A mixture of 7-bromo-N-(2,2-diphenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (15) (0.050 g, 0.10 mmol), Cs.sub.2CO.sub.3 (0.135 g, 0.413 mmol), 1,10-phenanthroline (0.007 g, 0.04 mmol) and CuI (0.008 g, 0.04 mmol) in MeOH (2 mL) was stirred under an atmosphere of nitrogen at 110° C. overnight. The reaction mixture was cooled to room temperature before sodium hydride (60% dispersion in mineral oil, 0.017 g, 0.41 mmol) was added. The mixture was heated at 110° C. overnight under an atmosphere of nitrogen. The reaction mixture was returned to room temperature and additional sodium hydride (60% dispersion in mineral oil, 0.017 g, 0.41 mmol) and CuI (0.008 g, 0.04 mmol) were added. The mixture was heated at 120° C. under an atmosphere of nitrogen for 72 h. The mixture was cooled to room temperature, water (10 mL) and aq. HCl (2 M, 10 mL) were added and the aqueous was extracted with DCM (3×15 mL). The organics were combined, dried (MgSO.sub.4), the solvent removed in vacuo and the solid purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (0.009 g, 20% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.59 (s, 1H), 9.20 (t, J=6.0 Hz, 1H), 7.76 (d, J=9.3 Hz, 1H), 7.37-7.28 (m, 9H), 7.25-7.17 (m, 3H), 4.49 (t, J=7.9 Hz, 1H), 3.96-3.89 (m, 2H), 3.84 (s, 3H); LCMS-B rt 3.35 min; m/z 436.1 [M+H].sup.+.
Example 20: Methyl 3-(2,2-diphenylethyl)carbamoyl)-2H-benzo[e][1,2,4]thiadiazine-7-carboxylate 1,1-dioxide (20)
[0726] ##STR00098##
[0727] A mixture of 7-bromo-N-(2,2-diphenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (15) (0.120 g, 0.248 mmol), PdCl.sub.2(dppf).DCM (0.020 g, 0.025 mmol), triethylamine (0.14 mL, 0.99 mmol) and MeOH (3 mL) was loaded into a Schlenk tube under an atmosphere of nitrogen. The tube was flushed with carbon monoxide and the mixture was stirred overnight at 110° C. Additional PdCl.sub.2(dppf).DCM (0.020 g, 0.025 mmol) and triethylamine (1.0 mL, 7.2 mmol) were added and the mixture was stirred at 120° C. for 24 h under an atmosphere of carbon monoxide. The mixture was cooled to room temperature and the volatiles were removed in vacuo. Water (10 mL) and aq. HCl (2 M, 10 mL) were added and the aqueous was extracted with DCM (3×20 mL). The organics were combined, dried (MgSO.sub.4) and the solvent removed in vacuo. The resultant residue was purified by column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product (˜80% purity, 0.064 g, 45% yield) as an off-white solid: .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.91 (s, 1H), 9.37-9.27 (m, 1H), 8.26 (d, J=1.9 Hz, 1H), 8.24-8.19 (m, 1H), 7.89 (d, J=8.8 Hz, 1H), 7.33-7.28 (m, 8H), 7.22-7.18 (m, 2H), 4.49 (t, J=7.9 Hz, 1H), 3.96-3.90 (m, 2H), 3.89 (s, 3H); LCMS-B rt 3.39 min; m/z 464.1 [M+H].sup.+.
Example 21: 3-(2,2-Diphenylethyl)carbamoyl)-2H-benzo[e][1,2,4]thiadiazine-7-carboxylic Acid 1,1-dioxide (21)
[0728] ##STR00099##
[0729] A mixture of methyl 3-((2,2-diphenylethyl)carbamoyl)-2H-benzo[e][1,2,4]thiadiazine-7-carboxylate 1,1-dioxide (20) (˜80% purity, 0.061 g, 0.11 mmol), LiOH.H.sub.2O (0.044 g, 1.1 mmol), THF (3.5 mL), MeOH (3.5 mL) and H.sub.2O (0.75 mL) were stirred at room temperature overnight. The mixture was concentrated in vacuo before H.sub.2O (5 mL) and aq. HCl (2 M, 5 mL) were added. The aqueous phase was extracted with EtOAc (3×20 mL), the organics were combined, washed with brine and dried (MgSO.sub.4). The solvent was removed in vacuo and the solid was purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (0.016 g, 34% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 13.49 (s, 1H), 12.88 (s, 1H), 9.36-9.24 (m, 1H), 8.27-8.23 (m, 1H), 8.20 (d, J=8.6 Hz, 1H), 7.88 (d, J=8.7 Hz, 1H), 7.35-7.27 (m, 8H), 7.23-7.16 (m, 2H), 4.49 (t, J=7.9 Hz, 1H), 3.97-3.89 (m, 2H); LCMS-B rt 3.29 min; m/z 450.1 [M+H].sup.+.
Example 22: N-(2,2-diphenylethyl)-7-(1H-pyrazol-5-yl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (22)
[0730] ##STR00100##
[0731] A mixture of 7-bromo-N-(2,2-diphenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (15) (0.040 g, 0.083 mmol), (1H-pyrazol-5-yl)boronic acid (0.018 g, 0.17 mmol), and K.sub.2CO.sub.3 (0.046 g, 0.33 mmol) in dioxane (2 mL) and H.sub.2O (0.5 mL) was bubbled with a stream of nitrogen for 5 min. PdCl.sub.2(dppf).DCM (0.007 g, 0.008 mmol) was then added and the mixture was stirred in the microwave at 100° C. for 60 min. The volatiles were removed in vacuo, H.sub.2O (5 mL) was added and the pH of the aqueous was adjusted to ˜3. The aqueous phase was extracted with DCM (3×10 mL), the organics were combined, dried (MgSO.sub.4) and concentrated in vacuo. The solid residue was purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (˜85% purity, 0.004 g, 9% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 13.08 (s, 1H), 12.68 (s, 1H), 9.24 (t, J=6.0 Hz, 1H), 8.22-8.12 (m, 2H), 7.88-7.77 (m, 2H), 7.36-7.26 (m, 8H), 7.24-7.15 (m, 2H), 6.92-6.82 (m, 1H), 4.50 (t, J=7.9 Hz, 1H), 3.93 (dd, J=7.9, 5.8 Hz, 2H); LCMS-B rt 3.31 min; m/z 472.1 [M+H].sup.+.
Example 23: Methyl 3-((2-(oxazol-2-yl)-2-phenylethyl)carbamoyl)-2H-benzo[e][1,2,4]thiadiazine-7-carboxylate 1,1-dioxide (23)
[0732] ##STR00101##
a) 7-Bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1)—Further Synthesis
[0733] A mixture of ethyl 7-bromo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I5) (90% purity, 1.96 g, 5.31 mmol), 2-(oxazol-2-yl)-2-phenylethan-1-amine (I27) (0.951 g, 5.05 mmol) and EtOH (4 mL) was heated in the microwave at 100° C. for 60 min and then 110° C. for 30 min. To encourage consumption of starting material, the mixture was stirred in the microwave at 110° C. for a further 60 min and then 120° C. for 30 min. The white precipitate was isolated by vacuum filtration, washed with EtOH and air dried to give a mixture of the desired product and starting material. The solid was taken up in THF (10 mL), MeOH (1 mL) and H.sub.2O (1 mL) and stirred with LiOH.H.sub.2O (0.300 g, 7.15 mmol) for 4 h at room temperature. The mixture was concentrated in vacuo, water (˜50 mL) and aq. HCl (2 M, −50 mL) were added and the mixture sonicated for 10 min. The white precipitate was isolated by vacuum filtration, washed with H.sub.2O and air dried to give the product as a white solid (1.38 g, 57% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.87-12.63 (s, 1H), 9.36-9.24 (t, J=5.9 Hz, 1H), 8.06-8.03 (m, 1H), 8.02-7.99 (d, J=2.2 Hz, 1H), 7.96-7.91 (dd, J=8.9, 2.2 Hz, 1H), 7.78-7.72 (d, J=8.9 Hz, 1H), 7.37-7.31 (m, 2H), 7.30-7.23 (m, 3H), 7.22-7.17 (m, 1H), 4.73-4.61 (t, J=7.6 Hz, 1H), 4.08-3.95 (m, 1H), 3.93-3.81 (m, 1H); LCMS-A rt 6.33 min; m/z 475/477 [M+H].sup.+.
b) Methyl 3-((2-(oxazol-2-yl)-2-phenylethyl)carbamoyl)-2H-benzo[e][1,2,4]thiadiazine-7-carboxylate 1,1-dioxide (23)
[0734] A mixture of 7-bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1) (0.100 g, 0.210 mmol) and Pd(dppf)Cl.sub.2.DCM (0.052 g, 0.063 mmol) in MeOH (2 mL) was bubbled with CO for 10 min. Triethylamine (2 mL) was added and the mixture was stirred at 120° C. under a balloon of CO for 16 h. Additional Pd(dppf)Cl.sub.2.DCM (0.052 g, 0.063 mmol) was added and the mixture was stirred at 120° C. under a balloon of CO for 4 h. The mixture was cooled to room temperature and concentrated in vacuo. Water (˜15 mL) was added and the aqueous phase was brought to pH ˜2 with aq. HCl (2 M). The aqueous layer was extracted with DCM (3×30 mL), the organics were combined, washed with brine, dried (MgSO.sub.4), the solvent removed in vacuo and the residue purified by column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as an orange solid (0.035 g, 37% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.92 (s, 1H), 9.36-9.29 (t, J=6.2 Hz, 1H), 8.31-8.25 (d, J=1.9 Hz, 1H), 8.25-8.19 (dd, J=8.7, 1.9 Hz, 1H), 8.07-8.02 (d, J=0.9 Hz, 1H), 7.93-7.86 (d, J=8.7 Hz, 1H), 7.37-7.31 (m, 2H), 7.30-7.25 (m, 3H), 7.22-7.18 (d, J=0.9 Hz, 1H), 4.72-4.63 (t, J=7.6 Hz, 1H), 4.05-3.97 (m, 1H), 3.92-3.85 (m, 4H); LCMS-A rt 6.26 min; m/z 455.1 [M+H].sup.+.
Example 24: 3-((2-(Oxazol-2-yl)-2-phenylethyl)carbamoyl)-2H-benzo[e][1,2,4]thiadiazine-7-carboxylic Acid 1,1-dioxide (24)
[0735] ##STR00102##
[0736] A mixture of methyl 3-((2-(oxazol-2-yl)-2-phenylethyl)carbamoyl)-2H-benzo[e][1,2,4]thiadiazine-7-carboxylate 1,1-dioxide (23) (0.060 g, 0.13 mmol), LiOH.H.sub.2O (0.028 g, 0.66 mmol), THF (3.5 mL), MeOH (3.5 mL) and H.sub.2O (0.75 mL) was stirred at room temperature for 18 h. Additional LiOH.H.sub.2O (0.028 g, 0.66 mmol) was added and the mixture was stirred at room temperature for 4 h. Another portion of LiOH.H.sub.2O (0.028 g, 0.66 mmol) was added and the mixture was stirred at 40° C. for 1.5 h. The volatiles were removed in vacuo, H.sub.2O (˜20 mL) was added and the aqueous layer was washed with DCM (2×20 mL). The aqueous phase was adjusted to pH ˜2 with aq. HCl (2 M) and then extracted with DCM (3×20 mL). The organics were combined, washed with brine, dried (Na.sub.2SO.sub.4), the solvent was removed in vacuo and the residue was purified by column chromatography (Biotage Isolera, 4 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.). The fraction containing the suspected product was purified by another round of column chromatography (Biotage Isolera, 4 g SiO.sub.2 cartridge, 0-5% MeOH in DCM) to give the product as a white solid (0.007 g, 12% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.92 (s, 1H), 9.40-9.27 (t, J=5.9 Hz, 1H), 8.30-8.24 (d, J=1.8 Hz, 1H), 8.23-8.17 (dd, J=8.9, 1.9 Hz, 1H), 8.08-8.01 (s, 1H), 7.93-7.83 (d, J=8.7 Hz, 1H), 7.37-7.31 (m, 2H), 7.30-7.23 (m, 3H), 7.24-7.15 (m, 1H), 4.75-4.59 (t, J=7.5 Hz, 1H), 4.08-3.96 (m, 1H), 3.94-3.82 (m, 1H), COOH not observed; LCMS-B RT 3.10 min; m/z 441.0 [M+H].sup.+.
Example 25: 7-(1-Methyl-1H-pyrazol-4-yl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (25)
[0737] ##STR00103##
[0738] A mixture of 7-bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1) (0.050 g, 0.11 mmol), 1-methyl-1H-pyrazole-4-boronic acid, pinacol ester (0.044 g, 0.21 mmol), Pd(dppf)Cl.sub.2.DCM (0.009 g, 0.01 mmol), H.sub.2O (0.5 mL) and dioxane (2 mL) were bubbled with a stream of nitrogen gas for 10 min. Potassium carbonate (0.058 g, 0.42 mmol) was then added and the mixture was stirred in the microwave at 100° C. for 60 min. The mixture was returned to room temperature and the volatiles were removed in vacuo. Water (˜10 mL) was added and the aqueous phase was adjusted to pH ˜2 with aq. HCl (2 M) and then extracted with DCM (2×15 mL). The organics were combined, the solvent was removed in vacuo and the residue was purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give a white solid. The solid was taken up in a minimum amount of DCM, cyclohexane was added and the suspension was sonicated for 5 min. The precipitate was isolated by filtration and air dried to give the product as a white solid (0.011 g, 22% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.62 (s, 1H), 9.36-9.15 (t, J=5.9 Hz, 1H), 8.38-8.25 (s, 1H), 8.10-7.95 (m, 3H), 7.95-7.89 (m, 1H), 7.83-7.71 (d, J=8.8 Hz, 1H), 7.37-7.31 (m, 2H), 7.31-7.24 (m, 3H), 7.23-7.18 (s, 1H), 4.75-4.60 (t, J=7.5 Hz, 1H), 4.06-3.95 (m, 1H), 3.94-3.79 (m, 4H); LCMS-B RT 3.15 min; m/z 477.1 [M+H].sup.+.
Example 26: N-(2-(Oxazol-2-yl)-2-phenylethyl)-7-(1H-pyrazol-4-yl)-2H-benzo[e][1, 2, 4]thiadiazine-3-carboxamide 1,1-dioxide (26)
[0739] ##STR00104##
[0740] A mixture of 7-bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1) (0.050 g, 0.11 mmol), pyrazole-4-boronic acid (HCl salt, 0.031 g, 0.21 mmol), Pd(dppf)Cl.sub.2.DCM (0.009 g, 0.01 mmol), H.sub.2O (0.5 mL) and dioxane (2 mL) were bubbled with a stream of nitrogen gas for 10 min. Potassium carbonate (0.058 g, 0.42 mmol) was then added and the mixture was stirred in the microwave at 100° C. for 60 min. The mixture was returned to room temperature and the volatiles were removed in vacuo. Water (˜10 mL) was added and the aqueous was adjusted to pH ˜2 with aq. HCl (2 M) and then extracted with DCM (2×15 mL). The organics were combined, the solvent was removed in vacuo and the residue was purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (0.010 g, 21% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 13.07 (s, 1H), 12.68-12.49 (s, 1H), 9.34-9.11 (m, 1H), 8.54-8.22 (s, 1H), 8.20-8.01 (m, 3H), 8.00-7.94 (dd, J=8.6, 2.1 Hz, 1H), 7.83-7.71 (d, J=8.6 Hz, 1H), 7.38-7.31 (m, 2H), 7.31-7.24 (m, 3H), 7.23-7.17 (m, 1H), 4.72-4.63 (t, J=7.5 Hz, 1H), 4.06-3.96 (m, 1H), 3.94-3.83 (m, 1H); LCMS-A RT 5.49 min; m/z 463.2 [M+H].sup.+.
Example 27: N.SUP.3.-(2-(Oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3,7-dicarboxamide 1,1-dioxide (27)
[0741] ##STR00105##
[0742] DIPEA (79 μL, 0.45 mmol) was added to a solution of 3-((2-(oxazol-2-yl)-2-phenylethyl)carbamoyl)-2H-benzo[e][1,2,4]thiadiazine-7-carboxylic acid 1,1-dioxide (24) (0.040 g, 0.091 mmol) in THF (3 mL) and DMF (0.5 mL). HOBt (0.018 g, 0.14 mmol) and EDCI.HCl (0.026 g, 0.14 mmol) were then added followed by (NH.sub.4).sub.2CO.sub.3 (0.044 g, 0.45 mmol). The mixture was stirred for 48 h at room temperature before being concentrated in vacuo. Water (˜15 mL) was added and the aqueous was brought to ˜pH 2. The precipitate was isolated by filtration and air dried to give a brown solid. The solid was adsorbed onto silica and purified by column chromatography (Biotage Isolera, 4 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (0.003 g, 8% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.79 (s, 1H), 9.37-9.21 (m, 1H), 8.37 (d, J=2.0 Hz, 1H), 8.25 (s, 1H), 8.17 (dd, J=8.7, 2.0 Hz, 1H), 8.05 (d, J=0.8 Hz, 1H), 7.82 (d, J=8.7 Hz, 1H), 7.60 (s, 1H), 7.38-7.31 (m, 2H), 7.30-7.24 (m, 3H), 7.21 (d, J=0.9 Hz, 1H), 4.67 (t, J=7.5 Hz, 1H), 4.06-3.96 (m, 1H), 3.93-3.83 (m, 1H); LCMS-B RT 3.09 min; m/z 440.1 [M+H].sup.+.
Example 28: N-(2-Bromophenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (28)
[0743] ##STR00106##
[0744] A mixture of ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (0.050 g, 0.20 mmol) and 2-(2-bromophenyl)ethan-1-amine (40 μL, 0.28 mmol) in EtOH (0.2 mL) was heated in the microwave at 120° C. for 60 min. The mixture was returned to room temperature and the white precipitate was isolated by filtration, washed with EtOH and air dried to give the product as a white solid (0.057 g, 71% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.62 (s, 1H), 9.47-9.25 (t, J=6.0 Hz, 1H), 7.88-7.83 (dd, J=8.0, 1.4 Hz, 1H), 7.83-7.78 (m, 1H), 7.76-7.70 (m, 1H), 7.62-7.57 (m, 1H), 7.56-7.49 (m, 1H), 7.36-7.29 (m, 2H), 7.21-7.13 (m, 1H), 3.59-3.48 (m, 2H), 3.06-2.93 (t, J=7.2 Hz, 2H); LCMS-B RT 3.28 min; m/z 408/410 [M+H].sup.+.
Example 29: N-(2-Hydroxyphenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (29)
[0745] ##STR00107##
[0746] A mixture of ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (0.050 g, 0.20 mmol) and 2-(2-aminoethyl)phenol (0.038 g, 0.28 mmol) in EtOH (0.2 mL) was heated in the microwave at 120° C. for 60 min. The mixture was returned to room temperature and the white precipitate was isolated by filtration, washed with EtOH and air dried to give the product as a white solid (0.031 g, 46% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.62 (s, 1H), 9.38 (s, 1H), 9.21 (t, J=5.9 Hz, 1H), 7.86 (dd, J=8.0, 1.4 Hz, 1H), 7.81 (dd, J=8.4, 1.2 Hz, 1H), 7.77-7.69 (m, 1H), 7.56-7.48 (m, 1H), 7.10-6.97 (m, 2H), 6.79 (dd, J=8.1, 1.2 Hz, 1H), 6.71 (td, J=7.4, 1.2 Hz, 1H), 3.54-3.44 (m, 2H), 2.82 (t, J=7.3 Hz, 2H); LCMS-A RT 6.07 min; m/z 344.1 [M−H].sup.−.
Example 30: 2-(2-(1,1-Dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)ethyl)benzoic Acid (30)
[0747] ##STR00108##
[0748] A solution of N-(2-bromophenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (28) (0.200 g, 0.490 mmol) in anhydrous THF (2 mL) was cooled to −78° C. under an atmosphere of nitrogen. A solution of n-butyllithium (1.6 M in hexanes, 0.64 mL, 1.0 mmol) was cautiously added and the mixture was stirred for 10 min at −78° C. The mixture was then poured onto dry ice and returned to room temperature with stirring. Water was added (˜10 mL) and the mixture was concentrated in vacuo. The aqueous was adjusted to pH ˜2 with aq. HCl (2 M) and then extracted with DCM (2×15 mL). The organics were combined, washed with brine, dried (Na.sub.2SO.sub.4) and the solvent removed in vacuo. The white solid was purified by column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C. then 0-25% MeOH in EtOAc) to give the product as a white solid (0.019 g, 10% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.24 (t, J=5.8 Hz, 1H), 7.87-7.81 (m, 2H), 7.78 (d, J=8.4 Hz, 1H), 7.74-7.68 (m, 1H), 7.55-7.43 (m, 2H), 7.35-7.28 (m, 2H), 3.56 (q, J=6.6 Hz, 2H), 3.22 (t, J=7.0 Hz, 2H), CO.sub.2H and SO.sub.2NH not observed; LCMS-B RT 3.09 min; m/z 372.0 [M−H].sup.−.
Example 31: N-(2-Iodophenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (31)
[0749] ##STR00109##
a) 2-(2-Iodophenyl)ethan-1-amine (A16)
[0750] A solution of 2-(2-iodophenyl)acetonitrile (1.00 g, 4.11 mmol) in anhydrous THF (5 mL) under an atmosphere of nitrogen was treated with borane tetrahydrofuran complex solution (1.0 M in THF, 12.3 mL, 12.3 mmol). The mixture was stirred at reflux for 16 h, cooled to room temperature and excess borane reagent was quenched by the dropwise addition of water (until evolution of hydrogen ceased). MeOH (2.5 mL) and conc. H.sub.2SO.sub.4 (0.5 mL) was added and the mixture was stirred for 1 h at r.t. The mixture was concentrated in vacuo, water (˜10 mL) was added and the aqueous was adjusted to pH ˜12 with aq. NaOH (2 M). The aqueous layer was extracted with EtOAc (3×30 mL), the organics were combined, washed with brine, dried (Na.sub.2SO.sub.4) and the solvent removed in vacuo to give a colourless oil. Water (˜20 mL) was added and the aqueous phase was adjusted to pH ˜2 with aq. HCl (2 M). The aqueous layer was washed with DCM (3×30 mL) and then adjusted to pH ˜12 with aq. NaOH (2 M). The aqueous layer was extracted with DCM (3×50 mL), the organics were combined, washed with brine, dried (Na.sub.2SO.sub.4) and the solvent removed in vacuo to give the product as a colourless oil (0.869 g, 85% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.81 (dd, J=7.8, 1.2 Hz, 1H), 7.35-7.27 (m, 2H), 6.97-6.91 (m, 1H), 2.75-2.71 (m, 4H) exchangeable NH not observed; LCMS-B RT 2.77 min; m/z 248.0 [M+H].sup.+.
b) N-(2-Iodophenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (31)
[0751] A mixture of ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (0.250 g, 0.983 mmol) and A16 (0.340 g, 1.38 mmol) in EtOH (1 mL) was heated in the microwave at 120° C. for 60 min. The mixture was returned to room temperature and the white precipitate was isolated by filtration, washed with EtOH and air dried to give the title compound as a white solid (0.370 g, 83% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.62 (s, 1H), 9.36 (t, J=5.8 Hz, 1H), 7.88-7.82 (m, 2H), 7.80 (dd, J=8.4, 1.2 Hz, 1H), 7.76-7.70 (m, 1H), 7.56-7.49 (m, 1H), 7.37-7.28 (m, 2H), 7.01-6.94 (m, 1H), 3.55-3.46 (m, 2H), 2.98 (t, J=7.3 Hz, 2H); LCMS-B RT 3.32 min; m/z 455.9 [M+H].sup.+.
Example 32: N.SUP.7.-Methyl-N.SUP.3.-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3,7-dicarboxamide 1,1-dioxide (32)
[0752] ##STR00110##
[0753] A mixture of 7-bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1) (0.050 g, 0.11 mmol), methylamine hydrochloride (0.036 g, 0.53 mmol), Pd(OAc).sub.2 (0.002 g, 0.009 mmol) and xantphos (0.004 g, 0.007 mmol) in 1,4-dioxane (3 mL) and triethylamine (0.15 mL, 1.1 mmol) was bubbled with CO.sub.(g) for 10 min. The mixture was then refluxed under a balloon of CO for 16 h. Additional portions of methylamine hydrochloride (0.036 g, 0.53 mmol), Pd(OAc).sub.2 (0.002 g, 0.009 mmol), xantphos (0.004 g, 0.007 mmol) and triethylamine (0.15 mL, 1.1 mmol) were added and the mixture was stirred at reflux for a further 24 h under a balloon of CO. The mixture was returned to room temperature and then concentrated in vacuo. Water (˜10 mL) was added to the residue and the pH was adjusted to ˜2 with aq. HCl (2 M). The aqueous was extracted with EtOAc (3×15 mL), the organics were combined, washed with brine and dried (Na.sub.2SO.sub.4). The solvent was removed in vacuo and the residue was purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (0.014 g, 29% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.79 (s, 1H), 9.37-9.19 (m, 1H), 8.78-8.67 (m, 1H), 8.32 (d, J=2.0 Hz, 1H), 8.13 (dd, J=8.7, 2.0 Hz, 1H), 8.05 (d, J=0.9 Hz, 1H), 7.83 (d, J=8.7 Hz, 1H), 7.37-7.31 (m, 2H), 7.30-7.24 (m, 3H), 7.21 (d, J=1.0 Hz, 1H), 4.67 (t, J=7.5 Hz, 1H), 4.07-3.96 (m, 1H), 3.93-3.83 (m, 1H), 2.80 (d, J=4.5 Hz, 3H); LCMS-B RT 3.10 min; m/z 454.1 [M+H].sup.+.
Example 33: N.SUP.7.,N.SUP.7.-Dimethyl-N.SUP.3.-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3,7-dicarboxamide 1,1-dioxide (33)
[0754] ##STR00111##
[0755] A mixture of 7-bromo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (1) (0.050 g, 0.11 mmol), dimethylamine hydrochloride (0.043 g, 0.53 mmol), Pd(OAc).sub.2 (0.002 g, 0.01 mmol) and xantphos (0.006 g, 0.01 mmol) in 1,4-dioxane (3 mL) and triethylamine (0.20 mL, 1.4 mmol) was bubbled with CO.sub.(g) for 10 min. The mixture was then refluxed under a balloon of CO for 16 h. Additional portions of dimethylamine hydrochloride (0.043 g, 0.53 mmol), Pd(OAc).sub.2 (0.002 g, 0.01 mmol), xantphos (0.006 g, 0.01 mmol) and triethylamine (0.20 mL, 1.4 mmol) were added and the mixture was stirred at reflux for a further 6 h under a balloon of CO. The mixture was returned to room temperature and stirred for 72 h. The mixture was concentrated in vacuo, water (˜10 mL) was added and the pH was adjusted to ˜2 with aq. HCl (2 M). The aqueous layer was extracted with EtOAc (3×15 mL), the organics were combined, washed with brine and dried (Na.sub.2SO.sub.4). The solvent was removed in vacuo and the residue was purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (0.013 g, 26% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.77 (s, 1H), 9.44-9.09 (m, 1H), 8.05 (d, J=0.9 Hz, 1H), 7.86-7.72 (m, 3H), 7.37-7.31 (m, 2H), 7.30-7.25 (m, 3H), 7.20 (d, J=0.9 Hz, 1H), 4.67 (t, J=7.5 Hz, 1H), 4.05-3.96 (m, 1H), 3.93-3.83 (m, 1H), 2.95 (d, J=25.7 Hz, 6H); LCMS-B RT 3.09 min; m/z 468.2 [M+H].sup.+.
Example 34: N-(2-(Pyridin-3-yl)phenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide
[0756] 1,1-dioxide (34)
##STR00112##
[0757] a) tert-Butyl (2-iodophenethyl)carbamate (A17)
[0758] A mixture of 2-(2-iodophenyl)ethan-1-amine (A16) (0.432 g, 1.75 mmol), di-tert-butyl dicarbonate (0.458 g, 2.10 mmol), TEA (0.37 mL, 2.6 mmol) and DMAP (0.021 g, 0.18 mmol) in THF (5 mL) was stirred at room temperature for 16 h. Water (˜10 mL) was added and the mixture concentrated in vacuo. The aqueous phase was adjusted to pH ˜2 with aq. HCl (2 M) and then extracted with DCM (3×25 mL). The organics were combined, dried (Na.sub.2SO.sub.4) and the solvent removed in vacuo. The residue was purified by column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-50% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (0.506 g, 83% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.82 (dd, J=7.9, 1.3 Hz, 1H), 7.33 (td, J=7.4, 1.3 Hz, 1H), 7.29-7.21 (m, 1H), 7.00-6.90 (m, 2H), 3.20-3.08 (m, 2H), 2.83-2.75 (m, 2H), 1.36 (s, 9H); LCMS-B RT 3.50 min; m/z 370.0 [M+Na].sup.+, 291.9 [M−t−Bu+2H].sup.+.
b) tert-Butyl (2-(pyridin-3-yl)phenethyl)carbamate (A18)
[0759] A mixture of tert-butyl (2-iodophenethyl)carbamate (A17) (0.100 g, 0.288 mmol), pyridine-3-boronic acid (0.071 g, 0.58 mmol), K.sub.2CO.sub.3 (0.119 g, 0.864 mmol) and Pd(dppf)Cl.sub.2.DCM (0.024 g, 0.029 mmol) in 1,4-dioxane (2 mL) and H.sub.2O (0.5 mL) were stirred at reflux under an atmosphere of nitrogen for 3 h. The mixture was cooled to room temperature and then concentrated in vacuo. Water (˜10 mL) and sat. aq. NaHCO.sub.3 (˜10 mL) were added and the aqueous layer was extracted with EtOAc (3×15 mL). The organics were combined, washed with brine, dried (Na.sub.2SO.sub.4), the volatiles evaporated in vacuo and the residue purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a colourless oil (0.063 g, 73% yield): .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.61 (dd, J=4.9, 1.7 Hz, 1H), 8.57 (dd, J=2.4, 0.9 Hz, 1H), 7.64 (dt, J=7.7, 2.0 Hz, 1H), 7.41-7.27 (m, 4H), 7.21 (dt, J=7.6, 1.0 Hz, 1H), 4.40 (s, 1H), 3.33-3.08 (m, 2H), 2.77 (t, J=7.2 Hz, 2H), 1.39 (s, 9H): LCMS-B rt 3.05 min; m/z 299 [M+H].sup.+, 243 [M−t−Bu+2H].sup.+.
c) 2-(2-(Pyridin-3-yl)phenyl)ethan-1-amine (A19)
[0760] A solution of tert-butyl (2-(pyridin-3-yl)phenethyl)carbamate (A18) (0.063 g, 0.21 mmol) in DCM (5 mL) was treated with TFA (0.16 mL, 2.1 mmol) and the mixture was stirred at room temperature for 4 h. Another aliquot of TFA (0.16 mL, 2.1 mmol) was added and the mixture was stirred at room temperature for a further 1 hour. Water (˜10 mL) was added, the aqueous phase was adjusted to pH ˜12 with aq. NaOH (2 M) and then extracted with EtOAc (3×20 mL). The organics were combined, washed with brine, dried (Na.sub.2SO.sub.4) and the solvent removed in vacuo to give the product as a colourless oil (0.043 g, >95% yield): .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.58-8.52 (m, 2H), 7.64 (dt, J=7.7, 2.0 Hz, 1H), 7.39-7.27 (m, 4H), 7.20 (dd, J=7.4, 1.4 Hz, 1H), 2.87-2.73 (m, 6H); LCMS-B RT 0.50 min; m/z 199.1 [M+H].sup.+.
d) N-(2-(Pyridin-3-yl)phenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (34)
[0761] A mixture of 2-(2-(pyridin-3-yl)phenyl)ethan-1-amine (A19) (0.043 g, 0.22 mmol), ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (0.050 g, 0.20 mmol) and EtOH (1.5 mL) was stirred in a sealed vessel at 110° C. for 1 hour and then at 120° C. for 2 h. The mixture was cooled to room temperature, the volatiles were removed in vacuo and the crude product purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the product as a white solid (0.016 g, 20% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.54 (s, 1H), 9.32-9.09 (m, 1H), 8.57 (dd, J=4.8, 1.6 Hz, 1H), 8.55-8.53 (m, 1H), 7.84 (dd, J=8.0, 1.4 Hz, 1H), 7.82-7.75 (m, 2H), 7.75-7.69 (m, 1H), 7.55-7.48 (m, 1H), 7.45-7.38 (m, 3H), 7.35-7.29 (m, 1H), 7.25-7.18 (m, 1H), 3.39-3.34 (m, 2H), 2.84 (t, J=7.4 Hz, 2H); LCMS-B rt 2.95 min; m/z 407.1 [M+H].sup.+.
Example 35: N-(2-Cyanophenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (35)
[0762] ##STR00113##
[0763] A mixture of ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (0.166 g, 0.655 mmol) and 2-(2-aminoethyl)benzonitrile (0.134 g, 0.917 mmol) in EtOH (1.5 mL) was heated in the microwave at 120° C. for 60 min. The mixture was returned to room temperature and the solvent removed in vacuo. The solid was taken up in DCM:MeOH (1:1 v/v) and loaded on to a Bond Elut SCX cartridge (10 g). The cartridge was eluted with DCM:MeOH (1:1 v/v, ˜100 mL) and the filtrate was concentrated in vacuo to give the product as a white solid (0.118 g, 51% yield): .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.61 (s, 1H), 9.39 (t, J=6.0 Hz, 1H), 7.88-7.77 (m, 3H), 7.76-7.70 (m, 1H), 7.64 (td, J=7.9, 1.3 Hz, 1H), 7.53 (t, J=7.5 Hz, 1H), 7.48 (d, J=7.8 Hz, 1H), 7.43 (t, J=7.6 Hz, 1H), 3.59 (q, J=6.7 Hz, 2H), 3.10 (t, J=6.9 Hz, 2H); LCMS-A RT 4.15 min; m/z 355.2 [M+H].sup.+.
Example 36: 7-fluoro-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (36)
[0764] ##STR00114##
[0765] 2-(Oxazol-2-yl)-2-phenylethan-1-amine (I27) (0.026 g, 0.138 mmol) and ethyl 7-fluoro-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I57) (0.031 g, 80% purity, 0.092 mmol) were placed in a microwave vial. Dry EtOH (0.125 mL) was added and the reaction was subjected to microwave irradiation at 120° C. for 1 hour. The reaction was allowed to cool to room temperature and the sides of the tube were continuously scratched with a spatula for about 2 min. The precipitated solid was collected by filtration, washed with EtOH (2 mL) and dried under high-vacuum to give the product (0.020, 53% yield) as an off-white solid. .sup.1H NMR (400 MHz, d-DMSO) δ 9.28-9.17 (m, 1H), 8.04 (d, J=0.9 Hz, 1H), 7.82 (dd, J=9.8, 4.6 Hz, 2H), 7.72 (dd, J=7.6, 2.8 Hz, 1H), 7.63 (td, J=8.9, 2.9 Hz, 1H), 7.37-7.30 (m, 2H), 7.30-7.23 (m, 3H), 7.20 (d, J=0.9 Hz, 1H), 4.66 (t, J=7.5 Hz, 1H), 4.04-3.95 (m, 1H), 3.91-3.83 (m, 1H). LCMS-B: RT 3.22 min; m/z 415.0 [M+H].sup.+.
Example 37: N-(2,2-diphenylethyl)-7-(pyridin-3-yl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (37)
[0766] ##STR00115##
[0767] 7-bromo-N-(2,2-diphenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (15) (50 mg, 0.10 mmol), pyridine 3-boronic acid (19 mg, 0.16 mmol), potassium carbonate (43 mg, 0.31 mmol) and PEPPSI-IPr (4 mg, 5 mol % yield) were loaded into a microwave tube and flushed with nitrogen. Absolute ethanol (1 mL) was added, the mixture degassed with a stream of nitrogen bubbles and heated in the microwave (80° C. for 30 min). The mixture was cooled to room temperature and then added to water (30 mL). The mixture was stirred and the pH adjusted to 3-4 with 30% w/v aq NaHSO.sub.4. The precipitate was collected by centrifugation and dried azeotropically with ethanol. The mixture was slurried in 10% v/v MeOH/DCM (5 mL) and the solvent decanted. The remaining precipitate was purified by preparative TLC (100% ethyl acetate) to give the product (1 mg, 2% yield). LCMS-A: RT 5.60 min; m/z 481.1 [M−H].sup.−.
Example 38: N-(2,2-diphenylethyl)-7-ethynyl-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (38)
[0768] ##STR00116##
a) Ethyl 7-((trimethylsilyl)ethynyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (A20)
[0769] Ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I7) (190 mg, 0.50 mmol), copper(I) iodide (5 mg, 5 mol % yield), bis(triphenylphosphine)palladium(II) dichloride (18 mg, 5 mol % yield), triethylamine (filtered through neutral alumina, 2 mL) and DMF (2 mL) were degassed with a stream of nitrogen bubbles. Trimethylsilylacetylene (0.214 mL, 1.5 mmol) was added and the mixture stirred at room temperature. After three days the mixture was poured into 0.5M aq HCl (60 mL) and extracted with DCM (3×30 mL). The pooled organic extracts were washed with brine (100 ml), dried over sodium sulfate and evaporated. Chromatography (12 g silica cartridge, 0-60% ethyl acetate/hexanes) gave the product as a pale yellow solid (101 mg, 58% yield). .sup.1H NMR (400 MHz, Chloroform-d) δ 9.48 (s, 1H), 8.07 (d, J=1.7 Hz, 1H), 7.66 (dd, J=8.5, 1.8 Hz, 1H), 7.15 (d, J=8.5 Hz, 1H), 4.51 (q, J=7.2 Hz, 2H), 1.46 (t, J=7.1 Hz, 3H), 0.26 (s, 9H). LCMS-B: 3.49 min; m/z 348.8 [M−H].sup.−.
b) N-(2,2-diphenylethyl)-7-((trimethylsilyl)ethynyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (A21)
[0770] Ethyl 7-((trimethylsilyl)ethynyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (A20) (25 mg, 0.071 mmol), 2,2-diphenylethan-1-amine (18 mg, 0.091 mmol) and absolute ethanol (1 mL) were heated in the microwave (100° for 1 h). The mixture was stood at room temperature for one hour and the resulting precipitate collected by filtration, washed with cold absolute ethanol (2×1 mL) and air dried to give the product as an off-white solid (8 mg, 22% yield). .sup.1H NMR (400 MHz, DMSO-d6) δ 9.24 (s, 1H), 7.84-7.78 (m, 1H), 7.75 (s, 2H), 7.35-7.25 (m, 9H), 7.25-7.15 (m, 2H), 4.48 (t, J=7.9 Hz, 1H), 3.92 (dd, J=7.8, 6.0 Hz, 2H), 0.24 (s, 9H). LCMS-A RT 6.76 min; m/z 500.1 [M−H].sup.−.
c) N-(2,2-diphenylethyl)-7-ethynyl-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (38)
[0771] N-(2,2-Diphenylethyl)-7-((trimethylsilyl)ethynyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (A21) (7 mg, 0.012 mmol) was dissolved in 1:1 v/v MeOH:THF (1 mL) and a 1M aqueous solution of KOH (0.05 mL, 0.05 mmol) was added. After 30 min Dowex-50X8 H-form (200 mg) was added, the mixture filtered through a syringe filter and the resin washed with methanol (1 mL). The pooled filtrates were concentrated in vacuo, the residue rinsed with diethyl ether and dried in vacuo to give the product as a pale yellow solid (6 mg, quantitative yield). .sup.1H NMR (400 MHz, Acetone-d6) δ 8.60-8.53 (m, 1H), 7.90 (d, J=1.7 Hz, 1H), 7.83 (dd, J=8.6, 0.6 Hz, 1H), 7.79 (dd, J=8.6, 1.8 Hz, 1H), 7.39-7.27 (m, 8H), 7.23-7.17 (m, 2H), 4.56 (t, J=8.0 Hz, 1H), 4.15-4.07 (m, 2H), 3.88 (s, 1H), NH proton not observed. LCMS-B: RT 3.47 min; m/z 427.8 [M−H].sup.−.
Example 39: 7-bromo-N-(2-(4-fluorophenyl)-2-(pyridin-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (39)
[0772] ##STR00117##
a) 2-(4-fluorophenyl)-2-(pyridin-2-yl)acetonitrile (A22)
[0773] 2-Chloropyridine (0.095 mL, 1.0 mmol) and 2-(4-fluorophenyl)acetonitrile (0.240 mL, 2.0 mmol) were dissolved in dry toluene (1 mL) and a 1.0M solution of NaHMDS in THF (2.0 mL, 2.0 mmol) was added. The mixture was stirred at room temperature overnight, filtered through a syringe filter and loaded onto a 12 g silica column. Chromatography (0-50% ethyl acetate/hexanes) gave the product as an oil (118 mg, 56% yield). .sup.1H NMR (400 MHz, Chloroform-d) δ 8.60 (ddd, J=4.9, 1.9, 0.9 Hz, 1H), 7.72 (td, J=7.7, 1.8 Hz, 1H), 7.46-7.36 (m, 3H), 7.29-7.22 (m, overlaps with CHCl.sub.3), 7.11-7.01 (m, 2H), 5.29 (s, 1H). LCMS-A RT 4.02 min; m/z 213.1 [M+H].sup.+.
b) 2-(4-fluorophenyl)-2-(pyridin-2-yl)ethan-1-amine (A23)
[0774] 2-(4-Fluorophenyl)-2-(pyridin-2-yl)acetonitrile (A22) (115 mg, 0.54 mmol) and cobalt(II) chloride (106 mg, 0.81 mmol) were dissolved in methanol (10 mL) and cooled to 0° C. under nitrogen. Sodium borohydride (103 mg, 2.71 mmol) was added in one portion under strong nitrogen flow. The mixture was stirred at room temperature under nitrogen for 45 min. The mixture was quenched with 3M aq HCl (2 mL) and concentrated in vacuo. Water (10 mL) and ethyl acetate (10 mL) were added, the pH of the aqueous phase was adjusted to 13 with 20% w/v aq NaOH and the mixture filtered through Celite®. The separated aqueous phase was extracted with further ethyl acetate (2×10 mL), the pooled ethyl acetate phases dried over sodium sulfate and evaporated to give the product as a pale yellow syrup (26 mg, 22% yield). LCMS-A RT: 1.58 min; m/z (positive ion) 217.1 [M+H]
c) 7-bromo-N-(2-(4-fluorophenyl)-2-(pyridin-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (39)
[0775] Ethyl 7-bromo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I5) (33 mg, 0.10 mmol), 2-(4-fluorophenyl)-2-(pyridin-2-yl)ethan-1-amine (A23) (26 mg, 0.12 mmol) and ethanol (1 mL) were heated in the microwave at 100° C. for 30 min. The mixture was cooled to room temperature and filtered. The filtrate was purified by preparative TLC (60% ethyl acetate/hexanes) followed by recrystallization from acetonitrile to give the product as a white solid (10 mg, 19% yield). .sup.1H NMR (400 MHz, DMSO-d6) δ 9.23 (t, J=6.0 Hz, 1H), 8.56 (ddd, J=4.8, 1.8, 0.9 Hz, 1H), 7.99 (d, J=2.2 Hz, 1H), 7.92 (dd, J=8.9, 2.2 Hz, 1H), 7.77-7.68 (m, 2H), 7.41-7.35 (m, 2H), 7.32 (d, J=7.9 Hz, 1H), 7.25 (ddd, J=7.5, 4.8, 1.1 Hz, 1H), 7.15-7.05 (m, 2H), 4.60 (t, J=7.5 Hz, 1H), 4.08-3.91 (m, 2H). LCMS-B RT 3.33 min; m/z 502.7 [M+H].sup.+.
Example 40: N-(2-(1-methyl-1H-pyrazol-4-yl)phenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (40)
[0776] ##STR00118##
a) 2-(2-Iodophenyl)acetamide (A24)
[0777] 2-Iodophenylacetic acid (2.62 g, 10.0 mmol), DCM (50 mL), oxalyl chloride (1.03 mL, 12.0 mmol) and DMF (0.05 mL) were stirred at room temperature. After one hour the mixture was concentrated in vacuo. The residue was dissolved in THF (50 mL) and a concentrated solution of aqueous ammonia (50 mL) added. The mixture was stirred for thirty min and concentrated in vacuo. The residue was slurried in water (100 mL), filtered, the collected solid washed with water (2×50 mL) and air dried to give the product as a tan solid (2.33 g, 89% yield). .sup.1H NMR (400 MHz, Chloroform-d) δ 7.90-7.86 (m, 1H), 7.40-7.33 (m, 2H), 7.03-6.96 (m, 1H), 5.42 (brs, 2H), 3.75 (s, 2H). LCMS-A RT 4.88 min; m/z 262.0 [M+H].sup.+.
b) 2-(2-(1-Methyl-1H-pyrazol-4-yl)phenyl)acetamide (A25)
[0778] 2-(2-Iodophenyl)acetamide (A24) (261 mg, 1.00 mmol), 1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (312 mg, 1.50 mmol), cesium carbonate (977 mg, 3.00 mmol), Pd(PPh.sub.3).sub.2Cl.sub.2 (35 mg, 5 mol % yield) and 1,4-dioxane (5 mL) were loaded into a microwave tube. The mixture was degassed with a stream of nitrogen bubbles and heated in the microwave (120° C. for 5 min). The mixture was cooled to room temperature, diluted with ethyl acetate (20 mL) and filtered through celite. The filtrate was concentrated in vacuo and separated by chromatography (12 g silica cartridge, 0-100% ethyl acetate/hexanes then 0-100% methanol/ethyl acetate) gave the product as a yellow oil (12 mg, 6% yield). .sup.1H NMR (400 MHz, Methanol-d4) δ 7.75-7.72 (m, 1H), 7.58 (d, J=0.8 Hz, 1H), 7.36-7.25 (m, 4H), 3.94 (s, 3H), 3.61 (s, 2H). LCMS-A RT 4.51 min; m/z 216.2 [M+H].sup.+.
c) 2-(2-(1-Methyl-1H-pyrazol-4-yl)phenyl)ethan-1-amine bis(hydrochloride) (A26)
[0779] 2-(2-(1-Methyl-1H-pyrazol-4-yl)phenyl)acetamide (A25) (12 mg, 0.056 mmol) and 1.0M borane in THF (0.50 mL, 0.50 mmol) were heated to 80° C. overnight. A 3M aq HCl solution (1 mL) was added and the mixture returned to 80° C. for thirty min then concentrated in vacuo. The residue was loaded onto a 0.5 g SCX cartridge, washed with methanol (10 mL) and eluted with 7M ammonia in methanol (10 mL). The basic eluate was concentrated in vacuo, and the residue dissolved and concentrated twice from methanol. The residue was dissolved in 1,4-dioxane (0.5 mL) and 4.0M HCl/1,4-dioxane (0.5 mL) added. The mixture was concentrated in vacuo, the solid residue slurried in ether (2 mL), the ether decanted and the solid dried in vacuo to give the product as a white solid (18 mg). The material was carried forward without further purification. LCMS-B: RT 2.65 min; m/z 202.0 [M+H].sup.+ for the free base.
d) N-(2-(1-Methyl-1H-pyrazol-4-yl)phenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (40)
[0780] Ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I2) (12 mg, 0.047 mmol), 2-(2-(1-methyl-1H-pyrazol-4-yl)phenyl)ethan-1-amine bis(hydrochloride) (A26) (0.056 mmol at 100% conversion), triethylamine (0.016 mL, 0.11 mmol) and ethanol (1 mL) were heated in the microwave (100° C. for 1 hour then 120° C. for 30 min). The mixture was separated by preparative TLC (100% ethyl acetate) to give the product as a white solid. LCMS-B RT 3.22 min; m/z 409.9 [M+H].sup.+; m/z 407.9 [M−H].sup.−.
Examples 41-43
[0781] ##STR00119##
a) 7-iodo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (41)
[0782] Ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I7) (100 mg, 0.26 mmol), 2-(oxazol-2-yl)-2-phenylethan-1-amine (I27) (59 mg, 0.32 mmol) and ethanol (1 mL) were heated in the microwave (100° C. for 1h). The mixture was cooled to room temperature, the precipitate filtered and the collected solids washed with cold ethanol (3×1 mL) and air dried to give the product as a pink solid (67 mg). Further material (9 mg) was recovered by concentration of the combined filtrates and purification by chromatography (4 g silica cartridge, 0-5% methanol/DCM). Total product: 74 mg, 54% yield. .sup.1H NMR (400 MHz, d-DMSO) δ 12.72 (br s, 1H), 9.32-9.20 (m, 1H), 8.12-7.99 (m, 3H), 7.56 (d, J=8.8 Hz, 1H), 7.36-7.24 (m, 5H), 7.20 (d, J=0.9 Hz, 1H), 4.66 (t, J=7.5 Hz, 1H), 4.05-3.94 (m, 1H), 3.91-3.81 (m, 1H). LCMS-B: rt 3.277 min; m/z 523.0 [M+H].sup.+.
b) N-(2-(oxazol-2-yl)-2-phenylethyl)-7-((trimethylsilyl)ethynyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (A27)
[0783] 7-iodo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (41) (72 mg, 0.14 mmol) was dissolved in NEt.sub.3 (0.5 mL) and DMF (0.5 mL), CuI (1 mg, 5 mol % yield) and Pd(PPh.sub.3).sub.2Cl.sub.2 (5 mg, 5 mol % yield) were added and the mixture degassed with a stream of nitrogen bubbles. TMS-acetylene (0.057 mL, 0.41 mmol) was added and the mixture stirred overnight. The mixture was added to water (20 mL) and the pH adjusted to 5 with 3M HCl. The mixture was extracted with ethyl acetate (3×20 mL), the pooled ethyl acetate phases were washed with water (20 mL), brine (20 mL), dried over sodium sulfate and concentrated in vacuo. Chromatography (4 g silica cartridge, 0-80% ethyl acetate/hexanes) gave the product as a pale yellow solid (27 mg, 40% yield). .sup.1H NMR (400 MHz, Chloroform-d) δ 9.86 (s, 1H), 8.38 (t, J=6.5 Hz, 1H), 8.06 (d, J=1.7 Hz, 1H), 7.65-7.59 (m, 2H), 7.38-7.30 (m, 3H), 7.23-7.13 (m, 4H), 4.39 (t, J=7.0 Hz, 1H), 4.08 (t, J=6.7 Hz, 2H), 0.26 (s, 9H). LCMS-B RT 4.69 min; m/z 490.9 [M−H].sup.−.
c) 7-ethynyl-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (42)
[0784] N-(2-(oxazol-2-yl)-2-phenylethyl)-7-((trimethylsilyl)ethynyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (A27) (26 mg, 0.053 mmol) was dissolved in 1:1 v/v THF: MeOH (4 mL) and 1.0M aq KOH (0.185 mL, 0.19 mmol) was added. The mixture was stirred for 45 min then Dowex 50X8 Hi-form (0.8 g) added. The mixture was filtered and the resin washed with methanol (5 mL). The pooled filtrates were concentrated in vacuo, the residue dried azeotropically by evaporation from ethanol (2×2 mL), rinsed with ether and dried in vacuo to give the product as a tan solid (17 mg, 77% yield). .sup.1H NMR (400 MHz, DMSO-d6) δ 9.30 (t, J=5.9 Hz, 1H), 8.04 (d, J=0.9 Hz, 1H), 7.90-7.87 (m, 1H), 7.82-7.77 (m, 2H), 7.37-7.24 (m, 5H), 7.20 (d, J=0.9 Hz, 1H), 4.67 (t, J=7.6 Hz, 1H), 4.44 (s, 1H), 4.00 (ddd, J=13.2, 7.6, 5.7 Hz, 1H), 3.92-3.83 (m, 1H). LCMS-A RT 5.63 min; m/z 421.1 [M+H].sup.+.
d) 7-acetyl-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (43)
[0785] Chloro[1,3-bis(2,6-diisopropylphenyl)imidazol-2-ylidene]gold(I) (1.5 mg, 20 mol % yield), silver hexafluoroantimonate (0.8 mg, 20 mol % yield) and methanol (1 mL) were stirred at room temperature for two min. 7-ethynyl-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (42) (5.0 mg, 0.012 mmol) and milliQ water (0.5 mL) were added and the mixture stirred at 65° C. overnight. The mixture was cooled to room temperature, diluted to 10 mL with methanol and mixed vigorously. Thiourea functionalised silica (SiliaMet thiourea, 1.1 mmol/g, 12 mg) was added and the mixture stirred vigorously at room temperature for one hour. The mixture was filtered through a syringe filter and the filtrate concentrated in vacuo. The residue was suspended in ethanol (20 mL) and again concentrated in vacuo. The residue was extracted with hot methanol (1 mL), the solvent was decanted and concentrated in vacuo. The residue was dissolved in methanol (1 mL) and treated with thiol functionalised silica (SiliaMet thiol, 1.4 mmol/g, 10 mg) for thirty min. The mixture was filtered through a syringe filter and the filtrate concentrated in vacuo to give the product as a yellow solid (3.2 mg, 61% yield). LCMS-B: RT 3.17 min; m/z 438.8 [M+H].sup.+; m/z 436.8 [M−H].sup.−.
Example 44: N-(3-oxo-2-phenyl-3-(pyrrolidin-1-yl)propyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (44)
[0786] ##STR00120##
[0787] A suspension of ethyl 3-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoate (73) (0.025 g, 0.062 mmol) and pyrrolidine (0.010 mL, 0.125 mmol) in EtOH (0.1 mL) were irradiated in a microwave reactor at 100° C. for 30 min. The mixture was further treated with NEt.sub.3 (0.017 mL, 0.125 mmol) and pyrrolidine (0.04 mL), then irradiated at 150° C. for 1 h. The crude material was loaded directly onto a column and purified by silica gel chromatography (Isolera Biotage 4 g, 0-100% EtOAc in petroleum benzine 40-60° C., then 0-40% EtOAc in MeOH). The material was further purified by RP-HPLC (Grace Alltima, C8, 5 micron column, 250 mm×22 mm ID, 30-100% CH.sub.3CN in water, 0.1% TFA over 20 min) to give the product (0.003 g, 11% yield) as a white solid. LCMS-B: RT 3.465 min; m/z 427.2 [M+H].sup.+.
Example 45: N-(3-(methylamino)-3-oxo-2-phenylpropyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (45)
[0788] ##STR00121##
[0789] A suspension of ethyl 3-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoate (73) (0.025 g, 0.062 mmol), NEt.sub.3 (0.017 mL, 0.125 mmol) and methylamine (0.016 mL, 0.125 mmol) in EtOH (0.1 mL) were irradiated in a microwave reactor at 150° C. for 30 min. The mixture was treated with additional equivalents of methylamine (0.016 mL, 0.125 mmol) and irradiated at 150° C. for a further 2 h. The material was loaded directly onto a column and purified by RP-HPLC (Grace Alltima, C8, 5 micron column, 250 mm×22 mm ID, 30-100% CH.sub.3CN in water, 0.1% TFA over 20 min) to give the product (0.006 g, 25% yield) as a white solid. .sup.1H NMR (400 MHz, MeOD): δ 7.89 (dd, J=8.0, 1.1 Hz, 1H), 7.71 (ddd, J=8.6, 7.3, 1.4 Hz, 1H), 7.60 (dd, J=8.4, 0.7 Hz, 1H), 7.53 (ddd, J=8.3, 7.3, 1.1 Hz, 1H), 7.40-7.24 (m, 5H), 3.95-3.85 (m, 2H), 3.73 (td, J=10.7, 9.3 Hz, 1H), 2.70 (s, 3H). LCMS-B RT 3.366 min; m/z 387.2 [M+H].sup.+.
Example 46: N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (46)
[0790] ##STR00122##
[0791] To a suspension of the ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I2) (0.063 g, 0.246 mmol) in EtOH (0.125 mL) was added 2-(oxazol-2-yl)-2-phenylethan-1-amine (I27) (0.051 g, 0.271 mmol). The mixture was subjected to microwave irradiation at 100° C. for 30 min. The reaction was cooled and the precipitate filtered. The solid was washed with EtOH (3 mL) and dried under vacuum to give the product (0.072 g, 74% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): δ 12.62 (brs, 1H), 9.28 (t, J=5.9 Hz, 1H), 8.05 (d, J=0.8 Hz, 1H), 7.84 (dd, J=8.0, 1.2 Hz, 1H), 7.79 (d, J=7.9 Hz, 1H), 7.75-7.69 (m, 1H), 7.55-7.49 (m, 1H), 7.36-7.30 (m, 2H), 7.30-7.24 (m, 3H), 7.20 (d, J=0.8 Hz, 1H), 4.67 (t, J=7.6 Hz, 1H), 4.00 (ddd, J=13.2, 7.5, 5.7 Hz, 1H), 3.92-3.84 (m, 1H). LCMS-B: rt 3.495 min, m/z 397.2 [M+H].sup.+.
Example 47: N-(2-(1,3,4-oxadiazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (47)
[0792] ##STR00123##
a) 3-(1,3-dioxoisoindolin-2-yl)-N′-formyl-2-phenylpropanehydrazide (A28)
[0793] To a solution of 3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanoic acid (I32) (0.250 g, 0.847 mmol), EDCI (0.194 g, 1.016 mmol) and formic hydrazine (0.051 g, 0.847 mmol) in DCM (10 mL) was added DMAP (0.124 g, 1.016 mmol). This was allowed to stir at r.t. for 17 h, upon which time the mixture was treated with 1M HCl (10 mL). The layers were separated and the organic portion concentrated in vacuo to give the product (0.464 g, >100% yield) as a white solid. The material was carried forward without further purification. LCMS:B: rt. 3.346 min, m/z 336.1 [M−H].sup.−.
b) 2-(2-(1,3,4-oxadiazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione (A29)
[0794] To a suspension of Burgess reagent (0.775 g, 3.253 mmol) in THF (4 mL) was added 3-(1,3-dioxoisoindolin-2-yl)-N′-formyl-2-phenylpropanehydrazide (28) (0.439 g, 1.301 mmol). This was irradiated in a microwave reactor at 140° C. for 15 min. Upon cooling, the mixture was loaded directly onto silica for purification. The crude material was purified by silica gel chromatography (Isolera Biotage 24 g, 0-100% EtOAc in petroleum benzine 40-60° C., then 0-40% MeOH in EtOAc). Product-containing fractions were combined and concentrated in vacuo to give the product (0.095 g, 23% yield) as a white solid. LCMS-B: rt. 3.558 min, m/z 320.2 [M+H].sup.+.
c) 2-(1,3,4-oxadiazol-2-yl)-2-phenylethan-1-amine (A30)
[0795] To a suspension of 2-(2-(1,3,4-oxadiazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione (A29) (0.045 g, 0.141 mmol) in EtOH (2 mL) was added hydrazine hydrate (50-60%, 0.026 mL, 0.423-0.508 mmol). The solution was heated to 80° C. for 3 h, upon which time it was cooled and the precipitate filtered. The precipitate was washed with a portion of cold EtOH (5 mL), and the combined EtOH fractions were pooled and concentrated in vacuo to give the product (0.030 g, >100% yield) as a yellow semi-solid. The material was carried forward without further purification. LCMS-B: rt. 3.411; no product ion detectable.
d) N-(2-(1,3,4-oxadiazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (47)
[0796] To a suspension of 2-(1,3,4-oxadiazol-2-yl)-2-phenylethan-1-amine (A30) (0.030 g, 0.111 mmol) in EtOH (0.5 mL) was added ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (0.020 g, 0.079 mmol). This was irradiated in a microwave reactor at 100° C. for 30 min. The solution was cooled and the EtOH evaporated. The residue was partitioned between EtOAc (3 mL) and 1M HCl (3 mL). The organic layer was separated and washed with a further portion of 1M HCl (3 mL), brine (3 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The material was purified by RP-HPLC (Grace Alltima, C8, 5 micron column, 250 mm×22 mm ID, 30-100% CH.sub.3CN in water, 0.1% TFA over 20 min) to give the product (0.003 g, 10% yield) as a white solid. LCMS-B: rt. 3.420 min, m/z 398.1 [M+H].sup.+.
Example 48: N-(2-(5-methyl-1,3,4-oxadiazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (48)
[0797] ##STR00124##
a) N′-acetyl-3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanehydrazide (A31)
[0798] To a solution of 3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanoic acid (I32) (0.500 g, 1.693 mmol), EDCI (0.387 g, 2.032 mmol) and formic hydrazine (0.125 g, 1.693 mmol) in DCM (20 mL) was added DMAP (0.248 g, 2.032 mmol). This was allowed to stir at r.t. for 17 h, upon which time the mixture was treated with 1M HCl (20 mL). The layers were separated and the organic portion concentrated in vacuo to give the product (0.680 g, >100% yield) as a white solid. The material was carried forward without further purification. .sup.1H NMR (400 MHz, DMSO-d6): δ 10.15 (d, J=2.0 Hz, 1H), 9.77 (d, J=1.9 Hz, 1H), 7.81-7.78 (m, 4H), 7.33-7.28 (m, 2H), 7.27-7.16 (m, 3H), 4.25 (dd, J=8.9, 7.1 Hz, 1H), 4.08 (dd, J=13.7, 9.0 Hz, 1H), 3.96 (dd, J=13.7, 7.2 Hz, 1H), 1.79 (s, 3H). LCMS-B: rt. 3.324, m/z 350.1 [M−H].sup.−.
b) 2-(2-(5-methyl-1,3,4-oxadiazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione (A32)
[0799] To a suspension of Burgess reagent (1.153 g, 4.838 mmol) in THF (7 mL) was added N′-acetyl-3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanehydrazide (A31) (0.680 g, 1.935 mmol). This was irradiated in a microwave reactor at 140° C. for 15 min. Upon cooling, the crude material was loaded onto silica gel and purified by silica gel chromatography (Isolera Biotage, 40 g SiO.sub.2 Cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.). The fractions containing the desired product were collected and concentrated in vacuo to yield the product (0.289 g, 45% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d6): δ 7.87-7.79 (m, 4H), 7.35-7.31 (m, 4H), 7.31-7.26 (m, 1H), 4.76 (t, J=8.0 Hz, 1H), 4.28 (dd, J=13.9, 7.7 Hz, 1H), 4.21 (dd, J=13.9, 8.3 Hz, 1H), 4.03 (q, J=7.1 Hz, 1H), 2.43 (s, 3H). LCMS-B: rt. 3.588, m/z 334.2 [M+H].sup.+.
c) 2-(5-methyl-1,3,4-oxadiazol-2-yl)-2-phenylethan-1-amine (A33)
[0800] To a suspension of 2-(2-(5-methyl-1,3,4-oxadiazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione (A32) (0.285 g, 0.855 mmol) in EtOH (12 mL) was added hydrazine hydrate (50-60%, 0.160 mL, 2.57-3.08 mmol). The solution was heated to 80° C. for 3 h, upon which time it was cooled and the precipitate filtered. The precipitate was washed with a portion of cold
[0801] EtOH (5 mL), and the combined EtOH fractions were pooled and concentrated in vacuo to give the product (0.174 g, >100% yield) as a yellow oil. The material was carried forward without further purification. LCMS-B: rt. 3.121; no product ion detectable.
d) N-(2-(5-methyl-1,3,4-oxadiazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (48)
[0802] To a suspension of 2-(5-methyl-1,3,4-oxadiazol-2-yl)-2-phenylethan-1-amine (A33) (0.100 g, 0.492 mmol) in EtOH (0.25 mL) was added ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (0.114 g, 0.447 mmol). This was irradiated in a microwave reactor at 100° C. for 30 min. The solution was cooled and the precipitate filtered. The resulting solid was washed with further portions of EtOH (3×3 mL) and dried to reveal the desired product (0.131 g, 71% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d6): δ 12.60 (brs, 1H), 9.30 (brs, 1H), 7.86-7.80 (m, 1H), 7.73 (dt, J=14.4, 7.7 Hz, 2H), 7.50 (t, J=7.5 Hz, 1H), 7.42-7.29 (m, 5H), 4.72 (t, J=7.5 Hz, 1H), 4.00 (ddd, J=13.6, 8.0, 5.8 Hz, 1H), 3.87 (dt, J=13.4, 6.7 Hz, 1H), 2.44 (s, 3H). LCMS-B: rt. 3.408 min, m/z 412.2 [M+H].sup.+.
Example 49: Ethyl (2-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-1-phenylethyl)carbamate (49)
[0803] ##STR00125##
[0804] To a suspension of N-(2-amino-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide hydrochloride (I41) (0.025 g, 0.066 mmol) in DCM (0.5 mL) was added NEt.sub.3 (0.019 mL, 0.135 mmol), followed 10 min later by ethyl chloroformate (0.007 mL, 0.069 mmol) dropwise. This was allowed to stir at r.t. for 17 h upon which time the reaction was diluted with DCM (1 mL), washed with 1M HCl (1 mL), saturated Na.sub.2CO.sub.3 (1 mL), brine (1 mL) then dried (Na.sub.2SO.sub.4) and concentrated in vacuo to reveal the product (0.022 g, 80% yield) as a white solid. LCMS-B: r.t. 3.474 min; m/z 417.2 [M+H].sup.+.
Example 50: Isopropyl (2-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-1-phenylethyl) carbamate (50)
[0805] ##STR00126##
[0806] To a suspension of N-(2-amino-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide hydrochloride (I41) (0.020 g, 0.053 mmol) in DCM (0.5 mL) was added NEt.sub.3 (0.015 mL, 0.111 mmol), followed 10 min later by a 1M solution of iso-propyl chloroformate (0.061 mL, 0.064) dropwise. This was allowed to stir at r.t. for 2 h upon which the reaction was diluted with DCM (1 mL) and washed with 1M HCl (1 mL), saturated Na.sub.2CO.sub.3 (1 mL), brine (1 mL) then dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was purified by RP-HPLC (Grace Alltima, C8, 5 micron column, 250 mm×22 mm ID, 30-100% CH.sub.3CN in water, 0.1% TFA over 30 min) to give the product (0.002 g, 7% yield) as a white solid. LCMS-B: r.t. 3.519 min; m/z 429.2 [M−H].sup.−.
Example 51: 2-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-1-phenylethyl azetidine-1-carboxylate (51)
[0807] ##STR00127##
a) 2-(2-hydroxy-2-phenylethyl)isoindoline-1,3-dione (A34)
[0808] Phthalic anhydride (2.159 g, 14.579 mmol) and 2-amino-1-phenylethan-1-ol (2.000 g, 14.579 mmol) were combined in a microwave vessel and irradiated at 150° C. for 15 min. The resulting residue was dried under vacuum to reveal the desired product (3.600 g, 92% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d6): δ 7.89-7.81 (m, 4H), 7.41-7.32 (m, 4H), 7.30-7.23 (m, 1H), 5.66 (brs, 1H), 4.93 (dd, J=8.8, 4.8 Hz, 1H), 3.77 (dd, J=13.6, 8.8 Hz, 1H), 3.64 (dd, J=13.6, 4.8 Hz, 1H). LCMS-B: rt 3.567 min; m/z 266.1 [M−H].sup.−.
b) 2-(1,3-dioxoisoindolin-2-yl)-1-phenylethyl azetidine-1-carboxylate (A35)
[0809] To a solution of 2-(2-hydroxy-2-phenylethyl)isoindoline-1,3-dione (A34) (0.400 g, 1.497 mmol) in dry toluene (5 mL), under an atmosphere of N.sub.2, was added CDI (0.291 g, 1.796 mmol). The mixture was allowed to stir at r.t. for 3 h, upon which dry THF (2 mL) was added. The solution was stirred for a further hour, upon which azetidine.HCl (0.280 g, 2.993 mmol) was added. The mixture was left to stir overnight. EtOAc was added (10 mL) and the mixture was then washed with water (10 mL), brine (10 mL), dried (Na.sub.2SO.sub.4), filtered and concentrated in vacuo. This crude material was purified by column chromatography (Isolera Biotage, 40 g SiO.sub.2 Cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.), with the fractions containing the desired material combined and concentrated in vacuo to reveal the desired product (0.235 g, 45% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d6): δ 8.00-7.77 (m, 4H), 7.50-7.24 (m, 5H), 5.82 (dd, J=9.0, 3.8 Hz, 1H), 4.03-3.92* (m, 2H), 4.05-3.88* (m, 1H), 3.81 (dd, J=14.3, 3.9 Hz, 1H), 3.76-3.58 (m, 2H), 2.23-2.04 (m, 2H). *overlapping peaks. LCMS-B: rt. 3.721; m/z 349.1 [M−H].sup.−
c) 2-amino-1-phenylethyl azetidine-1-carboxylate (A36)
[0810] To a suspension of 2-(1,3-dioxoisoindolin-2-yl)-1-phenylethyl azetidine-1-carboxylate (A35) (0.230 g, 0.656 mmol) in EtOH (12 mL) was added hydrazine hydrate (50-60%, 0.123 mL, 1.97-2.36 mmol). The solution was heated to 80° C. for 3 h, upon which time it was cooled and the precipitate filtered. The precipitate was washed with a portion of cold EtOH (5 mL), and the combined EtOH fractions were pooled and concentrated in vacuo to reveal the product (0.122 g, 84% yield) as an oil. The material was carried forward without further purification. LCMS-B: rt. 3.079; no product ion detectable.
d) 2-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-1-phenylethyl azetidine-1-carboxylate (51)
[0811] To 2-amino-1-phenylethyl azetidine-1-carboxylate (A36) (0.050 g, 0.227 mmol) in EtOH (0.125 mL) was added ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (0.048 g, 0.189 mmol). The mixture was subjected to microwave irradiation at 100° C. for 30 min. The reaction was cooled and the solvent evaporated. The crude material was purified by silica gel chromatography (Isolera Biotage, 12 g SiO.sub.2 Cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.). The fractions were combined and concentrated to dryness. The material was dissolved in a 1:1:1 mixture of THF: MeOH: 2M NaOH (3 mL) and allowed to stir overnight at r.t. The volatile solvents were removed and the aqueous layer was extracted with EtOAc (3×3 mL). This material was purified by column chromatography (Isolera Biotage, 12 g SiO.sub.2 Cartridge, 0-100% EtOAc in petroleum benzine 40-60° C., then 0-40% MeOH in EtOAc). The fractions containing the desired product were combined and concentrated in vacuo to reveal the product (0.015 g, 19% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d6): δ 12.69 (brs, 1H), 9.27 (brs, 1H), 7.88-7.65 (m, 3H), 7.55-7.47 (m, 1H), 7.45-7.27 (m, 5H), 5.80 (dd, J=8.7, 4.0 Hz, 1H), 4.12-3.95* (m, 2H), 3.91-3.75* (m, 2H), 3.71-3.61* (m, 2H), 2.16 (p, J=7.8, 7.8, 7.7, 7.7 Hz, 2H). *overlapping peaks. LCMS-B: rt. 3.521; m/z 427.1 [M−H].sup.−.
Example 52: N-(2-phenyl-2-(1H-1,2,3-triazol-1-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (52)
[0812] ##STR00128##
a) 2-(2-phenyl-2-(1H-1,2,3-triazol-1-yl)ethyl)isoindoline-1,3-dione (A37)
[0813] 2-(2-Hydroxy-2-phenylethyl)isoindoline-1,3-dione (A34) (0.500 g, 1.871 mmol), 1,2,3-triazole (0.130 mL, 2.245 mmol) and triphenylphosphine (0.589 g, 2.245 mmol), under an atmosphere of nitrogen, were dissolved in THF (25 mL) and cooled to 0° C. DIAD (0.422 mL, 2.245 mmol) was added dropwise over 10 min. The reaction was sealed, allowed to warm to r.t., then stirred overnight. Water (30 mL) was added to quench the reaction. The mixture was extracted with EtOAc (3×20 mL). The combined organic layers were washed with brine (20 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was purified by silica gel chromatography (Isolera Biotage, 40 g, 0-100% EtOAc in petroleum benzine 40-60° C.) to yield the product (0.137 g, 23% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): δ 8.35 (d, J=1.1 Hz, 1H), 7.86-7.81 (m, 4H), 7.70 (d, J=1.0 Hz, 1H), 7.56-7.48 (m, 2H), 7.43-7.33 (m, 3H), 6.20 (dd, J=9.2, 6.1 Hz, 1H), 4.60 (dd, J=14.2, 9.2 Hz, 1H), 4.39 (dd, J=14.2, 6.1 Hz, 1H).
b) 2-phenyl-2-(1H-1,2,3-triazol-1-yl)ethan-1-amine (A38)
[0814] To a suspension of 2-(2-phenyl-2-(1H-1,2,3-triazol-1-yl)ethyl)isoindoline-1,3-dione (A37) (0.137 g, 0.430 mmol) in EtOH (12 mL) was added hydrazine hydrate (50-60%, 0.080 mL, 1.29-1.55 mmol). The solution was heated to 80° C. for 3 h, upon which time it was cooled and the precipitate filtered. The precipitate was washed with a portion of cold EtOH (5 mL), and the combined EtOH fractions were pooled and concentrated in vacuo. The material was suspended in cold EtOH (3 mL) and re-filtered. The filtrate was concentrated in vacuo to reveal the product (0.060 g, 74% yield) as a yellow semi-solid. The material was carried forward without any further purification. .sup.1H NMR (400 MHz, DMSO-d.sub.6): δ 8.30 (d, J=1.0 Hz, 1H), 7.76 (d, J=1.0 Hz, 1H), 7.39-7.27 (m, 5H), 5.69 (dd, J=9.1, 5.4 Hz, 1H), 3.48 *partially obscured by solvent (dd, J=13.5, 9.2 Hz, 2H), 3.26 *partially obscured by solvent (dd, J=13.5, 5.4 Hz, 2H).
c) N-(2-phenyl-2-(1H-1,2,3-triazol-1-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (52)
[0815] To 2-phenyl-2-(1H-1,2,3-triazol-1-yl)ethan-1-amine (A38) (0.060 g, 0.319 mmol) in EtOH (0.125 mL) was added ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (0.068 g, 0.266 mmol). This was irradiated in a microwave reactor at 100° C. for 30 min. The solution was cooled, then concentrated in vacuo. The residue was taken up in EtOAc (2 mL) and the resulting precipitate filtered. The organic layer was washed with 1 M HCl (2 mL), water (2 mL), brine (2 mL), then dried (Na.sub.2SO.sub.4), filtered and concentrated in vacuo. The crude solid was purified by silica gel chromatography (Isolera Biotage 12 g, 0-100% EtOAc in petroleum benzine 40-60° C.). Product-containing fractions were combined and concentrated in vacuo to give the product (0.025 g, 24% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d6): δ 12.65 (s, 1H), 9.51-9.42 (m, 1H), 8.38 (d, J=1.1 Hz, 1H), 7.84 (dd, J=8.0, 1.5 Hz, 1H), 7.79 (d, J=8.4 Hz, 1H), 7.77 (d, J=1.0 Hz, 1H), 7.72 (t, J=7.9 Hz, 1H), 7.52 (t, J=7.6 Hz, 1H), 7.41 (s, 1H), 7.40 (d, J=2.3 Hz, 2H), 7.38-7.33 (m, 1H), 6.16 (dd, J=9.0, 5.6 Hz, 1H), 4.33 (ddd, J=13.7, 9.0, 6.6 Hz, 1H), 4.06 (dt, J=13.7, 5.5, 5.5 Hz, 1H). LCMS-B: rt. 3.408 min; m/z 397.1 [M+H].sup.+.
Example 53: N-(2-(4-methyloxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (53)
[0816] ##STR00129##
a) 2-oxopropyl 3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanoate (A39)
[0817] To a solution of 3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanoic acid (I32) (1.000 g, 3.38 mmol) in THF (5 mL), under an atmosphere of N.sub.2, was added NEt.sub.3 (0.566 mL, 4.06 mmol). The reaction mixture was allowed to stir for 10 min, upon which time it was cooled to 0° C., and chloroacetone (0.419 mL, 5.08 mmol) was added slowly. The mixture was allowed to warm to r.t. and stirred overnight. The formed precipitate was removed by filtration and the filtrate concentrated in vacuo to reveal the product (1.062 g, 89% yield). LCMS-B: rt 3.290 min; no product ion detected.
b) 2-(2-(4-methyloxazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione (A40)
[0818] To a solution of 2-oxopropyl 3-(1,3-dioxoisoindolin-2-yl)-2-phenylpropanoate (A39) (1.062 g, 3.02 mmol) in THF (5 mL), under an atmosphere of nitrogen, was added BF.sub.3.OEt.sub.2 (0.746 mL, 6.05 mmol) followed by acetamide (0.893 g, 15.1 mmol) The mixture was sealed then irradiated in a CEM microwave reactor at 150° C. for 2 h. The reaction mixture was cooled and the solid precipitate filtered. The solid was washed with EtOAc (10 mL) and the combined organics were concentrated in vacuo. The crude material was purified by silica gel chromatography (Isolera Biotage, 40 g Si Cartridge, 0-80% EtOAc in petroleum benzine 40-60° C.). Fractions containing suspected product, eluting at −50% EtOAc, were collected and concentrated in vacuo, to yield the product (0.060 g, 6% yield) as a white solid. LCMS-B: r.t. 3.345 min; m/z 333.1 [M+H].sup.+.
c) 2-(4-methyloxazol-2-yl)-2-phenylethan-1-amine (A41)
[0819] To a suspension of 2-(2-(4-methyloxazol-2-yl)-2-phenylethyl)isoindoline-1,3-dione (A40) (0.060 g, 0.18 mmol) in EtOH (4 mL) was added hydrazine hydrate (50-60%, 0.034 mL, 0.55-0.65 mmol). The solution was heated at 80° C. for 17 h. A further portion of hydrazine hydrate (50-60%, 0.034 mL, 0.55-0.65 mmol) was added and the solution allowed to stir for an additional 2 h, upon which time it was cooled and the resulting precipitate filtered. The precipitate was washed with a portion of cold EtOH (5 mL), and the combined EtOH fractions were pooled and concentrated in vacuo to reveal the product (0.022 g, 60% yield). The crude material was carried forward without any further purification. LC-MS: (LCMS-B) r.t. 2.913 min, m/z 203.1 [M+H].sup.+.
d) N-(2-(4-methyloxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (53)
[0820] To 2-(4-methyloxazol-2-yl)-2-phenylethan-1-amine (A41) (0.022 g, 0.109 mmol) in EtOH (0.125 mL) was added ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (0.021 g, 0.084 mmol). The mixture was subjected to microwave irradiation at 100° C. for 30 min. The reaction mixture was cooled and EtOH removed in vacuo. The mixture was taken up in EtOAc (3 mL) and washed with 1 M HCl (3 mL), brine (3 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The material was further purified by silica gel chromatography (Isolera Biotage, 4 g, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the desired product (0.004 g, 12% yield) as a white solid. .sup.1H NMR (400 MHz, MeOD): δ 7.94-7.85 (m, 1H), 7.76-7.66 (m, 1H), 7.65-7.57 (m, 1H), 7.58-7.49 (m, 2H), 7.41-7.21 (m, 5H), 4.50-4.43 (m, 1H, partially overlapping with solvent), 4.10-4.00 (m, 1H), 4.00-3.90 (m, 1H), 2.16 (s, 3H), exchangeable NH protons not observed. LCMS-B: rt 3.194 min; m/z 411.1 [M+H].sup.+.
Example 54: N-(2-phenyl-2-(1H-pyrrol-1-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (54)
[0821] ##STR00130##
a) 2-phenyl-2-(1H-pyrrol-1-yl)ethan-1-amine (A42)
[0822] To a solution of 3-phenyl-3-(1H-pyrrol-1-yl)propanoic acid (0.300 g, 1.39 mmol) in toluene (6 mL) under an atmosphere of nitrogen was added triethylamine (0.389 mL, 2.79 mmol) and DPPA (0.603 mL, 2.79 mmol). The solution was heated to 80° C., when the evolution of nitrogen began immediately. After 3 h at this temperature, the reaction mixture was cooled to r.t., a 2 M aq. NaOH solution (5 mL) was added and the mixture heated to 80° C. and left to stir overnight. Water (5 mL) was added and the reaction mixture was heated to 110° C., then stirred for a further 17 h. The reaction mixture was concentrated in vacuo and the crude material taken up in minimal MeOH and loaded onto a 10 g SCX cartridge. The cartridge was washed with MeOH (90 mL), then stripped with a 1M solution of methanolic ammonia (90 mL). The ammonia washes were concentrated in vacuo to give the desired product (0.078 g, 30% yield) as a pale yellow oil. .sup.1H NMR (400 MHz, CDCl.sub.3): δ 7.43-7.28 (m, 3H), 7.25-7.16 (m, 2H), 6.84 (t, J=2.2 Hz, 2H), 6.27 (t, J=2.1 Hz, 2H), 5.10 (dd, J=8.8, 5.8 Hz, 1H), 3.53-3.34 (m, 2H), exchangeable NH protons not observed. LCMS-B: rt. 0.766 min, product mass ion not present.
b) N-(2-phenyl-2-(1H-pyrrol-1-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (54)
[0823] To 2-phenyl-2-(1H-pyrrol-1-yl)ethan-1-amine (A42) (0.078 g, 0.42 mmol) in EtOH (0.125 mL) was added ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (12) (0.071 g, 0.28 mmol). The mixture was subjected to microwave irradiation at 100° C. for 30 min. The reaction mixture was cooled and the resulting precipitate was filtered. The solid was washed with a portion of EtOH (2 mL) and then dried under vacuum to give the desired product (0.069 g, 63% yield) as a grey solid. .sup.1H NMR (400 MHz, d.sub.6-DMSO): δ 12.92-12.40 (brs, 1H), 9.39-9.34 (dd, J=6.6, 5.1 Hz, 1H), 7.88-7.79 (m, 2H), 7.76-7.68 (m, 1H), 7.57-7.47 (m, 1H), 7.39-7.21 (m, 5H), 6.95-6.90 (t, J=2.1 Hz, 2H), 6.05-5.98 (t, J=2.1 Hz, 2H), 5.64-5.55 (dd, J=9.3, 5.7 Hz, 1H), 4.20-4.05 (ddd, J=13.7, 9.4, 6.7 Hz, 1H), 4.00-3.84 (dt, J=13.8, 5.5 Hz, 1H). LCMS-B: r.t. 3.305 min, m/z 395.1 [M+H].sup.+.
Example 55: N-(2-(2-fluorophenyl)-2-(1H-pyrrol-1-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (55)
[0824] ##STR00131##
a) 2-(2-fluorophenyl)-2-(1H-pyrrol-1-yl)ethan-1-amine (A43)
[0825] To a solution of 3-phenyl-3-(1H-pyrrol-1-yl)propanoic acid (0.300 g, 1.29 mmol) in toluene (6 mL) under an atmosphere of nitrogen was added triethylamine (0.359 mL, 2.57 mmol) and DPPA (0.556 mL, 2.572 mmol). The solution was heated to 80° C., whereby the evolution of nitrogen began immediately. After 3 h at this temperature, the reaction mixture was cooled to r.t., a 2 M aq. NaOH solution (5 mL) was added and the mixture heated to 80° C. and left to stir overnight. Water (5 mL) was added and the reaction mixture was heated to 110° C., then stirred for a further 17 h. The reaction mixture was concentrated in vacuo and the crude material taken up in minimal MeOH and loaded onto a 10 g SCX cartridge. The cartridge was washed with MeOH (90 mL), then stripped with a solution of methanolic ammonia (90 mL). The ammonia washes were concentrated in vacuo to reveal the desired product (0.135 g, 51% yield) as a pale yellow oil. .sup.1H NMR (400 MHz, CDCl.sub.3): δ 7.19-7.10 (m, 1H), 7.01-6.87 (m, 3H), 6.73 (t, J=2.1 Hz, 2H), 6.13 (t, J=2.1 Hz, 2H), 5.28 (dd, J=9.1, 5.4 Hz, 1H), 3.40-3.18 (m, 2H), exchangeable NH.sub.2 protons not observed. LCMS-B: rt. 0.774 min, product mass ion not present.
b) N-(2-(2-fluorophenyl)-2-(1H-pyrrol-1-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (55)
[0826] To 2-(2-fluorophenyl)-2-(1H-pyrrol-1-yl)ethan-1-amine (A43) (0.135 g, 0.661 mmol) in EtOH (0.250 mL) was added ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I2) (0.112 g, 0.441 mmol). The mixture was subjected to microwave irradiation at 100° C. for 30 min. The reaction mixture was cooled and the resulting precipitate was filtered. The solid was washed with a portion of EtOH (2 mL) and then dried under vacuum to reveal the desired product (0.109 g, 60% yield) as a grey solid. .sup.1H NMR (400 MHz, d.sub.6-DMSO): δ 12.92-12.28 (brs, 1H), 9.49-9.39 (t, J=5.9 Hz, 1H), 7.87-7.78 (m, 2H), 7.76-7.69 (m, 1H), 7.56-7.49 (m, 1H), 7.42-7.28 (m, 2H), 7.27-7.16 (m, 2H), 6.94-6.86 (t, J=2.2 Hz, 2H), 6.04-5.99 (t, J=2.1 Hz, 2H), 5.96-5.88 (dd, J=9.0, 6.0 Hz, 1H), 4.20-4.05 (ddd, J=13.6, 9.2, 6.6 Hz, 1H), 4.00-3.89 (dt, J=13.7, 5.6 Hz, 1H). LCMS-B: r.t. 3.316 min, m/z 413.1 [M+H].sup.+.
Example 56: N-(2-(3-methyl-1,2,4-oxadiazol-5-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (56)
[0827] ##STR00132##
a) tert-butyl (2-(3-methyl-1,2,4-oxadiazol-5-yl)-2-phenylethyl)carbamate (A44)
[0828] To a solution of 3-((tert-butoxycarbonyl)amino)-2-phenylpropanoic acid (1.00 g, 3.7 mmol) in DMF (10 mL), under an atmosphere of nitrogen, was added EDCI.HCl (0.723 g, 3.7 mmol) and HOBt (0.509 g, 3.769 mmol). After 10 min, N-hydroxyacetimidamide (0.279 g, 3.7 mmol) was added. The mixture was allowed to stir at r.t. for 2 h, upon which time the mixture was heated to 80° C. and allowed to stir for 17 h. The reaction mixture was quenched by pouring it into a sat. aq. Na.sub.2CO.sub.3 solution (100 mL). The aqueous layer was extracted with EtOAc (3×100 mL). The combined organics were washed with water (200 mL), brine (200 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was purified by column chromatography (Isolera Biotage 40 g, 0-50% EtOAc in petroleum benzine 40-60° C.). Fractions containing the product were combined and concentrated in vacuo to reveal the product (0.475 g, 42% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3): δ 7.41-7.21 (m, 5H, partially obscured by solvent), 4.95 (s, 1H), 4.60-4.44 (m, 1H), 3.76 (t, J=7.1 Hz, 2H), 2.42 (s, 3H), 1.42 (s, 9H). LCMS-F: r.t. 8.968 min, m/z 304.0 [M+H].sup.+, 204.0 [M−Boc+H].sup.+.
b) 2-(3-methyl-1,2,4-oxadiazol-5-yl)-2-phenylethan-1-amine (A45)
[0829] To tert-butyl (2-(3-methyl-1,2,4-oxadiazol-5-yl)-2-phenylethyl)carbamate (A44) (0.475 g, 1.57 mmol), in DCM (12.5 mL), was added TFA (1.25 mL). The mixture was stirred overnight at r.t. and then diluted with DCM (10 mL), and basified with 2 M NaOH (10 mL). The layers were separated and the aqueous layer washed with further portions of DCM (2×10 mL). The organics were combined, washed with brine (30 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo to reveal the product (0.299 g, 94% yield) as a clear oil. .sup.1H NMR: (400 MHz, CDCl.sub.3): δ 7.36-7.14 (m, 5H), 4.16 (dd, J=7.8, 6.6 Hz, 1H), 3.35 (dd, J=13.1, 7.7 Hz, 1H), 3.20 (dd, J=13.1, 6.6 Hz, 1H), 2.31 (s, 3H), exchangeable NH.sub.2 protons not observed.
c) N-(2-(3-methyl-1,2,4-oxadiazol-5-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (56)
[0830] Ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I7) (0.050 g, 0.13 mmol) and 2-(3-methyl-1,2,4-oxadiazol-5-yl)-2-phenylethan-1-amine (A45) (0.032 g, 0.16 mmol) were suspended in EtOH (0.2 mL), then irradiated in a microwave reactor at 120° C. for 60 min. The mixture was allowed to cool and the precipitate filtered. The precipitate was washed with EtOH (2 mL). The filtrate was concentrated in vacuo then purified by column chromatography (Grace Biotage, 12 g SiO.sub.2, 0-100% EtOAc in petroleum benzines 40-60° C.). Fractions containing the desired product were combined and concentrated in vacuo to reveal the product (0.006 g, 9% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): δ 12.73 (s, 1H), 9.40 (brs, 1H), 8.28-7.93 (m, 2H), 7.58 (d, J=8.8 Hz, 1H), 7.41-7.27 (m, 5H), 4.83 (t, J=7.5 Hz, 1H), 4.09-3.99 (m, 1H), 3.89 (dt, J=13.4, 6.7 Hz, 1H), 2.33 (s, 3H). LC-MS (LCMS-B) r.t. 3.331 min; m/z 537.7 [M+H].sup.+.
Example 57: N-(2-(2-(difluoromethoxy)phenyl)-2-hydroxyethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (57)
[0831] ##STR00133##
a) 1-(2-(difluoromethoxy)phenyl)-2-nitroethan-1-ol (A46)
[0832] To a solution of 2-(difluoromethoxy)benzaldehyde (2.0 g, 11.7 mmol) in MeOH (25 mL) were added nitromethane (1.88 mL, 34.9 mmol) and sodium methoxide (0.75 g, 13.9 mmol). The solution was allowed to stir for 2 h, then quenched with the addition of 2 M HCl (10 mL) and extracted with EtOAc (30 mL). The organic layer was washed with brine (30 mL×2), dried (Na.sub.2SO.sub.4) and concentrated in vacuo to reveal the product (2.617 g, 97% yield) as an orange oil. The material was carried forward without any further purification. .sup.1H NMR (400 MHz, CDCl.sub.3): δ 7.62 (dd, J=7.7, 1.8 Hz, 1H), 7.41-7.34 (m, 1H), 7.32-7.20 (m, 1H), 7.14 (ddd, J=8.2, 3.0, 1.1 Hz, 1H), 6.61 (t, J=73.1 Hz, 1H), 5.76 (dd, J=9.1, 3.0 Hz, 1H), 4.85 (dd, J=7.0, 1.0 Hz, 1H), 4.67-4.48 (m, 2H).
b) 2-amino-1-(2-(difluoromethoxy)phenyl)ethan-1-ol (A47)
[0833] 1-(2-(Difluoromethoxy)phenyl)-2-nitroethan-1-ol (A46) (1.600 g, 6.862 mmol) and nickel (II) chloride hexahydrate (4.078 g, 17.16 mmol) were dissolved in dry methanol (50 mL) and stirred vigorously under nitrogen. The mixture was cooled to 0° C. and sodium borohydride (6.490 g, 171.5 mmol) was added in 0.5 g portions over 30 min (comment: exothermic, gas evolution). After 1 h, the mixture was quenched with the addition of 2 N HCl (20 mL). The reaction was then basified to ˜pH 11 using sat. NaHCO.sub.3 solution and the MeOH removed in vacuo. EtOAc (50 mL) was added and the layers separated. The aqueous was washed with further portions of EtOAc (3×50 mL). The organics were combined, washed with brine (150 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo to reveal the product (1.023 g, 73% yield) as an orange oil. The material was carried forward without any further purification. LCMS-A: r.t. 1.522 min, product mass ion not present.
c) N-(2-(2-(difluoromethoxy)phenyl)-2-hydroxyethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (57)
[0834] To 2-amino-1-(2-(difluoromethoxy)phenyl)ethan-1-ol (A47) (0.040 g, 0.20 mmol) in EtOH (0.125 mL) was added ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide, (I7) (0.050 g, 0.13 mmol). The mixture was subjected to microwave irradiation at 100° C. for 1 h. The reaction mixture was cooled and EtOH removed in vacuo. The reaction mixture was taken up in EtOAc (3 mL) and washed with 1 M HCl (3 mL), brine (3 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo to give the product (0.046 g, 65% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.75 (brs, 1H), 9.15-8.95 (m, 1H), 8.13-8.02 (m, 2H), 7.65-7.55 (m, 2H), 7.37-7.31 (m, 1H), 7.27 (td, J=7.5, 1.2 Hz, 1H), 7.17 (t, J=73.7 Hz, 1H), 7.19-7.11 (m, 1H), 5.65 (d, J=4.7 Hz, 1H), 5.14 (dt, J=8.6, 4.4 Hz, 1H), 3.48 (dt, J=13.0, 5.1 Hz, 1H), other CH.sub.2 proton obscured by water signal as confirmed by 2D COSY. LCMS-B: r.t. 3.324 min; m/z 535.7 [M−H].sup.−.
Example 58: N-(2-(2-(difluoromethoxy)phenyl)-2-methoxyethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (58)
[0835] ##STR00134##
a) 2-(2-(2-(difluoromethoxy)phenyl)-2-hydroxyethyl)isoindoline-1,3-dione (A48)
[0836] 2-Amino-1-(2-(difluoromethoxy)phenyl)ethan-1-ol (A47) (0.250 g, 1.23 mmol), phthalic anhydride (0.164 g, 1.1 mmol) and 3 Å molecular sieves were suspended in toluene (10 mL) and the solution heated to 110° C. DMF (1 mL) was added to aid solubility and the reaction was left to stir overnight. The reaction mixture was cooled to r.t., poured into water (50 mL) and then extracted with EtOAc (50 mL). The organic layer was washed with a solution of 1 M HCl (50 mL), brine (50 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo to reveal the product (0.245 g, 60% yield) as an orange oil. The material was carried forward without any further purification. .sup.1H NMR (400 MHz, DMSO-d.sub.6): δ 7.89-7.79 (m, 4H), 7.62 (dd, J=7.6, 1.9 Hz, 1H), 7.36-7.30 (m, 1H), 7.29-7.23 (m, 1H), 7.15 (t, J=74.1 Hz, 1H), 7.13-7.07 (m, 1H), 5.69 (d, J=4.7 Hz, 1H), 5.25 (dt, J=7.9, 5.0 Hz, 1H), 3.79-3.63 (m, 2H).
b) 2-(2-(2-(difluoromethoxy)phenyl)-2-methoxyethyl)isoindoline-1,3-dione (A49)
[0837] To a solution of 2-(2-(2-(difluoromethoxy)phenyl)-2-hydroxyethyl)isoindoline-1,3-dione (A48) (0.245 g, 0.735 mmol) in THF (5 mL) at 0° C., under a nitrogen atmosphere, was added NaH (60% dispersion in mineral oil, 0.044 g, 1.1 mmol). The mixture was allowed to stir for 30 min at this temperature before methyl iodide (0.092 mL, 1.5 mmol) was added. After 30 min at 0° C., the reaction mixture was allowed to warm to r.t. and stirred for 5 h. The reaction mixture was quenched by the addition of water (1 mL) and then the THF was removed in vacuo. The material was partitioned between EtOAc (10 mL) and aq. 1 M HCl (10 mL), then separated. The aqueous layer was further washed with EtOAc (2×10 mL). The organics were combined, washed with brine, dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was purified by silica gel chromatography (Isolera Biotage, 12 g Si Cartridge, 0-50% EtOAc in petroleum benzine 40-60° C.). Fractions containing suspected product were collected and concentrated in vacuo to yield ˜70% pure material (0.062 g, 24% yield). This impure material was used in the next step without further purification.
c) 2-(2-(difluoromethoxy)phenyl)-2-methoxyethan-1-amine (A50)
[0838] To a suspension of crude 2-(2-(2-(difluoromethoxy)phenyl)-2-methoxyethyl)isoindoline-1,3-dione (A49) (0.062 g, 0.179 mmol) in EtOH (3 mL) was added hydrazine hydrate (50-60%, 0.104 mL, 1.67-2.00 mmol). The solution was stirred at 80° C. overnight, cooled and the precipitate filtered. The precipitate was washed with a portion of cold EtOH (1 mL), and the combined EtOH fractions were pooled and concentrated in vacuo. The resulting solid was re-suspended in minimum cold EtOH, the solid filtered and the EtOH filtrate concentrated in vacuo to reveal the product (0.042 g, >100% yield). The material was carried forward without any further purification. LCMS-A: r.t. 1.678 min, no desired mass ion present.
d) N-(2-(2-(difluoromethoxy)phenyl)-2-methoxyethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (58)
[0839] To 2-(2-(difluoromethoxy)phenyl)-2-methoxyethan-1-amine (A50) (0.042 g, 0.193 mmol) in EtOH (0.125 mL) was added ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I7) (0.037 g, 0.097 mmol). The mixture was subjected to microwave irradiation at 100° C. for 1 h. The reaction mixture was cooled and the precipitate filtered. The filtrate was concentrated in vacuo to reveal a complex mixture of products. The crude material was loaded onto a column and purified by silica gel chromatography (Isolera Biotage 4 g Si cartridge, 0-100% EtOAc in petroleum benzine 40-60° C., then 0-40% MeOH in EtOAc). Product-containing fractions were combined and concentrated in vacuo to give the product (0.001 g, 0.5% yield over three steps) as a white solid. LCMS-B: rt. 3.768, m/z 549.7 [M−H].sup.−
Example 59: N-(2-(3-(hydroxymethyl)-1,2,4-oxadiazol-5-yl)-2-phenylethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (59)
[0840] ##STR00135## ##STR00136##
a) Ethyl (2E)-2-[[3-(tert-butoxycarbonylamino)-2-phenyl-propanoyl]amino]-2-hydroxyimino-acetate (A51)
[0841] To 3-{[(tert-Butoxy)carbonyl]amino}-2-phenylpropanoic acid (1.0 g, 3.8 mmol), ethyl 2-(hydroxyamino)-2-imino-acetate (0.50 g, 3.8 mmol) and (2-(7-aza-1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate) (1.4 g, 3.8 mmol) in acetonitrile (30 mL) was added N,N-diisopropylethylamine (0.66 mL, 3.8 mmol). This was allowed to stir at r.t. for 1 h, upon which time a white precipitate formed. The mixture was filtered and the resulting solid was washed successively with EtOAc (20 mL), water (50 mL), ether (20 mL), then allowed to air dry to reveal the desired product (1.2 g, 80% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.40-7.25 (m, 5H), 7.03 (brs, 2H), 4.25 (q, J=7.1 Hz, 2H), 4.08 (dd, J=8.8, 6.6 Hz, 1H), 3.66-3.53 (m, 1H), 3.30-3.22* partially obscured by solvent (m, 1H), 1.35 (s, 9H), 1.25 (t, J=7.1 Hz, 3H), exchangeable OH proton not observed. LCMS (LCMS-A) rt. 5.691 min; m/z 378.2 [M−H].sup.−.
b) Ethyl 5-[2-(tert-butoxycarbonylamino)-1-phenyl-ethyl]-1,2,4-oxadiazole-3-carboxylate (A52)
[0842] Ethyl (2E)-2-[[3-(tert-butoxycarbonylamino)-2-phenyl-propanoyl]amino]-2-hydroxyimino-acetate (A51) (0.85 g, 2.2 mmol) in DMF (5 mL) was heated to 120° C. and allowed to stir o/n. The reaction mixture was cooled and concentrated to dryness. The crude residue was loaded onto a silica gel cartridge and purified by column chromatography (Isolera, Grace 40 g Si cartridge, 0-50% EtOAc in petroleum benzine 40-60° C.) with the material eluting at ˜30% EtOAc collected and concentrated in vacuo to reveal the desired product (430 mg, 53% yield) as a white solid. .sup.1H NMR: (400 MHz, Chloroform-d): δ 7.36-7.24 *partially obscured by solvent (m, 5H), 5.00 (br t, J=6.4 Hz, 1H), 4.75-4.64 (m, 1H), 4.50 (q, J=7.1 Hz, 2H), 3.89-3.72 (m, 2H), 1.43 (t, J=7.1 Hz, 3H), 1.40 (s, 9H). LCMS-A: rt. 6.006 min; m/z 261.9 [M+H−Boc].sup.+.
c) tert-Butyl N-[2-[3-(hydroxymethyl)-1,2,4-oxadiazol-5-yl]-2-phenyl-ethyl]carbamate (A53)
[0843] To a solution of ethyl 5-[2-(tert-butoxycarbonylamino)-1-phenyl-ethyl]-1,2,4-oxadiazole-3-carboxylate (A52) (0.27 g, 0.76 mmol) in EtOH (15 mL) and THF (3 mL), under an atmosphere of nitrogen, was added sodium borohydride (0.057 g, 1.5 mmol). The mixture was allowed to stir o/n at r.t. The reaction mixture was quenched with the addition of aq. 10% citric acid (15 mL). The EtOH and THF were removed in vacuo and EtOAc (15 mL) was added. The layers were separated and the aqueous layer further washed with EtOAc (15 mL). The organic layers were combined, washed with brine, dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was purified by column chromatography (Grace Biotage, 40 g Si cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) with the fraction eluting at ˜50% EtOAc identified as the desired product. The fractions containing product were combined and concentrated in vacuo to reveal the desired product (202 mg, 83% yield) as a clear oil. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.36-7.19*partially obscured by solvent (m, 5H), 5.16 (brt, J=6.4 Hz, 1H), 4.76 (s, 2H), 4.63-4.47 (m, 1H), 3.86-3.69 (m, 2H), 3.66 (s, 1H), 1.39 (s, 9H). LC-MS (LCMS-A): rt. 5.520, m/z 219.9 [M+H−Boc].sup.+
d) [5-(2-amino-1-phenyl-ethyl)-1,2,4-oxadiazol-3-yl]methanol (A54)
[0844] tert-Butyl N-[2-[3-(hydroxymethyl)-1,2,4-oxadiazol-5-yl]-2-phenyl-ethyl]carbamate (A53) (0.20 g, 0.63 mmol) was dissolved in DCM (3 mL) and TFA (0.3 mL) was added. This was allowed to stir at r.t. for 2 h. Aqueous 1 M NaOH (1 mL) was added and the organic layer was separated, washed with brine (1 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo to give the desired product (0.058 g, 42% yield) as a clear oil. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.41-7.28 (m, 5H), 4.78 (s, 2H), 4.31 (dd, J=7.6, 6.7 Hz, 1H), 3.47 (dd, J=13.1, 7.7 Hz, 1H), 3.33 (dd, J=13.1, 6.7 Hz, 1H), 1.78 (brs, 3H). LCMS-A:: rt 1.419 min; m/z 219.9 [M+H].sup.+.
e) N-(2-(3-(hydroxymethyl)-1,2,4-oxadiazol-5-yl)-2-phenylethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (59)
[0845] To a solution of [5-(2-amino-1-phenyl-ethyl)-1,2,4-oxadiazol-3-yl]methanol (A54) 0.035 g, 0.16 mmol) in EtOH (0.125 mL) was added triethylamine (0.022 mL, 0.16 mmol). This was allowed to stir for 10 min, upon which ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I7) (0.050 g, 0.13 mmol) was added. The mixture was irradiated in a microwave reactor at 120° C. for 1 h. The ethanol was removed and the material taken up in EtOAc (3 mL). This was washed with 1 M HCl (3 mL), brine (3 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The residue was purified by column chromatography (Grace Biotage, 4 g Si cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) with the fraction eluting at ˜80% EtOAc identified as the desired product. The fraction was concentrated in vacuo though not completely pure by .sup.1H NMR analysis. The resulting solid was washed with warm EtOAc (0.25 mL), warm DCM (0.25 mL), then air dried give the product (0.0025 g, 2.8% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d6) δ 12.73 (brs, 1H), 9.31 (brs, 1H), 8.11-7.89 (m, 2H), 7.62-7.21 (m, 6H), 5.68 (t, J=6.2 Hz, 1H), 4.86 (t, J=7.6 Hz, 1H), 4.53 (d, J=6.2 Hz, 2H), 3.90 (dt, J=13.5, 6.7 Hz, 2H). LCMS-A:: rt 5.449 min; m/z 551.9 [M−H].sup.−.
Example 60: N-(2-(2H-1,2,3-triazol-2-yl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (60)
[0846] ##STR00137##
a) 2-[2-(triazol-2-yl)phenyl]acetonitrile (A55)
[0847] To iodophenylacetonitrile (0.57 mL, 4.1 mmol) in DMF (5 mL), under an atmosphere of nitrogen, was added successively, cesium carbonate (60-80 mesh, 2.7 g, 8.2 mmol), copper(I) iodide (0.078 g, 0.41 mmol), triazole (0.48 mL, 8.2 mmol) and dimethylethylenediamine (0.089 mL, 0.82 mmol). The mixture was irradiated in a microwave reactor for 40 min at 100° C. The reaction mixture was cooled and poured into water (75 mL) and extracted with EtOAc (3×75 mL). The organics were combined and washed with brine (200 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was purified by column chromatography (Biotage Isolera, 120 g Si cartridge, 0-50% EtOAc in petroleum benzine 40-60° C.) with the material eluting at ˜25% EtOAc identified as the desired material. The fractions containing the material were combined and concentrated in vacuo to give the product (0.10 g, 13% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.87 (s, 2H), 7.82-7.78 (m, 1H), 7.64-7.59 (m, 1H), 7.46 (pd, J=7.4, 1.7 Hz, 2H), 4.08 (s, 2H).
b) 2-[2-(triazol-2-yl)phenyl]ethanamine (A56)
[0848] To 2-[2-(triazol-2-yl)phenyl]acetonitrile (A55) (0.10 g, 0.54 mmol) in THF (5 mL) was added borane-tetrahydrofuran complex (1.0 M solution in THF, 2.7 mL, 2.7 mmol) dropwise. The solution was heated to reflux and allowed to stir o/n. The reaction mixture was cooled and quenched slowly with water (5 mL). A 50% w/v aq. NaOH solution (2 mL) was added and the mixture was refluxed for 1 h. The reaction was cooled and the organics concentrated in vacuo. The remaining aqueous layer was washed with DCM (5 mL×2). The organics were combined, washed with brine (10 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was loaded onto an SCX cartridge (1 g) and the column was washed with MeOH (10 mL), then a methanolic ammonia solution (10 mL). The methanolic ammonia washings were concentrated in vacuo leaving the product (0.074 g, 72% yield) as a brown oil. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.80 (s, 2H), 7.55-7.48 (m, 1H), 7.40-7.28 (m, 3H), 2.79 (s, 4H).
c) N-(2-(2H-1,2,3-triazol-2-yl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (60)
[0849] To 2-[2-(triazol-2-yl)phenyl]ethanamine (A56) (0.030 g, 0.16 mmol) in EtOH (0.125 mL) was added ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (I7) (0.050 g, 0.13 mmol). This was irradiated in a microwave reactor at 120° C. for 1 h. The reaction mixture was cooled and concentrated to dryness. The residue was taken up in EtOAc (1 mL) and washed with 1 M HCl (1 mL), brine (1 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The residue was taken up in minimal warm EtOH (0.2 mL) and allowed to slowly cool. The resulting solid was collected and air dried to reveal the desired product N-(2-(2H-1,2,3-triazol-2-yl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (0.0070 g, 10% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d6) δ 12.68 (s, 1H), 9.29 (t, J=5.9 Hz, 1H), 8.09 (s, 2H), 8.12-8.03 (m, 2H), 7.60 (d, J=8.6 Hz, 1H), 7.56-7.47 (m, 3H), 7.47-7.40 (m, 1H), 3.47-3.39* partially obscured by solvent (m, 2H), 2.91 (t, J=7.2 Hz, 2H). LCMS-B: rt. 3.319 min; m/z 520.7 [M−H].sup.−.
[0850] General Methods
[0851] Method A:
##STR00138##
[0852] To a solution of the amine (1.2 eq.) in EtOH (0.8 M) was added the ester (1 eq.). This was irradiated in a microwave reactor for 30 min at 100° C. The reaction mixture was cooled and the resulting precipitate filtered, washed with cold EtOH, then air dried to give the desired product. [0853] A-1: Reaction temperature increased to 120° C.; reaction time extended to 1 h [0854] A-2: Reaction temperature increased to 120° C.; reaction time extended to 2 h [0855] A-3: Additional EtOH wash of solid required to remove residual impurities [0856] A-4: Column chromatography of isolated material required
[0857] Method B:
##STR00139##
[0858] To a solution of the amine (1.2 eq.) in EtOH (0.8 M) was added triethylamine (1.2 eq.). After 10 min the ester (1 eq.) was added and the mixture was irradiated in a microwave reactor for 30 min at 100° C. The reaction mixture was cooled and resulting precipitate filtered, washed with cold EtOH, then air dried to reveal the desired product. [0859] B-1: Reaction time extended to 1 h [0860] B-2: Reaction time extended to 1 h; column chromatography of isolated material required [0861] B-3: Precipitated by cooling to 4° C. overnight [0862] B-4: Reaction produced a mixture of two major products, separated by preparatory TLC in 2% MeOH/DCM
[0863] Method C:
[0864] To a solution of the amine (1.2 eq.) in EtOH (0.8 M) was added the ester (1 eq.). This was irradiated in a microwave reactor for 30 min at 100° C. The reaction mixture was cooled and the solvent removed. The material was taken up in EtOAc and washed with 1 M HCl, brine, dried and concentrated in vacuo to reveal the desired product.
[0865] Method D:
[0866] To a solution of the amine (1.2 eq.) in EtOH (0.8 M) was added triethylamine (1.2 eq.). After 10 min the ester (1 eq.) was added and the mixture was irradiated in a microwave reactor for 30 min at 100° C. The reaction mixture was cooled and the solvent removed. The material was taken up in EtOAc and washed with 1 M HCl, brine, dried and concentrated in vacuo to reveal the desired product.
[0867] Method E:
[0868] To a solution of the ester (1 eq.) and amine (1.5 eq.) in EtOH (0.06 M) was added Et.sub.3N (3 eq.) and the mixture heated at 120° C. in a sealed tube for 3 h. The mixture was concentrated under reduced pressure and the residue was recrystallized from MeOH (2 mL) to afford the desired product.
[0869] Method F:
##STR00140##
[0870] To a solution of the acid 155 (1 eq.), HOBt (1.5 eq.), EDCI.HCl (2 eq.) and triethylamine (3 eq.) in THF (0.02 M) was added the amine (1.5 eq.) and the mixture was stirred at r.t. for 16 h. Water (5 mL) was added and the mixture extracted with EtOAc (8 mL×3). The combined organic extracts were dried over Na.sub.2SO.sub.4 and concentrated. The residue was purified by preparative TLC (DCM/MeOH=10:1) to give the desired product.
[0871] Method G:
[0872] A suspension of the ester (1 eq.), amine (1 eq.) and Et.sub.3N (2-4 eq.) in EtOH (0.8 M) was irradiated in the microwave at 150° C. for 30 min. Upon cooling, water (1 mL) and diethyl ether (5 mL) were added and the mixture sonicated for 10 min. The resulting precipitates were collected by filtration and air dried to yield the desired compounds. [0873] G-1: The precipitate was treated with LiOH-hydrate (217 mg) in THF:MeOH:water 10:1:0.5 at room temperature overnight and purified by column chromatography (0-100% EtOAc/hexanes, then 0-40% MeOH in EtOAc). [0874] G-2: Heated at 100° C. for 30 min; precipitated by adding petroleum benzene
TABLE-US-00005 Example Name & Structure LCMS data Method 61
TABLE-US-00006 Example Structure LCMS Method 112
TABLE-US-00007 Example Structure LCMS Method 120
[0875] Method H:
##STR00209##
[0876] To a mixture of N-(2-amino-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide hydrochloride (I41) (0.18 mmol) in DCM (3 mL) was added TEA (3 eq) and the acyl chloride (1.2 eq). The mixture was stirred at r.t. for 3 h under N.sub.2 atmosphere. The mixture was diluted with DCM and washed with water (×2), 1 M HCl, brine, dried over Na.sub.2SO.sub.4 and concentrated to give the crude product which was purified by preparative TLC (DCM/MeOH=20:1) to give the desired product.
[0877] Method I:
##STR00210##
[0878] A solution of 3-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoyl chloride (I37) (0.13 mmol) and TEA (10 eq) in DCM (5 mL) was stirred at 0° C. under N.sub.2 for 10 min. The amine (5 eq) was then added and the mixture was stirred at r.t. for 30 min. Water and 1 M HCl were added and the mixture was extracted with DCM. The organic layer was dried over sodium sulfate, concentrated and the residue was purified by preparative TLC (DCM/MeOH=20:1) to afford the desired product.
[0879] Method J:
##STR00211##
[0880] Methyl 3-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoate (I35; 112) (0.18 mmol) was dissolved in the appropriate amine solution (5 mL) and the mixture was heated at 120° C. for 90 min in the microwave. The solvent was removed and the residue was purified by preparative TLC (DCM/MeOH=20:1) to afford the desired product.
[0881] Method K:
##STR00212##
[0882] A mixture of N-(2-(oxazol-2-yl)-2-phenylethyl)-7-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (A9) (0.1 mmol), R—Br (4 eq), Pd(dppf).sub.2Cl.sub.2 (0.1 eq), K.sub.2CO.sub.3 (4 eq) in dioxane (3 mL) and water (0.5 mL) was stirred under N.sub.2 at 90° C. for 3 h. The mixture was then allowed to cool to r.t. and extracted with EtOAc. The combined organic extracts were washed with brine, dried over sodium sulfate and concentrated to give a residue which was purified by preparative TLC (DCM/MeOH=20:1) to give the desired product.
TABLE-US-00008 Example Name and structure LCMS data .sup.1H NMR data Method 129
[0883] Chiral Separation
[0884] Some of the racemates produced above were separated using chiral columns as described below
TABLE-US-00009 LCMS Racemate Enantiomer SFC Purification Method SFC data data* 46 Enantiomer 1 - Instrument: Waters SFC-80; Column: SFC: rt. rt. 2.749 min; 136 Lux C3 (250*30)mm, 5μ 2.41 min m/z 397.2 [M + H]+ Enantiomer 2 - Mobile Phase: CO2: MeOH (70:30); SFC: rt rt. 2.744 min; 137 Total flow: 60 ml/min 4.04 min m/z 397.2 [M + H]+ Back Pressure: 100 bar; Wave length: 210 nm; Cycle time: 10 min 1 Enantiomer 1 - Instrument: Waters SFC-80; Column: SFC: rt rt. 3.045 min; 138 Lux C3 (250*30)mm, 5μ 3.83 min m/z 475.0 [M + H]+ Enantiomer 2 - Mobile Phase: CO2: MeOH (70:30); SFC: rt rt. 3.044 min; 139 Total flow: 60 ml/min 5.64 min m/z 475.0 [M + H]+ Back Pressure: 100 bar; Wave length: 210 nm; Cycle time: 10 min 48 Enantiomer 1 - Instrument: Waters SFC-80; Column: SFC: rt rt. 2.638 min; 140 YMC Amylose C (250*30)mm, 5μ 3.19 min m/z 412.2 [M + H]+ Enantiomer 2 - Mobile Phase: CO2: MeOH (60:40); SFC: rt rt. 2.6220 min; 141 Total flow: 60 ml/min 4.02 min m/z 412.2 [M + H]+ Back Pressure: 100 bar; Wave length: 210 nm; Cycle time: 10 min 4 Enantiomer 1 - Instrument: Waters SFC-80; Column: SFC: rt n/a 142 Chiralpak ADH (250*20)mm, 5μ 3.88 min Enantiomer 2 - Mobile Phase: CO2: MeOH (60:40); SFC: rt n/a 143 Total flow: 40 mL/min 5.91 min Back Pressure: 100 bar; Wave length: 210 nm; Cycle time: 7 min 36 Enantiomer 1 - Instrument: Waters SFC-80; Column: SFC: rt n/a 144 Chiralpak ADH (250*20)mm, 5μ 4.76 min Enantiomer 2 - Mobile Phase: CO2: MeOH (60:40); SFC: rt n/a 145 Total flow: 40 mL/min 6.17 min Back Pressure: 100 bar; Wave length: 210 nm; Cycle time: 7 min 41 Enantiomer 1 - Instrument: Waters SFC-80; Column: SFC: rt n/a 146 Lux C3 (250*20)mm, 5μ 2.22 min Enantiomer 2 - Mobile Phase: CO2: MeOH (60:40); SFC: rt n/a 147 Total flow: 60 mL/min; 3.62 min Back Pressure: 100 bar; Wave length: 304 nm; Cycle time: 6 min 8 Enantiomer 1 - Instrument: Waters SFC-80; Column: SFC: rt n/a 148 Lux A1 (250*30)mm, 5μ 5.17 min Enantiomer 2 - Mobile Phase: CO2: IPA (60:40); SFC: rt n/a 149 Total flow: 60 mL/min 6.84 min Back Pressure: 100 bar; Wave length: 312 nm; Cycle time: 5 min 94 Enantaiomer 1 - Instrument: Waters SFC-80; Column: SFC: rt n/a 150 YMC Cellulose-SC (250*30)mm, 5μ 3.58 min Mobile Phase: CO2: MeOH (60:40); Total flow: 60 mL/min Back Pressure: 100 bar; Wave length: 304 nm; Cycle time: 6 min 113 Enantiomer 1 - ChiralPak IA, 250 × 4.6 mm with 1:1 rt 15.6 min n/a 151 EtOH: hexane mobile phase. Enantiomer 2 - rt 20.5 min n/a 152 *LC-MS details: Column: ZORBAX Extend C18 (50 × 4.6 mm 5μ); MOBILE PHASE: A: 0.1% HCOOH IN WATER, B: METHANOL; FLOW RATE : 1.5 mL/min
Example 153: 7-(Methylsulfonamido)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (I53)
[0885] ##STR00217##
a) 2-Amino-5-nitrobenzenesulfonamide (A57)
[0886] POCl.sub.3(6.86 mL, 82.2 mmol) was slowly added to a mixture of 2-amino-5-nitrobenzenesulfonic acid (3.00 g, 27.4 mmol) in sulfolane (20 mL) at r.t. and the mixture was heated at 120° C. for 3.5 h. The mixture was allowed to cool to r.t. then slowly poured into conc. NH.sub.4OH (60 mL). The resulting precipitate was collected by filtration, washed with water (100 mL) and dried to give the product (1.90 g, 31% yield) as a yellow solid. LCMS (ES-API): R.sub.t 0.43 min; m/z 218.1 [M+H].sup.+.
b) 2,5-Diaminobenzenesulfonamide (A58)
[0887] To a solution of 2-amino-5-nitrobenzenesulfonamide (A57) (1.9 g, 8.7 mmol) in MeOH (20 mL) was added 10% Pd/C (190 mg) and the mixture was stirred at r.t. under H.sub.2 (1 atm) for 16 h. The mixture was filtered and the filtrate was concentrated to give the product as a brown solid (1.3 g, 79% yield). LCMS (ES-API): R.sub.t 0.342 min; m/z 188.1 [M+H].sup.+.
c) 2-Amino-5-(methylsulfonamido)benzenesulfonamide (A59)
[0888] To a solution of 2,5-diaminobenzenesulfonamide (A58) (1.3 g, 0.69 mmol) in acetonitrile (20 mL) at r.t. was added pyridine (79 mg, 1.03 mmol) and MsCl (795 mg, 0.69 mmol) and the mixture was stirred at r.t. for 15 h. Diethyl ether (10 mL) was added and the resulting precipitate was collected by filtration and washed with diethyl ether (30 mL) to give the product as a yellow solid (1.4 g, 90% yield). LCMS (ES-API): R.sub.t 2.53 min; m/z 266.1 [M+H].sup.+.
d) Ethyl 7-(methylsulfonamido)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (A60)
[0889] To a solution of 2-amino-5-(methylsulfonamido)benzenesulfonamide (A59) (1.3 g, 4.9 mmol) in EtOH (20 mL) was added ethyl 2-ethoxy-2-iminoacetate (1.42 g, 9.8 mmol) and the mixture was heated at 100° C. for 15 h. After cooling to r.t., the precipitate was collected by filtration and washed with diethyl ether (20 mL) to give the product as a white solid (1.2 g, 70% yield). LCMS (ES-API): R.sub.t 0.584 min; m/z 347.8 [M+H].sup.+.
e) 7-(Methylsulfonamido)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (153)
[0890] To a solution of ethyl 7-(methylsulfonamido)-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide (A60) (85 mg, 0.24 mmol) in EtOH (3 mL) was added 2-(oxazol-2-yl)-2-phenylethanamine (I27) (51 mg, 0.27 mmol) and the mixture was heated at 100° C. for 15 h then allowed to cool to r.t. The solvent was removed under reduced pressure and the residue was diluted with water (5 mL) and extracted with EtOAc (8 mL×3). The combined organic extracts were dried over Na.sub.2SO.sub.4 and concentrated. The residue was purified by prep. TLC (DCM/MeOH=10:1) to give the product as a white solid (20 mg, 17% yield). .sup.1H NMR (400 MHz, d.sub.6-DMSO) δ 12.7 (brs, 1H), 10.2 (brs, 1H), 9.26 (t, J=5.8 Hz, 1H), 8.04 (d, J=0.4 Hz, 1H), 7.78 (d, J=8.7 Hz, 1H), 7.58-7.52 (m, 2H), 7.36-7.31 (m, 2H), 7.29-7.26 (m, 3H), 7.20 (d, J=0.4 Hz, 1H), 4.67 (t, J=7.6 Hz, 1H), 4.03-3.95 (m, 1H), 3.92-3.84 (m, 1H), 3.05 (s, 3H). LCMS (ES-API): R.sub.t 2.31 min; m/z 489.8 [M+H].sup.+.
[0891] General Method L
##STR00218##
[0892] To a solution of the ester (x mmol) and amine (x mmol) in EtOH (x mL) was added Et.sub.3N (3 equivalents) and the mixture was heated at 110° C. in a sealed tube overnight. The mixture was concentrated under reduced pressure and the residue was purified by silica gel chromatography (DCM/MeOH=20/1) to give the title compound.
[0893] General Method M
##STR00219##
[0894] To a solution of the acid (x mmol), HATU (x mmol) and DIPEA (x mmol) in DMF (x mL) or MeCN (x mL) was added the amine (x mmol) and the mixture was stirred at RT overnight. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=20/1) to give the title compound.
[0895] General Method N
##STR00220##
[0896] To a suspension of ethyl 4H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide 12 (x mmol) in EtOH (0.125 mL) was added the amine (x mmol) and for some examples triethylamine (x mmol). The mixture was subjected to microwave irradiation at 100° C. for 30 min. Method for isolation of product specified in Table L.
[0897] General Method 0
##STR00221##
[0898] A solution of 3-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-2-phenylpropanoyl chloride (I37) (0.13 mmol) and TEA (10 eq) in DCM (5 mL) was stirred at 0° C. under N.sub.2 for 10 min. The amine (5 eq) was then added and the mixture was stirred at room temperature. for 30 min. Water and 1 M HCl were added and the mixture was extracted with DCM. The organic layer was dried over sodium sulfate, concentrated and the residue was purified by preparative TLC (DCM/MeOH=20:1) to afford the desired product.
[0899] General Method P
##STR00222##
[0900] A mixture of N-(2-(oxazol-2-yl)-2-phenylethyl)-7-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide (A9) (0.1 mmol), R—Br (4 eq), Pd(dppf).sub.2Cl.sub.2 (0.1 eq), K.sub.2CO.sub.3 (4 eq) in 1,4-dioxane (3 mL) and water (0.5 mL) was stirred under N.sub.2 at 90° C. for 3 h. The mixture was then allowed to cool to room temperature and extracted with EtOAc. The combined organic extracts were washed with brine, dried over sodium sulfate and concentrated to give a residue which was purified by preparative TLC (DCM/MeOH=20:1) to give the desired product.
[0901] The following examples were prepared according to the procedures described in general methods L-P using the specified quantities of reagents.
TABLE-US-00010 TABLE L Example Name and structure Analytical data Method Notes 157
Example 208: 7-(1-Aminoethyl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 208
[0902] ##STR00277##
a) N-(2-(Oxazol-2-yl)-2-phenylethyl)-7-((trimethylsilyl)ethynyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide A27
[0903] To a mixture of 7-iodo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 41 (880 mg, 1.7 mmol), Pd(PPh.sub.3).sub.2Cl.sub.2(120 mg, 0.17 mmol) and CuI (32 mg, 0.17 mmol) in Et.sub.3N (10 mL) and DMF (10 mL) under N.sub.2 was added ethynyltrimethylsilane (700 mg, 6.8 mmol) and the mixture was stirred at RT under N.sub.2 overnight. The mixture was concentrated under reduced pressure and the residue was dissolved in EtOAc (200 mL), washed with water (100 mL×3), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (1.3 g, >100%) as a brown solid, which was used directly in the next step. LCMS-D: R.sub.t 3.19 min, m/z 493.1 [M+H].sup.+.
b) 7-Ethynyl-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 42
[0904] To a solution of N-(2-(oxazol-2-yl)-2-phenylethyl)-7-((trimethylsilyl)ethynyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide A27 (1.2 g, 2.4 mmol) in THF (20 mL) and MeOH (20 mL) was added a 1 M aqueous KOH solution (12.0 mL, 12.0 mmol) and the mixture was stirred at RT for 45 min. Dowex 50WX8 H.sup.+ form (50 g) was added and stirring was continued for 30 min. The mixture was filtered and the filtrate was concentrated under reduced pressure. The residue was diluted with EtOAc (100 mL) and concentrated under reduced pressure to give the title compound (800 mg, 80%) as a brown solid. LCMS-D: R.sub.t 2.64 min, m/z 421.1 [M+H].sup.+.
c) 7-Acetyl-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 43
[0905] A suspension of AgSbF.sub.6 (69 mg, 0.2 mmol) and chloro[1,3-bis(2,6-diisopropylphenyl)imidazol-2-ylidene]gold(I) (124 mg, 0.2 mmol) in MeOH (12 mL) was stirred at RT for 2 min. 7-Ethynyl-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboximide 1,1-dioxide 42 (420 mg, 1.0 mmol) and water (6 mL) were then added and the mixture was heated at 65° C. overnight. The resulting precipitate was collected by filtration and dried to give the title compound (400 mg, 90%) as a brown solid, which was used in the next step without further purification. LCMS-D: R.sub.t 1.77 min, m/z 439.1 [M+H].sup.+.
d) 7-(1-Aminoethyl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 208
[0906] To a solution of 7-acetyl-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 43 (219 mg, 0.5 mmol) in MeOH (5 mL) was added NH.sub.4OAc (385 mg, 5 mmol) and NaCNBH.sub.3 (32 mg, 0.5 mmol) and the mixture was heated at reflux for 18 h. The mixture was diluted with water, extracted with EtOAc (100 mL) and the organic layer was concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=10/1) to give the title compound (50 mg, 25%) as a yellow solid. LCMS-D: R.sub.t 1.89 min, m/z 440.1 [M+H].sup.+. .sup.1H NMR (400 MHz, Methanol-d.sub.4) δ 7.93 (s, 1H), 7.85 (s, 1H), 7.72-7.65 (m, 1H), 7.57 (d, J=8.9 Hz, 1H), 7.36-7.24 (m, 5H), 7.17 (s, 1H), 4.65-4.61 (m, 1H), 4.54 (q, J=6.7 Hz, 1H), 4.11-4.03 (m, 1H), 4.01-3.92 (m, 1H), 1.63 (d, J=6.9 Hz, 3H).
Example 209: 7-(1-(Methylamino)ethyl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 209
[0907] ##STR00278##
[0908] To a solution of 7-acetyl-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 43 (44 mg, 0.1 mmol) in MeOH (5 mL) was added CH.sub.3NH.sub.2(2 M solution in THF, 0.5 mL, 1.0 mmol) and NaBH.sub.3CN (6.3 mg, 0.1 mmol). The flask was sealed and the mixture was heated at 66° C. overnight. The mixture was diluted with water, extracted with EtOAc and the organic extract was concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=10/1) to give the title compound (10 mg, 20%) as a yellow solid. LCMS-D: R.sub.t 2.09 min, m/z 454.2 [M+H].sup.+. .sup.1H NMR (400 MHz, Methanol-d.sub.4) δ 8.02 (s, 1H), 7.86 (s, 1H), 7.85-7.80 (m, 1H), 7.73-7.67 (m, 1H), 7.37-7.25 (m, 5H), 7.17 (s, 1H), 4.66-4.58 (m, 1H), 4.46 (q, J=6.8 Hz, 1H), 4.12-4.04 (m, 1H), 4.02-3.93 (m, 1H), 2.60 (s, 3H), 1.69 (d, J=6.9 Hz, 3H).
Example 210: 7-(1-(Methylsulfonamido)ethyl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 210
[0909] ##STR00279##
[0910] To a solution of 7-(1-aminoethyl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 208 (44 mg, 0.1 mmol) in pyridine (5 mL) at 0° C. was added MsCl (51 mg, 0.5 mmol) and the mixture was stirred at RT overnight. The mixture was diluted with 1 M aqueous HCl (20 mL), extracted with EtOAc (100 mL) and the organic extract was washed with water (50 mL×3) and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=10/1) to give the title compound (20 mg, 40%) as a yellow solid. LCMS-D: R.sub.t 2.18 min, m/z 518.1 [M+H].sup.+. .sup.1H NMR (400 MHz, Methanol-d.sub.4) δ 7.92 (d, J=2.0 Hz, 1H), 7.85 (d, J=0.9 Hz, 1H), 7.73 (dd, J=8.7, 2.0 Hz, 1H), 7.59 (d, J=8.7 Hz, 1H), 7.36-7.24 (m, 5H), 7.17 (d, J=0.9 Hz, 1H), 4.70 (q, J=7.0 Hz, 1H), 4.62 (t, 7.6 Hz, 1H), 4.12-4.03 (m, 1H), 4.01-3.94 (m, 1H), 2.78 (s, 3H), 1.52 (d, J=7.0 Hz, 3H).
Example 211: 7-(1-Acetamidoethyl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 211
[0911] ##STR00280##
[0912] To a solution of 7-(1-aminoethyl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 208 (44 mg, 0.1 mmol) in pyridine (5 mL) at 0° C. was added acetyl chloride (78 mg, 1.0 mmol) and the mixture was stirred at RT overnight. The mixture was diluted with 1 M aqueous HCl (20 mL), extracted with EtOAc (100 mL) and the organic extract was washed with water (50 mL×3) and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=10/1) to give the title compound (10 mg, 20%) as a white solid. LCMS-D: R.sub.t 2.29 min, m/z 482.0 [M+H].sup.+. .sup.1H NMR (400 MHz, Methanol-d.sub.4) δ 7.86 (s, 1H), 7.81 (d, J=2.0 Hz, 1H), 7.66 (dd, J=8.6, 2.0 Hz, 1H), 7.56 (d, J=8.6 Hz, 1H), 7.31 (s, 5H), 7.17 (d, J=0.8 Hz, 1H), 5.05 (q, J=7.0 Hz, 1H), 4.62 (t, J=7.6 Hz, 1H), 4.11-4.03 (m, 1H), 4.01-3.93 (m, 1H), 1.98 (s, 3H), 1.46 (d, J=7.0 Hz, 3H).
Example 212: 7-(1-Hydroxyethyl)-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 212
[0913] ##STR00281##
[0914] To a solution of 7-acetyl-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 43 (44 mg, 0.1 mmol) in MeOH (5 mL) was added NaBH.sub.4 (4.5 mg, 0.12 mmol) and the mixture was stirred at RT under N.sub.2 for 1 h. The mixture was diluted with water, extracted with EtOAc and the organic extract was concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=10/1) to give the title compound (10 mg, 20%) as a yellow solid. LCMS-D: R.sub.t 2.4 min, m/z 441.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.6 (s, 1H), 9.26 (t, J=6.0 Hz, 1H), 8.04 (d, J=0.9 Hz, 1H), 7.78 (d, J=1.8 Hz, 1H), 7.76-7.72 (m, 1H), 7.69-7.64 (m, 1H), 7.37-7.31 (m, 2H), 7.30-7.24 (m, 3H), 7.20 (d, J=0.9 Hz, 1H), 5.44 (d, J=4.4 Hz, 1H), 4.84-4.77 (m, 1H), 4.68 (t, J=7.5 Hz, 1H), 4.05-3.96 (m, 1H), 3.92-3.84 (m, 1H), 1.33 (d, J=6.4 Hz, 3H).
Example 213: N-(2-(Oxazol-2-yl)-2-phenylethyl)-7-(1H-1,2,3-triazol-4-yl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 213
[0915] ##STR00282##
[0916] To a solution of 7-ethynyl-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 42 (52 mg, 0.12 mmol) in DMF (1 mL) and EtOH (0.25 mL) was added CuI (5 mg, 24 μmol) and azidotrimethylsilane (18 mg, 0.15 mmol) and the mixture was stirred at 120° C. for 18 h in a sealed tube. The mixture was treated with 1 M aqueous HCl (1 mL), diluted with EtOAc (100 mL) and washed with water (50 mL×3). The organic layer was concentrated under reduced pressure and the residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (20 mg, 40%) as a yellow solid. LCMS-D: R.sub.t 2.4 min, m/z 464.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 15.5-15.2 (m, 1H), 12.7 (s, 1H), 9.28 (t, J=6.0 Hz, 1H), 8.81-8.38 (m, 1H), 8.29 (s, 1H), 8.22 (d, J=8.4 Hz, 1H), 8.05 (s, 1H), 7.88 (d, J=8.7 Hz, 1H), 7.39-7.31 (m, 2H), 7.31-7.24 (m, 3H), 7.21 (s, 1H), 4.68 (t, J=7.5 Hz, 1H), 4.07-3.97 (m, 1H), 3.95-3.84 (m, 1H).
Example 214: 7-Bromo-N-(2-(3-hydroxyphenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 214
[0917] ##STR00283##
[0918] To a solution of 7-bromo-N-(2-(3-methoxyphenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 188 (101 mg, 0.2 mmol) in DCM (4 mL) at 0° C. was added BBr.sub.3 (1 M solution in DCM, 0.4 mL, 0.4 mmol) and the mixture was stirred overnight. The mixture was diluted with DCM (50 mL), washed with a saturated aqueous NaHCO.sub.3 solution and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (10 mg, 10%) as a yellow solid. LCMS-D: R.sub.t 2.41 min, m/z 490.8 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.8 (s, 1H), 9.44 (s, 1H), 9.27 (t, J=5.9 Hz, 1H), 8.04 (d, J=0.9 Hz, 1H), 8.00 (d, J=2.2 Hz, 1H), 7.93 (dd, J=8.9, 2.2 Hz, 1H), 7.75 (d, J=8.9 Hz, 1H), 7.19 (d, J=0.9 Hz, 1H), 7.15-7.08 (m, 1H), 6.71-6.62 (m, 3H), 4.57 (t, J=7.5 Hz, 1H), 4.02-3.93 (m, 1H), 3.86-3.77 (m, 1H).
Example 215: N-(2-(3-Hydroxyphenyl)-2-(oxazol-2-yl)ethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 215
[0919] ##STR00284##
[0920] To a solution of 7-iodo-N-(2-(3-methoxyphenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 187 (110 mg, 0.2 mmol) in DCM (10 mL) at 0° C. was added BBr.sub.3 (1 M solution in DCM, 0.4 mL, 0.4 mmol) and the mixture was stirred overnight. The mixture was diluted with DCM (100 mL), washed with a saturated aqueous NaHCO.sub.3 solution (50 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (20 mg, 20%) as a white solid. LCMS-D: R.sub.t 2.44 min, m/z 538.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.7 (s, 1H), 9.45 (s, 1H), 9.21 (s, 1H), 8.09-8.01 (m, 3H), 7.55 (d, J=8.8 Hz, 1H), 7.19 (s, 1H), 7.15-7.07 (m, 1H), 6.72-6.61 (m, 3H), 4.56 (t, J=7.5 Hz, 1H), 4.01-3.92 (m, 1H), 3.85-3.76 (m, 1H).
Example 216: 7-Chloro-N-(2-(3-hydroxyphenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 216
[0921] ##STR00285##
[0922] To a solution of 7-chloro-N-(2-(3-methoxyphenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 176 (60 mg, 0.13 mmol) in DCM (10 mL) at 0° C. was added BBr.sub.3 (1 M solution in DCM, 0.4 mL, 0.4 mmol) and the reaction was stirred overnight. The mixture was diluted with DCM (100 mL), washed with water (×3), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was rinsed with MeOH (2 mL) and dried to give the title compound (25 mg, 40%) as a grey solid. LCMS-C: R.sub.t 2.30 min, m/z 446.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.8 (s, 1H), 9.45 (s, 1H), 9.29 (t, J=5.9 Hz, 1H), 8.04 (s, 1H), 7.92 (s, 1H), 7.87-7.78 (m, 2H), 7.20 (s, 1H), 7.11 (t, J=7.7 Hz, 1H), 6.72-6.62 (m, 3H), 4.57 (t, J=7.5 Hz, 1H), 4.03-3.92 (m, 1H), 3.88-3.75 (m, 1H).
Example 217: N-(2-(3-(Cyclopropylmethoxy)phenyl)-2-(oxazol-2-yl)ethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 217
[0923] ##STR00286##
[0924] To a solution of N-(2-(3-hydroxyphenyl)-2-(oxazol-2-yl)ethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 215 (160 mg, 0.3 mmol) in CH.sub.3CN (15 mL) was added Ag.sub.2O (348 mg, 1.5 mmol) and (bromomethyl)cyclopropane (400 mg, 3.0 mmol) and the mixture was stirred at RT under N.sub.2 overnight. The mixture was diluted with DCM (100 mL), washed with water, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (20 mg, 10%) as a yellow solid. LCMS-D: R.sub.t 2.39 min, m/z 592.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.7 (s, 1H), 9.26 (t, J=6.0 Hz, 1H), 8.11-8.01 (m, 3H), 7.58 (d, J=8.7 Hz, 1H), 7.25-7.18 (m, 2H), 6.83-6.76 (m, 3H), 4.61 (t, J=7.5 Hz, 1H), 4.00-3.92 (m, 1H), 3.91-3.82 (m, 1H), 3.80-3.69 (m, 2H), 0.86-0.80 (m, 1H), 0.54-0.48 (m, 2H), 0.29-0.23 (m, 2H).
Example 218: N-(2-(2-Cyanophenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 218
[0925] ##STR00287##
[0926] To a solution of N-(2-(2-iodophenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 174 (52 mg, 0.1 mmol) in DMF (2 mL) was added Zn(CN).sub.2 (24 mg, 0.2 mL) and Pd(PPh.sub.3).sub.4 (12 mg, 0.01 mmol) and the mixture was bubbled with N.sub.2 for 10 min. The flask was then sealed and the mixture was heated at 130° C. overnight. The mixture was diluted with EtOAc (50 mL), washed with water (50 mL×3) and the organic layer was concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=40/1) to give the title compound (20 mg, 50%) as a white solid. LCMS-C: R.sub.t 1.18 min, m/z 422.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.7 (s, 1H), 9.48 (t, J=6.0 Hz, 1H), 8.09 (d, J=0.9 Hz, 1H), 7.89-7.78 (m, 3H), 7.77-7.67 (m, 2H), 7.60-7.46 (m, 3H), 7.23 (s, 1H), 5.02 (t, J=7.6 Hz, 1H), 4.21-4.10 (m, 1H), 4.03-3.92 (m, 1H).
Example 219: Methyl 2-(2-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)-1-(oxazol-2-yl)ethyl)benzoate 219
[0927] ##STR00288##
[0928] To a solution of N-(2-(2-iodophenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 174 (208 mg, 0.4 mmol) in MeOH (40 mL) in a high-pressure reaction vessel was added Et.sub.3N (120 mg, 1.2 mL) and Pd(dppf)Cl.sub.2 (32 mg, 0.04 mmol). The mixture was then heated at 100° C. under a CO atmosphere (0.2 MPa) overnight. The mixture was diluted with water, extracted with EtOAc and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (55 mg, 32%) as a white solid. LCMS-C: R.sub.t 1.77 min, m/z 455.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.6 (s, 1H), 9.21 (t, J=6.0 Hz, 1H), 8.03 (s, 1H), 7.84 (d, J=7.6 Hz, 1H), 7.81-7.75 (m, 2H), 7.75-7.68 (m, 1H), 7.59-7.48 (m, 2H), 7.44-7.38 (m, 1H), 7.33 (dd, J=7.9, 1.2 Hz, 1H), 7.21 (s, 1H), 5.49 (t, J=7.3 Hz, 1H), 4.11-4.01 (m, 1H), 3.91-3.81 (m, 1H), 3.80 (s, 3H).
Example 220: 7-Iodo-N-(4-methoxy-2-phenylbutyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 220
[0929] ##STR00289##
a) tert-Butyl 3-cyano-3-phenylpropanoate A61
[0930] To a solution of 2-phenylacetonitrile (2.34 g, 20 mmol) in dry THF (60 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 24 mL, 24 mmol) dropwise. The mixture was stirred at −78° C. for 45 min then added to a solution of tert-butyl 2-bromoacetate (4.68 g, 24 mmol) in dry THF (60 mL) at −78° C. under N.sub.2 and the mixture was stirred at −78° C. overnight. The mixture was diluted with water, extracted with EtOAc (300 mL) and the organic layer was washed with water, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=20/1) to give the title compound (3.8 g, 80%) as a white solid. LCMS-C: R.sub.t 2.30 min, m/z 232.0 [M+H].sup.+.
b) 4-Amino-3-phenylbutan-1-ol A62
[0931] To a solution of tert-butyl 3-cyano-3-phenylpropanoate A61 (231 mg, 1 mmol) in THF (10 mL) was added LiAlH.sub.4 (1 M solution in THF, 2.0 mL, 2.0 mmol) and the mixture was stirred at RT for 2 h. The mixture was diluted with water, extracted with EtOAc (100 mL) and the organic layer was washed with water, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (115 mg, 60%) as a yellow oil. LCMS-A (ES-API): R.sub.t 0.322 min, m/z 166.1 [M+H].sup.+.
c) N-(4-Hydroxy-2-phenylbutyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide A63
[0932] A suspension of 4-amino-3-phenylbutan-1-ol A62 (115 mg, 0.7 mmol), ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I7 (266 mg, 0.7 mmol) and Et.sub.3N (200 mg, 2 mmol) in EtOH (9 mL) was heated at 110° C. in a sealed tube overnight. The mixture was concentrated under reduced pressure and the residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (75 mg, 20%) as a yellow solid. LCMS-C: R.sub.t 1.97 min, m/z 499.9 [M+H].sup.+.
d) 7-Iodo-N-(4-methoxy-2-phenylbutyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 220
[0933] To a solution of N-(4-hydroxy-2-phenylbutyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide A63 (75 mg, 0.15 mmol) in CH.sub.3CN (10 mL) was added Ag.sub.2O (174 mg, 0.75 mmol) and iodomethane (213 mg, 1.5 mmol) and the mixture was stirred at RT under N.sub.2 overnight. The mixture was concentrated under reduced pressure and the residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (45 mg, 60%) as a white solid. LCMS-C: R.sub.t 2.27 min, m/z 513.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.7 (s, 1H), 9.20 (t, J=6.0 Hz, 1H), 8.10-8.03 (m, 2H), 7.59 (d, J=8.7 Hz, 1H), 7.34-7.27 (m, 2H), 7.26-7.18 (m, 3H), 3.46 (t, J=6.8 Hz, 2H), 3.20-3.15 (m, 1H), 3.14 (s, 3H), 3.12-3.05 (m, 2H), 2.02-1.90 (m, 1H), 1.79-1.66 (m, 1H).
Example 221: 7-Chloro-N-(2-(3-hydroxy-5-methylphenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 221
[0934] ##STR00290##
[0935] To a solution of 7-chloro-N-(2-(3-methoxy-5-methylphenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 159 (50 mg, 0.11 mmol) in DCM (5 mL) was added BBr.sub.3 (1 M solution in DCM, 0.33 mL, 0.33 mmol) and the mixture was stirred at RT overnight. The mixture was diluted with water, extracted with diethyl ether and the combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. HPLC to give the title compound (7 mg, 15%) as a white solid. LCMS-C: R.sub.t 1.97 min; m/z 460.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.8 (s, 1H), 9.32 (s, 1H), 9.24 (t, J=5.9 Hz, 1H), 8.03 (s, 1H), 7.91 (d, J=1.9 Hz, 1H), 7.84-7.77 (m, 2H), 7.19 (s, 1H), 6.50 (s, 1H), 6.49-6.44 (m, 2H), 4.51 (t, J=7.5 Hz, 1H), 4.01-3.92 (m, 1H), 3.83-3.74 (m, 1H), 2.17 (s, 3H).
Example 222: N-(2-(3-Hydroxy-5-methylphenyl)-2-(oxazol-2-yl)ethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 222
[0936] ##STR00291##
[0937] To a solution of 7-iodo-N-(2-(3-methoxy-5-methylphenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 196 (50 mg, 0.09 mmol) in DCM (5 mL) was added BBr.sub.3 (1 M solution in DCM, 0.27 mL, 0.27 mmol) and the mixture was stirred at RT overnight. The mixture was diluted with water, extracted with EtOAc and the combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. HPLC to give the title compound (1 mg, 3%) as a white solid. LCMS-C: R.sub.t 2.07 min; m/z 552.9 [M+H].sup.+. .sup.1H NMR (400 MHz, Methanol-d.sub.4) δ 8.13 (d, J=2.0 Hz, 1H), 7.96 (dd, J=8.7, 2.0 Hz, 1H), 7.86 (d, J=0.9 Hz, 1H), 7.35 (d, J=8.7 Hz, 1H), 7.17 (d, J=0.9 Hz, 1H), 6.61-6.59 (m, 1H), 6.53 (dd, J=10.2, 2.0 Hz, 2H), 4.51-4.46 (m, 1H), 4.07-3.99 (m, 1H), 3.96-3.89 (m, 1H), 2.24 (s, 3H).
Examples 223 and 224: N-(2-(3-Chlorophenyl)-2-(oxazol-2-yl)ethyl)-7-methoxy-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 223 and N-(2-(3-chlorophenyl)-2-(oxazol-2-yl)ethyl)-7-hydroxy-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 224
[0938] ##STR00292##
a) 7-Methoxy-2H-benzo[e][1,2,4]thiadiazin-3(4H)-one 1,1-dioxide A64
[0939] To a solution of sulfurisocyanatidic chloride (1.38 g, 9.76 mmol) in nitroethane (8 mL) at −40° C. was added a solution of 4-methoxyaniline (1.0 g, 8.13 mmol) in nitroethane (2 mL) dropwise and the mixture was stirred for 5 min. AlCl.sub.3 (1.08 g, 8.13 mmol) was then added and the mixture was quickly heated to 110° C. and maintained at that temperature for 20 min. The mixture was then poured onto ice and the resulting precipitate was collected by filtration, washed with water and dried under reduced pressure to give the title compound (1.1 g, 60%) as a red solid. LCMS-C: R.sub.t 0.32 min; m/z 228.9 [M+H].sup.+.
b) 2-Amino-5-methoxybenzenesulfonamide A65
[0940] A mixture of 7-methoxy-2H-benzo[e][1,2,4]thiadiazin-3(4H)-one 1,1-dioxide A64 (600 mg, 2.63 mmol) and 50% (v/v) aqueous H.sub.2SO.sub.4 (20 mL) was heated at 130° C. until a homogeneous solution formed. The mixture was poured onto ice, neutralised and extracted with EtOAc. The organic extract was concentrated under reduced pressure to give the title compound (432 mg, 64%) as a red solid. LCMS-C: R.sub.t 0.29 min; m/z 203.0 [M+H].sup.+.
c) Ethyl 7-methoxy-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide A66
[0941] A mixture of 2-amino-5-methoxybenzenesulfonamide A65 (432 mg, 2.14 mmol) and ethyl carbonocyanidate (2.12 g, 21.4 mmol) in AcOH (20 mL)/conc. aqueous HCl (0.5 mL) was heated at 85° C. for 4 h. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (150 mg, 23%) as a white solid. LCMS-C: R.sub.t 0.51 min; m/z 284.9 [M+H].sup.+.
d) N-(2-(3-Chlorophenyl)-2-(oxazol-2-yl)ethyl)-7-methoxy-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 223
[0942] A mixture of ethyl 7-methoxy-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide A66 (50 mg, 0.18 mmol), 2-(3-chlorophenyl)-2-(oxazol-2-yl)ethanamine I128 (49 mg, 0.22 mmol) and Et.sub.3N (55 mg, 0.54 mmol) in MeOH (3 mL) was heated at 110° C. in a sealed tube for 3 h. The mixture was allowed to cool to RT, diluted with water and extracted with EtOAc. The combined organic extracts were washed with brine, dried over
[0943] Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (5.3 mg, 6%) as a white solid. LCMS-C: R.sub.t 2.22 min; m/z 460.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.6 (s, 1H), 9.27 (t, J=6.1 Hz, 1H), 8.07 (d, J=0.9 Hz, 1H), 7.76 (d, J=9.1 Hz, 1H), 7.40-7.31 (m, 4H), 7.28-7.21 (m, 3H), 4.69 (t, J=7.5 Hz, 1H), 4.05-3.86 (m, 2H), 3.85 (s, 3H).
e) N-(2-(3-Chlorophenyl)-2-(oxazol-2-yl)ethyl)-7-hydroxy-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 224
[0944] To a solution of N-(2-(3-chlorophenyl)-2-(oxazol-2-yl)ethyl)-7-methoxy-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 223 (15 mg, 0.03 mmol) in DCM (5 mL) was added BBr.sub.3 (1 M solution in DCM, 1.5 mL, 1.5 mmol) and the mixture was stirred at RT for 48 h. The mixture was diluted with water (5 mL), extracted with EtOAc and the combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (3.1 mg, 23%) as a white solid. LCMS-C: R.sub.t 1.98 min; m/z 446.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.5 (s, 1H), 10.4 (s, 1H), 9.25 (t, J=6.2 Hz, 1H), 8.07 (s, 1H), 7.67 (d, J=9.0 Hz, 1H), 7.42-7.32 (m, 3H), 7.29-7.20 (m, 2H), 7.19-7.12 (m, 1H), 7.08 (d, J=2.7 Hz, 1H), 4.69 (t, J=7.5 Hz, 1H), 4.03-3.84 (m, 2H).
Examples 225 and 226: 7-Chloro-N-(3-methoxy-2-phenylpropyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 225 and 7-chloro-N-(3-methoxy-2-phenylpropyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 226
[0945] ##STR00293##
a) 3-((tert-Butyldimethylsilyl)oxy)-2-phenylpropan-1-amine A67
[0946] A solution of 2-(3-((tert-butyldimethylsilyl)oxy)-2-phenylpropyl)isoindoline-1,3-dione I153 (1.0 g, 2.53 mmol) and hydrazine monohydrate (380 mg, 7.58 mmol) in EtOH (50 mL) was heated at 80° C. under N.sub.2 for 3 h. The mixture was filtered and the filter cake was washed with EtOH. The filtrate was concentrated under reduced pressure to give the title compound (0.57 g, 85%) as a yellow oil. LCMS-C: R.sub.t 2.85 min; m/z 265.8 [M+H].sup.+.
b) N-(3-((tert-Butyldimethylsilyl)oxy)-2-phenylpropyl)-7-chloro-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide A68
[0947] A solution of 3-((tert-butyldimethylsilyl)oxy)-2-phenylpropan-1-amine A67 (200 mg, 0.75 mmol), ethyl 7-chloro-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I162 (261 mg, 0.90 mmol) and Et.sub.3N (228 mg, 2.25 mmol) in ethanol (15 mL) was heated at 110° C. in a sealed tube for 24 h. The mixture was allowed to cool to RT, diluted with water and extracted with EtOAc. The organic extract was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=20/1) to give the title compound (403 mg, >100%) as white solid, which was used in the next step without further purification. LCMS-C: R.sub.t 2.74 min; m/z 508.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.8 (s, 1H), 9.14 (s, 1H), 7.89 (s, 1H), 7.86-7.75 (m, 2H), 7.36-7.18 (m, 5H), 3.82-3.69 (m, 2H), 3.69-3.53 (m, 2H), 3.25-3.15 (m, 1H), 0.80 (s, 9H), −0.07 (s, 3H), −0.08 (s, 3H).
c) 7-Chloro-N-(3-hydroxy-2-phenylpropyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 225
[0948] A mixture of N-(3-((tert-butyldimethylsilyl)oxy)-2-phenylpropyl)-7-chloro-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide A68 (383.6 mg, 0.755 mmol) and TBAF (1 M solution in THF, 3.78 mL, 3.78 mmol) in THF (15 mL) was stirred at RT overnight. The mixture was diluted with water, extracted with EtOAc and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=20/1) to give the title compound (140 mg, 47%) as a white solid. LCMS-C: R.sub.t 1.71 min; m/z 393.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.8 (s, 1H), 9.15 (t, J=6.0 Hz, 1H), 7.91 (d, J=2.1 Hz, 1H), 7.87-7.77 (m, 2H), 7.34-7.17 (m, 5H), 4.81 (br s, 1H), 3.68-3.55 (m, 4H), 3.19-3.08 (m, 1H).
d) 7-Chloro-N-(3-methoxy-2-phenylpropyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 226
[0949] A mixture of 7-chloro-N-(3-hydroxy-2-phenylpropyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 225 (90.0 mg, 0.23 mmol), Ag.sub.2O (266 mg, 1.15 mmol) and iodomethane (326 mg, 2.3 mmol) in CH.sub.3CN (10 mL) was stirred at RT for 4 days. The mixture was diluted with water, extracted with EtOAc and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=20/1) to give the title compound (8 mg, 9%) as a white solid. LCMS-C: R.sub.t 2.20 min; m/z 407.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.8 (s, 1H), 9.14 (s, 1H), 7.89 (s, 1H), 7.79 (s, 2H), 7.42-7.13 (m, 5H), 3.67-3.46 (m, 4H), 3.30-3.26 (m, 1H), 3.23 (s, 3H).
Example 227: N-(2-(3-Cyanophenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 227
[0950] ##STR00294##
[0951] To a solution of N-(2-(3-iodophenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 160 (52 mg, 0.1 mmol) in DMF (2 mL) was added Pd(PPh.sub.3).sub.4 (12 mg, 0.01 mmol) and Zn(CN).sub.2 (24 mg, 0.2 mmol) and the mixture was heated at 120° C. overnight. The mixture was diluted with water, extracted with EtOAc and the combined organic extracts were concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (20 mg, 47%) as a white solid. LCMS-C: R.sub.t 1.28 min; m/z 421.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.26 (br s, 1H), 7.99-7.75 (m, 3H), 7.75-7.53 (m, 4H), 7.53-7.40 (m, 2H), 7.29-7.21 (m, 1H), 4.82-4.59 (m, 1H), 4.31-3.78 (m, 2H).
Example 228: N-(2-(2-Hydroxyphenyl)-2-(oxazol-2-yl)ethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 228
[0952] ##STR00295##
[0953] To a solution of 7-iodo-N-(2-(2-methoxyphenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 184 (50 mg, 0.09 mmol) in DCM (5 mL) at 0° C. was added BBr.sub.3 (1 M solution in DCM, 0.27 mL, 0.27 mmol) and the mixture was stirred at RT overnight. The reaction was quenched with brine (10 mL) and the mixture was diluted with water (20 mL) and extracted with DCM containing a small amount of MeOH (30 mL×3). The combined organic extracts were washed with brine (30 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (13 mg, 27%) as a white solid. LCMS-C: R.sub.t 2.04 min; m/z 538.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.7 (s, 1H), 9.66 (s, 1H), 9.20 (t, J=5.9 Hz, 1H), 8.11-8.03 (m, 2H), 7.99 (d, J=0.9 Hz, 1H), 7.58 (d, J=8.7 Hz, 1H), 7.17 (d, J=0.8 Hz, 1H), 7.11-7.00 (m, 2H), 6.82 (dd, J=8.1, 1.2 Hz, 1H), 6.78-6.71 (m, 1H), 4.95 (t, J=7.4 Hz, 1H), 4.07-3.96 (m, 1H), 3.84-3.74 (m, 1H).
Example 155: 2-(2-(7-Iodo-1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)ethyl)benzoic Acid 155
[0954] ##STR00296##
a) (2-(2-Aminoethyl)phenyl)methanol A69
[0955] To a solution of methyl 2-(cyanomethyl)benzoate (3.0 g, 17.1 mmol) in THF (50 mL) was added BH.sub.3.THF (1 M solution in THF, 51.0 mL, 51.0 mmol) and the mixture was heated at 70° C. under N.sub.2 overnight. The mixture was adjusted to pH 5 with 1 M aqueous HCl, diluted with water (20 mL) and washed with EtOAc (30 mL×3). The aqueous phase was adjusted to pH 9 with 1 M aqueous NaOH and extracted with EtOAc (30 mL×3). The combined organic extracts were concentrated under reduced pressure to give the title compound (1.5 g, 57%) as a yellow oil. LCMS-C: R.sub.t 0.39; m/z 152.1 [M+H].sup.+.
b) N-(2-(Hydroxymethyl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 109
[0956] The following procedure was performed three times: A solution of (2-(2-aminoethyl)phenyl)methanol A69 (300 mg, 1.98 mmol), ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I7 (753 mg, 1.98 mmol) and Et.sub.3N (600 mg, 7.84 mmol) in ethanol (10 mL) was heated at 150° C. in a sealed tube for 3 h. The mixture was allowed to cool to RT and concentrated under reduced pressure. The crude product of the three reactions were combined and purified by silica gel chromatography (DCM/MeOH=100/1 to 20/1) to give the title compound (520 mg, 18%) as a white solid. LCMS-D: R.sub.t 0.34 min; m/z 486.1 [M+H].sup.+.
c) 2-(2-(7-Iodo-1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)ethyl)benzoic Acid 155
[0957] To a solution of N-(2-(hydroxymethyl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 109 (200 mg, 0.4 mmol) in acetone (10 mL) was added Jones reagent (10 mL) and the mixture was heated at 40° C. overnight. The mixture was concentrated under reduced pressure and the residue was diluted with water. The solids were collected by filtration and washed with diethyl ether to give the title compound (115 mg, 55%) as a white solid. LCMS-D: R.sub.t 2.64 min; m/z 522.0 [M+Na].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.8 (br s, 1H), 9.43-9.17 (m, 1H), 8.19-7.97 (m, 2H), 7.84 (t, J=8.1 Hz, 1H), 7.69-7.17 (m, 4H), 3.60-3.48 (m, 2H), 3.26-3.19 (m, 2H).
Example 230: N-(2-Carbamoylphenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 230
[0958] ##STR00297##
[0959] To a solution of 2-(2-(7-iodo-1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)ethyl)benzoic acid 155 (50 mg, 0.1 mmol), EDCI (23 mg, 0.12 mmol), DIPEA (39 mg, 0.3 mmol) and HOBt (16 mg, 0.12 mmol) in 1,4-dioxane (5 mL) was added NH.sub.4Cl (11 mg, 0.2 mmol) and the mixture was stirred at RT overnight. The mixture was diluted with water (15 mL), adjusted to pH 5 with 1 M aqueous HCl and extracted with EtOAc (50 mL×3). The combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=20/1) to give the title compound (3 mg, 6%) as a grey solid. LCMS-D: R.sub.t 2.11 min; m/z 499.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.6 (br s, 1H), 9.34 (br s, 1H), 8.08-7.98 (m, 2H), 7.79 (s, 1H), 7.57-7.49 (m, 1H), 7.43 (s, 1H), 7.41-7.29 (m, 3H), 7.29-7.22 (m, 1H), 3.55-3.50 (m, 2H), 3.01 (t, J=7.2 Hz, 2H).
Example 231: N-(2-(2-(difluoromethoxy)phenyl)-2,2-difluoroethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 231
[0960] ##STR00298##
a) Ethyl 2-(2-(difluoromethoxy)phenyl)-2,2-difluoroacetate A70
[0961] To activate Cu powder: Copper powder was stirred vigorously with 1M aqueous HCl (10 mL) for 10 min at RT, then filtered. The process was sequentially repeated with water (10 mL), MeOH (10 mL) and acetone (10 mL). The final filtered material was dried under vacuum for 30 min then used immediately in the reaction.
[0962] DMSO (18.5 mL) was added to a nitrogen flushed flask containing activated copper (1.2 g, 19 mmol). 1-(Difluoromethoxy)-2-iodo-benzene (1.1 mL, 7.4 mmol) was added, followed by ethyl bromodifluoroacetate (0.95 mL, 7.4 mmol) and the reaction was heated to 60° C. and stirred overnight. The mixture was cooled and filtered through a pad of Celite® and the Celite® was washed with diethyl ether (100 mL). The green solution was washed with saturated aqueous NH.sub.4Cl (100 mL×2). The now orange organic layer was washed with brine (100 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The material was purified by column chromatography (Grace Biotage 40 g SiO.sub.2, 0-50% EtOAc in petroleum benzine 40-60° C.) to give the title compound (1.5 g, 77% yield) as a clear oil. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.74 (dd, J=7.9, 1.7 Hz, 1H), 7.57-7.48 (m, 1H), 7.38-7.31 (m, 1H), 7.23 (dq, J=8.3, 1.2 Hz, 1H), 6.44 (t, J=73.3 Hz, 1H), 4.35 (q, J=7.1 Hz, 2H), 1.33 (t, J=7.1 Hz, 3H).
b) 2-(2-(Difluoromethoxy)phenyl)-2,2-difluoroacetamide A71
[0963] 7 M ammonia in MeOH (20 mL) was added to ethyl 2-(2-(difluoromethoxy)phenyl)-2,2-difluoroacetate A70 (1.5 g, 5.6 mmol) and the solution was stirred at RT for 1 h. The mixture was concentrated in vacuo to give the title compound (1.2 g, 90% yield) as an oil. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.75 (td, J=7.7, 1.7 Hz, 1H), 7.59-7.48 (m, 1H), 7.41-7.29 (m, 1H), 7.29-7.15 (m, 1H), 6.56 (br s, 1H), 6.44 (t, J=73.5 Hz, 1H), 6.11 (br s, 1H).
c) 2-(2-(Difluoromethoxy)phenyl)-2,2-difluoroethan-1-amine A72
[0964] To 2-(2-(Difluoromethoxy)phenyl)-2,2-difluoroacetamide A71 (1.2 g, 5.1 mmol) in THF (25 mL) at 0° C. was added borane-tetrahydrofuran complex 1.0 M solution in THF (2.4 mL, 2.4 mmol) dropwise. The solution was allowed to warm to RT and stirred overnight. The reaction was cooled to 0° C. and quenched with the slow addition of MeOH until gas evolution ceased (˜25 mL). Conc. HCl was added (˜20 mL) and the reaction allowed to stir for 1 h upon which time the mixture was concentrated to dryness. The crude material was loaded onto a Biotage SCX cartridge (2×10 g) and washed with MeOH (50 mL), then a methanolic ammonia solution (50 mL). The basic washings were concentrated in vacuo to give the title compound (0.14 g, 12% yield) as an orange oil. LCMS-B: rt 2.772 min; m/z 223.9 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.62 (dd, J=7.6, 1.7 Hz, 1H), 7.52-7.43 (m, 1H), 7.35-7.26 (m, 1H), 7.25-7.21 (m, 1H), 6.46 (t, J=74.0 Hz, 1H), 3.33 (t, J=15.1 Hz, 2H).
d) N-(2-(2-(Difluoromethoxy)phenyl)-2,2-difluoroethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 231
[0965] A suspension of 2-(2-(difluoromethoxy)phenyl)-2,2-difluoroethan-1-amine A72 (0.038 g, 0.17 mmol) and ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I7 (0.050 g, 0.13 mmol) in EtOH (0.125 mL) was irradiated in a CEM microwave at 100° C. for 2 h. The reaction was cooled and the precipitate filtered, then washed with EtOH (2 mL). The filtrate was concentrated to dryness, then partitioned between EtOH (2 mL) and 1 M aqueous HCl (2 mL). The layers were separated and the organics washed with a further portion of 1 M aqueous HCl (2 mL), brine (2 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was purified by column chromatography (Santai Sepa-Flash, 12 g SiO.sub.2, 0-100% EtOAc in petroleum benzine 40-60° C.) with the material eluting at ˜50% EtOAc collected and concentrated in vacuo to give the title compound (0.010 g, 14% yield) as a cream-colored solid. LCMS-B: rt 3.678 min; m/z 555.7 [M−H].sup.−. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.76 (br s, 1H), 9.47 (br s, 1H), 8.11-7.96 (m, 2H), 7.69-7.47 (m, 3H), 7.33 (t, J=8.1 Hz, 2H), 7.26 (t, J=73.3 Hz, 1H), 4.34-3.91 (m, 2H).
Example 232: 7-chloro-N-(2-(2-(difluoromethoxy)phenyl)-2,2-difluoroethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 232
[0966] ##STR00299##
[0967] A suspension of 2-(2-(difluoromethoxy)phenyl)-2,2-difluoroethan-1-amine A72 (0.048 g, 0.22 mmol) and ethyl 7-chloro-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I162 (0.048 g, 0.17 mmol) in EtOH (0.2 mL) was irradiated in a CEM microwave at 120° C. for 1 h. The crude material was purified by column chromatography (Santai Sepa-Flash, 12 g SiO.sub.2, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.022 g, 28% yield) as a white solid. LCMS-B: rt 3.857 min; m/z 463.8 [M−H].sup.−. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.82 (br s, 1H), 9.53 (br s, 1H), 7.92 (s, 1H), 7.81 (s, 2H), 7.68-7.49 (m, 2H), 7.33 (t, J=8.1 Hz, 2H), 7.26 (t, J=73.3 Hz, 1H), 4.10 (td, J=14.2, 6.6 Hz, 2H).
Example 233: 7-iodo-N-(2-(oxazol-2-yl)-2-(m-tolyl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 233
[0968] ##STR00300##
a) 2-(3-Methylbenzyl)oxazole A73
[0969] m-Tolylacetic acid (5.0 g, 33 mmol) was dissolved in thionyl chloride (25 mL) and heated at 80° C. for 3 h. The remaining thionyl chloride was evaporated in vacuo. The residue was dissolved in sulfolane (10 mL), and to this was added 1H-1,2,3-Triazole (2.7 mL, 47 mmol) and K.sub.2CO.sub.3(9.2 g, 67 mmol). The reaction was heated to 150° C. for 30 min, then cooled, added to water (30 mL) and extracted with EtOAc (3×30 mL). The combined organics were washed with brine, dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was purified by silica gel chromatography (Isolera Biotage 120 g SiO.sub.2, 0-30% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.58 g, 10% yield) as a clear oil. LCMS-B: rt 3.268 min, m/z 174.0 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.56 (d, J=0.9 Hz, 1H), 7.22 (td, J=7.6, 0.7 Hz, 1H), 7.13-7.05 (m, 3H), 7.04 (d, J=0.9 Hz, 1H), 4.09 (s, 2H), 2.33 (d, J=0.7 Hz, 3H).
b) 2-(2-(Oxazol-2-yl)-2-(m-tolyl)ethyl)isoindoline-1,3-dione A74
[0970] To a solution of 2-(3-methylbenzyl)oxazole A73 (0.573 g, 3.31 mmol) in anhydrous THF (10 mL) at −78° C. under nitrogen was added lithium bis(trimethylsilyl)amide, 1.0 M solution in hexane (4.96 mL, 4.96 mmol) dropwise. A solution of N-(bromomethyl)phthalimide (1.19 g, 4.96 mmol) in anhydrous THF (8 mL) was then added dropwise and the mixture allowed to warm slowly to room temperature and stirred overnight. The mixture was diluted with a saturated aqueous NH.sub.4Cl solution (50 mL) and water (25 mL), then extracted with DCM (50 mL×3). The combined organic extracts were washed with brine, dried (Na.sub.2SO.sub.4), concentrated in vacuo and purified by column chromatography (Biotage, Grace 40 g SiO.sub.2, 0-60% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.11 g, 10% yield) as a white solid. LCMS-A: rt 6.117 min; m/z 332.9 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.63 (dd, J=5.5, 3.0 Hz, 2H), 7.52 (dd, J=5.5, 3.0 Hz, 2H), 7.42 (d, J=1.0 Hz, 1H), 7.05-6.96 (m, 3H), 6.92-6.82 (m, 2H), 4.61 (t, J=8.1 Hz, 1H), 4.25 (dd, J=13.7, 8.1 Hz, 1H), 4.16 (dd, J=13.7, 8.2 Hz, 1H), 2.12 (s, 3H).
c) 2-(Oxazol-2-yl)-2-(m-tolyl)ethan-1-amine A75
[0971] To a suspension of 2-(2-(oxazol-2-yl)-2-(m-tolyl)ethyl)isoindoline-1,3-dione A74 (0.11 g, 0.34 mmol) in EtOH (3 mL), under an atmosphere of nitrogen, was added hydrazine hydrate (0.251 g, 5.01 mmol). This was heated to 80° C. and allowed to stir for 3 h, upon which time the reaction was cooled and the formed precipitate filtered. The solid was washed with cold EtOH (1 mL) and the combined filtrate concentrated in vacuo. The resulting solid was taken up in cold EtOH (1 mL) and filtered. The filtrate was concentrated in vacuo. The resulting semi-solid was once more taken up in cold EtOH (1 mL), the precipitate was filtered and the filtrate concentrated in vacuo to give the title compound (0.045 g, 66% yield) as a yellow oil. LCMS-B: rt 2.741 min; m/z 203.0 [M+H].sup.+.
d) 7-Iodo-N-(2-(oxazol-2-yl)-2-(m-tolyl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 233
[0972] To a solution of 2-(oxazol-2-yl)-2-(m-tolyl)ethan-1-amine A75 (0.022 g, 0.11 mmol) in EtOH (0.125 mL) was added ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I7 (0.034 g, 0.091 mmol). This was irradiated in a CEM microwave at 120° C. for 2 h. The reaction was cooled and the precipitate filtered. The solid was washed with EtOH (2 mL) and air dried to give title compound (0.020 g, 34% yield) as an off-white solid. LCMS-B: rt 3.565 min; m/z 536.6 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.72 (br s, 1H), 9.17 (br s, 1H), 8.10-7.92 (m, 3H), 7.57-7.47 (m, 1H), 7.26-7.17 (m, 2H), 7.15-7.00 (m, 3H), 4.61 (t, J=7.5 Hz, 1H), 3.99 (dt, J=13.4, 6.8 Hz, 1H), 3.84 (dt, J=13.3, 6.8 Hz, 1H), 2.27 (s, 3H).
Example 234: 7-chloro-N-(2-(oxazol-2-yl)-2-(m-tolyl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 234
[0973] ##STR00301##
[0974] To a solution of 2-(oxazol-2-yl)-2-(m-tolyl)ethan-1-amine A75 (0.020 g, 0.099 mmol) in EtOH (0.125 mL) was added ethyl 7-chloro-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I162 (0.024 g, 0.082 mmol). The reaction was irradiated in a CEM microwave at 120° C. for 1 h. The reaction was cooled and the precipitate filtered. The solid was washed with EtOH (2 mL) and air dried to give the title compound (0.020 g, 45% yield) as a white solid. LCMS-B: rt 3.616 min; m/z 444.7 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.79 (br s, 1H), 9.23 (br s, 1H), 8.04 (d, J=0.9 Hz, 1H), 7.89 (s, 1H), 7.86-7.66 (m, 2H), 7.29-7.16 (m, 2H), 7.15-6.95 (m, 3H), 4.62 (t, J=7.5 Hz, 1H), 4.00 (dt, J=13.3, 6.6 Hz, 1H), 3.85 (dt, J=13.4, 6.8 Hz, 1H), 2.27 (s, 3H).
Example 235: N-(2-(2-fluorophenyl)-2-(oxazol-2-yl)ethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 235
[0975] ##STR00302##
a) 2-(2-Fluorobenzyl)oxazole A76
[0976] 2-Fluorophenylacetic acid (3.0 g, 19 mmol) was dissolved in thionyl chloride (15 mL) and heated at 80° C. for 3 h. The remaining thionyl chloride was evaporated in vacuo. The residue was dissolved in sulfolane (10 mL), and to this was added 1H-1,2,3-triazole (1.6 mL, 27 mmol) and K.sub.2CO.sub.3 (5.4 g, 39 mmol). The reaction was heated to 150° C. for 30 min, then cooled, added to water (20 mL) and extracted with EtOAc (3×20 mL). The combined organics were washed with brine, dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was purified by silica gel chromatography (Isolera Biotage 120 g SiO.sub.2, 0-20% EtOAc in petroleum benzine 40-60° C.) to give the title compound (1.6 g, 47% yield) as a clear oil. LCMS-B: rt 3.322 min, m/z 178.0 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.57 (d, J=0.9 Hz, 1H), 7.31-7.20 (m, 3H), 7.15-7.02 (m, 3H), 4.17 (s, 2H).
b) 2-(2-(2-Fluorophenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione A77
[0977] To a solution of 2-(2-fluorobenzyl)oxazole A76 (1.63 g, 9.21 mmol) in anhydrous THF (30 mL) at −78° C. under nitrogen was added lithium bis(trimethylsilyl)amide, 1.0 M solution in hexane (13.8 mL, 13.8 mmol) dropwise. A solution of N-(bromomethyl)phthalimide (2.87 g, 12.0 mmol) in anhydrous THF (25 mL) was then added dropwise and the mixture allowed to warm slowly to RT and left to stir overnight. The mixture was diluted with a saturated aqueous NH.sub.4Cl solution (100 mL) and water (50 mL), then extracted with DCM (3×100 mL). The combined organic extracts were washed with brine, dried (Na.sub.2SO.sub.4), concentrated in vacuo and purified by column chromatography (Isolera Biotage, Grace 120 g SiO.sub.2, 0-60% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.91 g, 30% yield) as a white solid. LCMS-B: rt 3.434 min; m/z 336.9 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.83-7.77 (m, 2H), 7.73-7.67 (m, 2H), 7.60 (d, J=0.9 Hz, 1H), 7.42-7.35 (m, 1H), 7.15-7.07 (m, 2H), 7.02-6.92 (m, 1H), 5.11 (dd, J=8.8, 7.1 Hz, 1H), 4.50-4.33 (m, 2H). One aromatic proton obscured by solvent signal.
c) 2-(2-Fluorophenyl)-2-(oxazol-2-yl)ethan-1-amine A78
[0978] To a suspension of 2-(2-(2-fluorophenyl)-2-(oxazol-2-yl)ethyl)isoindoline-1,3-dione A77 (0.20 g, 0.59 mmol) in EtOH (6 mL), under an atmosphere of nitrogen, was added hydrazine hydrate (0.430 mL, 8.84 mmol). The reaction was heated to 80° C. and allowed to stir for 3 h, upon which time the reaction was cooled and the formed precipitate filtered.
[0979] The solid was washed with cold EtOH (2 mL) and the combined filtrate concentrated in vacuo. The resulting solid was taken up in cold EtOH (1 mL) and filtered. The filtrate was concentrated in vacuo. The resulting semi-solid was once more taken up in cold EtOH (1 mL), the precipitate filtered and the filtrate concentrated in vacuo to give the title compound (0.11 g, 90% yield) as an orange oil. LCMS-B: rt 2.718 min; m/z 207.0 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.60 (d, J=0.9 Hz, 1H), 7.26-7.22 (m, 1H), 7.22-7.14 (m, 1H), 7.13-7.03 (m, 3H), 4.56 (dd, J=7.9, 6.0 Hz, 1H), 3.50-3.40 (m, 1H), 3.25 (dd, J=12.9, 6.0 Hz, 1H).
d) N-(2-(2-Fluorophenyl)-2-(oxazol-2-yl)ethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 235
[0980] To a suspension of ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I7 (0.040 g, 0.11 mmol) in EtOH (0.125 mL) was added 2-(2-fluorophenyl)-2-(oxazol-2-yl)ethan-1-amine A78 (0.026 g, 0.13 mmol). The reaction was irradiated in a CEM microwave at 120° C. for 3 h. The reaction was cooled and the precipitate filtered. The solid was washed with EtOH (2 mL) and air dried to give the title compound (0.020 g, 35% yield) as a white solid. LCMS-B: rt 3.591 min; m/z 540.6 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.74 (s, 1H), 9.38 (t, J=6.0 Hz, 1H), 8.13-7.98 (m, 3H), 7.57 (dd, J=19.2, 8.7 Hz, 2H), 7.35 (tdd, J=8.5, 3.7, 1.5 Hz, 2H), 7.25-7.06 (m, 2H), 4.94 (t, J=7.6 Hz, 1H), 4.06 (ddd, J=12.9, 7.2, 5.7 Hz, 1H), 3.90 (ddd, J=13.2, 8.1, 6.4 Hz, 1H).
Example 236: 7-chloro-N-(2-(2-fluorophenyl)-2-(oxazol-2-yl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 236
[0981] ##STR00303##
[0982] To a suspension of ethyl 7-chloro-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I162 (0.028 g, 0.097 mmol) in EtOH (0.125 mL) was added 2-(2-fluorophenyl)-2-(oxazol-2-yl)ethan-1-amine A78 (0.024 g, 0.12 mmol). The reaction was irradiated in a CEM microwave at 120° C. for 1 h. The reaction was cooled and the precipitate filtered. The solid was washed with EtOH (1 mL) and air dried to give the title compound (0.015 g, 29% yield) as a white solid. LCMS-B: rt 3.562 min; m/z 448.7 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.80 (br s, 1H), 9.34 (br s, 1H), 8.06 (d, J=0.8 Hz, 1H), 7.90 (s, 1H), 7.80 (s, 2H), 7.35 (dddt, J=9.3, 7.4, 3.7, 1.7 Hz, 2H), 7.26-7.12 (m, 3H), 4.94 (t, J=7.5 Hz, 1H), 4.06 (dt, J=13.0, 6.4 Hz, 1H), 3.91 (dt, J=13.6, 7.1 Hz, 1H).
Example 237: 7-iodo-N-(2-(oxazol-2-yl)-2-(o-tolyl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 237
[0983] ##STR00304##
a) 2-(2-Methylbenzyl)oxazole A79
[0984] 2-(o-Tolyl)acetic acid (2.0 g, 13 mmol) was dissolved in thionyl chloride (10 mL) and heated at 80° C. for 3 h. The remaining thionyl chloride was evaporated in vacuo. The residue was dissolved in sulfolane (10 mL), and to this was added 1H-1,2,3-triazole (1.08 mL, 18.6 mmol) and K.sub.2CO.sub.3 (3.7 g, 27 mmol). The reaction was heated to 150° C. for 30 min, then cooled, added to water (20 mL) and extracted with EtOAc (3×20 mL). The combined organics were washed with brine, dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was purified by silica gel chromatography (Isolera Biotage 120 g SiO.sub.2, 0-60% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.63 g, 27% yield) as a clear oil. LCMS-B: rt 3.185 min, m/z 174.0 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.55 (d, J=0.9 Hz, 1H), 7.22-7.15 (m, 4H), 7.03 (d, J=0.9 Hz, 1H), 4.12 (s, 2H), 2.34 (s, 3H).
b) 2-(2-(Oxazol-2-yl)-2-(o-tolyl)ethyl)isoindoline-1,3-dione A80
[0985] To a solution of 2-(2-methylbenzyl)oxazole A79 (0.62 g, 3.6 mmol) in anhydrous THF (10 mL) at −78° C. under nitrogen was added lithium bis(trimethylsilyl)amide, 1.0 M solution in hexane (4.68 mL, 4.68 mmol) dropwise. A solution of N-(bromomethyl)phthalimide (1.12 g, 4.68 mmol) in anhydrous THF (8 mL) was then added dropwise and the mixture allowed to warm slowly to room temperature and stirred overnight. The mixture was diluted with a saturated aqueous NH.sub.4Cl solution (50 mL) and water (25 mL), then extracted with DCM (3×50 mL). The combined organic extracts were washed with brine, dried (Na.sub.2SO.sub.4), concentrated in vacuo and purified by column chromatography (Isolera Biotage, Grace 40 g SiO.sub.2, 0-60% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.070 g, 5.9% yield) as a white solid. LCMS-B: rt 3.414 min; m/z 332.9 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.79 (dd, J=5.5, 3.0 Hz, 2H), 7.68 (dd, J=5.5, 3.0 Hz, 2H), 7.56 (d, J=0.9 Hz, 1H), 7.47-7.41 (m, 1H), 7.23-7.17 (m, 1H), 7.17-7.12 (m, 2H), 7.02 (d, J=0.8 Hz, 1H), 5.09 (dd, J=8.8, 7.1 Hz, 1H), 4.49 (dd, J=13.7, 8.8 Hz, 1H), 4.25 (dd, J=13.7, 7.2 Hz, 1H), 2.42 (s, 3H).
c) 2-(Oxazol-2-yl)-2-(o-tolyl)ethan-1-amine A81
[0986] To a suspension of 2-(2-(oxazol-2-yl)-2-(o-tolyl)ethyl)isoindoline-1,3-dione A80 (0.067 g, 0.20 mmol) in EtOH (3 mL), under an atmosphere of nitrogen, was added hydrazine hydrate (0.150 g, 3.00 mmol). This was heated to 80° C. and allowed to stir for 3 h, upon which time the reaction was cooled and the formed precipitate filtered. The solid was washed with cold EtOH (1 mL) and the combined filtrates concentrated in vacuo. The resulting solid was taken up in cold EtOH (1 mL) and filtered. The filtrate was concentrated in vacuo. The resulting semi-solid was once more taken up in cold EtOH (1 mL), the precipitate filtered and the filtrate concentrated in vacuo to give the title compound (0.024 g, 59% yield) as a yellow oil. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.57 (d, J=0.8 Hz, 1H), 7.23-7.17 (m, 1H), 7.18-7.13 (m, 2H), 7.12-7.07 (m, 2H), 4.45 (dd, J=8.4, 5.7 Hz, 1H), 3.46 (dd, J=13.0, 8.4 Hz, 1H), 3.22 (dd, J=13.0, 5.7 Hz, 1H), 2.44 (s, 3H).
d) 7-Iodo-N-(2-(oxazol-2-yl)-2-(o-tolyl)ethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 237
[0987] To a solution of 2-(oxazol-2-yl)-2-(o-tolyl)ethan-1-amine A81 (0.022 g, 0.11 mmol) in EtOH (0.125 mL) was added ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I7 (0.034 g, 0.089 mmol). The reaction was irradiated in a CEM microwave at 120° C. for 1.5 h, then cooled and the precipitate filtered. The solid was washed with EtOH (2 mL) and air dried to give title compound (0.031 g, 54% yield) as a white solid. LCMS-B: rt 3.431 min; m/z 536.6 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.77 (br s, 1H), 9.24 (br s, 1H), 8.15-7.91 (m, 3H), 7.52 (d, J=8.5 Hz, 1H), 7.27-7.10 (m, 5H), 4.91 (t, J=7.5 Hz, 1H), 4.04 (dt, J=14.0, 7.5 Hz, 1H), 3.78 (dt, J=12.8, 6.1 Hz, 1H), 2.40 (s, 3H).
Example 238: N-(2,2-difluoro-2-phenylethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 238
[0988] ##STR00305##
[0989] To 2,2-difluoro-2-phenyl-ethanamine hydrochloride (0.031 g, 0.16 mmol) in EtOH (0.125 mL), was added triethylamine (0.022 mL, 0.16 mmol). This was allowed to stir for 10 min at RT upon which time ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I7 (0.050 g, 0.13 mmol) was added. The reaction was irradiated in a CEM microwave for 1.5 h at 120° C., then cooled and the precipitate filtered. The solid was washed with cold EtOH (2 mL) and air dried to give the title compound (0.033 g, 51% yield) as a cream solid. LCMS-B: rt 3.344 min; m/z 489.7 [M−H].sup.−.
Example 239: 7-iodo-N-(2-(4-(methoxymethyl)-2H-1,2,3-triazol-2-yl)phenethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 239
[0990] ##STR00306##
[0991] To a suspension of N-(2-(4-(hydroxymethyl)-2H-1,2,3-triazol-2-yl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 190 (0.050 g, 0.091 mmol) in acetonitrile (5 mL), under an atmosphere of nitrogen, was added silver(I)oxide (0.10 g, 0.45 mmol) and iodomethane (0.056 mL, 0.91 mmol). This was allowed to stir overnight at 50° C. The reaction was cooled and filtered through a pad of Celite®. The Celite® was washed with a mixture of DCM/MeOH and the filtrate was concentrated in vacuo. The solid residue was washed with warm DCM/MeOH (5 mL/1 mL) and the remaining solid was dissolved in DCM/MeOH (20 mL/10 mL), 1.25 M HCl in methanol (4 mL) was added and the solution sonicated for 5 minutes. The cloudy solution was filtered through a pad of Celite® and the filtrate was concentrated in vacuo to give the title compound (0.016 g, 31% yield) as a white solid. LCMS-B: rt 3.699 min; m/z 564.7 [M−H].sup.−. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.68 (s, 1H), 9.29 (t, J=5.9 Hz, 1H), 8.12-8.06 (m, 2H), 8.05 (s, 1H), 7.61 (d, J=8.7 Hz, 1H), 7.57-7.37 (m, 4H), 4.58 (s, 2H), 3.46 (q, J=6.8 Hz, 2H), 2.93 (t, J=7.1 Hz, 2H). OCH.sub.3 signal obscured by water. Presence confirmed via HMQC (3.33 ppm/57.9 ppm).
Example 240: N-(2-(1H-pyrazol-1-yl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 240
[0992] ##STR00307##
a) 2-(2-(1H-pyrazol-1-yl)phenyl)ethan-1-amine A82
[0993] To 2-(2-pyrazol-1-ylphenyl)acetonitrile (0.13 g, 0.70 mmol) in THF (5 mL) was added borane-tetrahydrofuran complex 1.0 M solution in THF (3.5 mL, 3.5 mmol) dropwise. The solution was heated to reflux and allowed to stir overnight. The reaction was cooled and quenched slowly with water (5 mL). A 50% w/v aq. NaOH solution (2 mL) was added and the mixture was refluxed for 1 h. The reaction was cooled and the organics concentrated in vacuo. The remaining aqueous layer was extracted with DCM (10 mL×3), the organics were combined, washed with brine (20 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was loaded onto a Biotage SCX cartridge (5 g) and washed with MeOH (30 mL), then a methanolic ammonia solution (30 mL). The methanolic washings were concentrated in vacuo to give the title compound (0.12 g, 90% yield) as a yellow oil. LCMS-B: rt 0.930 min; m/z 188.0 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.71 (dd, J=1.9, 0.7 Hz, 1H), 7.61 (dd, J=2.3, 0.7 Hz, 1H), 7.41-7.33 (m, 2H), 7.32-7.29 (m, 2H), 6.44 (t, J=2.1 Hz, 1H), 2.86-2.76 (m, 2H), 2.73-2.61 (m, 2H), 1.25 (br s, 2H).
b) N-(2-(1H-pyrazol-1-yl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 240
[0994] To a solution of 2-(2-(1H-pyrazol-1-yl)phenyl)ethan-1-amine A82 (0.049 g, 0.26 mmol) in EtOH (0.2 mL) was added ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I7 (0.050 g, 0.13 mmol). The reaction was irradiated in a microwave reactor at 120° C. for 1 h, then cooled and the precipitate filtered. The solid was washed with EtOH (2 mL), then taken up in EtOAc (10 mL) and washed with 1M aqueous HCl (10 mL×2) and brine. A precipitate formed from the organic layer and this solid was collected by filtration to give the title compound (0.0080 g, 12% yield) a pale grey solid. LCMS-B: rt 3.354 min; m/z 521.6 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.68 (br s, 1H), 9.41 (m, 1H), 8.11-8.03 (m, 2H), 8.00 (dd, J=2.3, 0.7 Hz, 1H), 7.72 (dd, J=1.8, 0.7 Hz, 1H), 7.59 (d, J=8.7 Hz, 1H), 7.48-7.31 (m, 4H), 6.48 (t, J=2.1 Hz, 1H), 3.45-3.36 (partially obscured by solvent, m, 2H), 2.83 (t, J=7.1 Hz, 2H).
Example 241: N-(2-(1H-1,2,3-triazol-1-yl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 241
[0995] ##STR00308##
a) (2-(1H-1,2,3-Triazol-1-yl)phenyl)methanol A83
[0996] A solution of 2-(triazol-1-yl)benzoic acid (0.50 g, 2.6 mmol) in tetrahydrofuran (10 mL) (note: required heat and sonication for complete dissolution), under an atmosphere of nitrogen, was cooled to 0° C. To this was added lithium aluminum hydride 1.0 M THF (3.96 mL, 3.96 mmol) dropwise over 15 min. After 10 min at this temperature, the reaction was allowed to warm to RT and stirred for a further 3 h. The reaction was cooled to 0° C. and cautiously added to 2M aqueous HCl (10 mL). The THF was removed in vacuo and the remaining aqueous phase extracted with DCM (10 mL×3). The combined organics were washed with brine (20 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo to give the title compound (0.37 g, 80% yield) as an amber oil. LCMS-A: rt 4.364 min; m/z 176.0 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.96 (d, J=1.1 Hz, 1H), 7.89 (d, J=1.1 Hz, 1H), 7.64 (dd, J=7.2, 1.9 Hz, 1H), 7.56-7.45 (m, 2H), 7.39 (dd, J=7.7, 1.5 Hz, 1H), 4.48 (s, 2H), 3.44 (br s, 1H).
b) 2-(1H-1,2,3-Triazol-1-yl)benzaldehyde A84
[0997] To a suspension of pyridinium chlorochromate (PCC) (0.91 g, 4.2 mmol) in DCM (6 mL), under an atmosphere of nitrogen, was added a solution of (2-(1H-1,2,3-triazol-1-yl)phenyl)methanol A83 (0.37 g, 2.1 mmol) in DCM (6 mL) dropwise. This was allowed to stir at RT for 1 h. Diethyl ether (10 mL) was added and the suspension filtered through a pad of Celite®. The pad was washed with diethyl ether (50 mL) and the filtrate concentrated in vacuo. The crude material was purified by column chromatography (Grace Biotage, 40 g SiO.sub.2, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.18 g, 49% yield) as a white solid. LCMS-A: rt 4.369 min; m/z 174.0 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 9.89 (d, J=0.7 Hz, 1H), 8.16-8.10 (m, 1H), 7.98 (d, J=1.1 Hz, 1H), 7.94 (d, J=1.2 Hz, 1H), 7.79 (td, J=7.7, 1.6 Hz, 1H), 7.72-7.64 (m, 1H), 7.53 (dd, J=7.8, 0.8 Hz, 1H).
c) (E)-1-(2-(2-Nitrovinyl)phenyl)-1H-1,2,3-triazole A85
[0998] 2-(1H-1,2,3-Triazol-1-yl)benzaldehyde A84 (0.16 g, 0.92 mmol), nitromethane (0.20 mL, 3.7 mmol) and ammonium acetate (0.036 g, 0.46 mmol) were added to glacial acetic acid (1 mL) and refluxed for 5 h. The reaction was cooled, poured into water (5 mL) and extracted with diethyl ether (3×5 mL). The organics were combined, washed with brine (10 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The residue was recrystallised from EtOH to give the title compound (0.075 g, 38% yield) as a white solid. LCMS-A: rt 5.082 min; m/z 216.9 [M+H].sup.+. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.95 (d, J=1.1 Hz, 1H), 7.85 (d, J=1.1 Hz, 1H), 7.81 (d, J=13.6 Hz, 1H), 7.76 (ddd, J=7.6, 1.4, 0.8 Hz, 1H), 7.71-7.58 (m, 2H), 7.57-7.51 (m, 1H), 7.44 (d, J=13.6 Hz, 1H).
d) 2-(2-(1H-1,2,3-Triazol-1-yl)phenyl)ethan-1-amine A86
[0999] To (E)-1-(2-(2-Nitrovinyl)phenyl)-1H-1,2,3-triazole A85 (0.072 g, 0.33 mmol) in dry THF (2 mL) at 0° C., under an atmosphere of nitrogen, was added lithium aluminum hydride 1.0 M THF (0.67 mL, 0.67 mmol) dropwise. This was allowed to warm to RT, then stirred for a further 3 h. The reaction was cooled to 0° C. and quenched with the slow addition of aqueous 1M NaOH (5 mL). Water (5 mL) and EtOAc (10 mL) were added and the layers separated. The aqueous was extracted with EtOAc (2×), the combined organics were washed with brine (20 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo to give the title compound (0.043 g, 69% yield) as an oil. .sup.1H NMR (400 MHz, Chloroform-d) δ 7.93-7.61 (m, 2H), 7.52-7.29 (m, 6H), 2.81 (t, J=7.1 Hz, 2H), 2.58 (td, J=7.1, 2.4 Hz, 2H).
e) N-(2-(1H-1,2,3-triazol-1-yl)phenethyl)-7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 241
[1000] To 2-(2-(1H-1,2,3-triazol-1-yl)phenyl)ethan-1-amine A86 (0.043 g, 0.23 mmol) in EtOH (0.125 mL) was added ethyl 7-iodo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide I7 (0.056 g, 0.15 mmol). The reaction was irradiated in a CEM microwave at 120° C. for 2 h, then concentrated to dryness and partitioned between 1M aqueous HCl (2 mL) and EtOAc (2 mL). The layers were separated and the organic layer concentrated in vacuo. The material was taken up in minimum EtOH and Et.sub.2O was added dropwise until a precipitate formed. The precipitate was collected and the process repeated. This material was further purified by column chromatography (Grace Biotage, 4 g SiO.sub.2, 0-100% EtOAc in petroleum benzine 40-60° C., then 0-40% EtOAc in MeOH) to give the title compound (0.0050 g, 4.2% yield) as an off-white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.68 (br s, 1H), 9.22 (br s, 1H), 8.43 (d, J=1.1 Hz, 1H), 8.10-8.01 (m, 2H), 7.94 (d, J=1.0 Hz, 1H), 7.65-7.36 (m, 5H), 2.72 (t, J=7.3 Hz, 2H). Two aliphatic protons obscured by the water signal.
Example 242: N-((1-(oxazol-2-yl)cyclopentyl)methyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 242
[1001] ##STR00309##
a) 1-((1,3-Dioxoisoindolin-2-yl)methyl)cyclopentane-1-carboxylic Acid A87
[1002] To 1-(aminomethyl)cyclopentane-1-carboxylic acid hydrochloride (0.500 g, 2.783 mmol) in 1,4-dioxane (8 mL) was added NEt.sub.3 (1.164 mL, 8.350 mmol). This was allowed to stir for 10 min, upon which phthalic anhydride (0.495 g, 3.340 mmol) was added. The mixture was sealed and irradiated in a microwave reactor at 150° C. for 30 min. The precipitated salts were filtered and the filtrate concentrated in vacuo. The material was taken up in minimal MeOH and loaded onto a 10 g Agilent, Bond Elut NH.sub.2 column. The column was washed with 3 volumes of MeOH (3×30 mL), then stripped with 1M HCl in 1,4-dioxane (100 mL). The HCl wash was concentrated in vacuo to give the title compound (0.560 g, 74% yield) as a white solid. LCMS-B: rt 3.168 min; m/z 272.1 [M−H].sup.−. .sup.1H NMR (400 MHz, DMSO-d.sub.6): δ 12.34 (br s, 1H), 8.04-7.71 (m, 4H), 3.79 (s, 2H), 2.08-1.81 (m, 2H), 1.65-1.56 (m, 4H), 1.55-1.46 (m, 2H).
b) 2-((1-(Oxazol-2-yl)cyclopentyl)methyl)isoindoline-1,3-dione A88
[1003] 1-((1,3-Dioxoisoindolin-2-yl)methyl)cyclopentane-1-carboxylic acid A87 (0.300 g, 1.098 mmol) was dissolved in thionyl chloride (2 mL) and heated at 80° C. for 3 h. The remaining thionyl chloride was evaporated in vacuo. The residue was dissolved in sulfolane (2 mL), and to this was added 1,2,3-triazole (0.089 mL, 1.537 mmol) and K.sub.2CO.sub.3(0.303 g, 2.196 mmol). The reaction was heated to 150° C. for 30 min, then cooled, added to water (5 mL) and extracted with EtOAc (3×3 mL). The combined organics were washed with brine, dried (Na.sub.2SO.sub.4) and concentrated in vacuo. The crude material was purified by silica gel chromatography (Isolera Biotage 40 g SiO.sub.2, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.135 g, 42% yield) as a white solid. LCMS-B: rt 3.285 min, m/z 297.1 [M+H].sup.+.
c) (1-(Oxazol-2-yl)cyclopentyl)methanamine A89
[1004] To a suspension of 2-((1-(oxazol-2-yl)cyclopentyl)methyl)isoindoline-1,3-dione A88 (0.135 g, 0.456 mmol) in EtOH (6 mL) was added hydrazine hydrate (0.057 mL, 1.822 mmol). The solution was heated at 80° C. for 3 h, an additional portion of hydrazine hydrate (0.057 mL) was added, and the reaction was allowed to stir for a further 2 h. The reaction was cooled and the precipitate filtered and washed with a portion of cold EtOH (5 mL). The combined EtOH fractions were allowed to stand at 0° C. overnight, the precipitate was removed by filtration and the filtrate was loaded directly onto a 5 g SCX cartridge (Agilent Bond Elut) and the cartridge was washed with MeOH (20 mL), the product was then eluted with a 10% aq. NH.sub.3 in MeOH solution (20 mL). The NH.sub.3 washings were evaporated in vacuo give the title compound (0.049 g, 65% yield) as an oil. LCMS-B: rt 1.534 min, m/z 167.1 [M+H].sup.+.
d) N-((1-(Oxazol-2-yl)cyclopentyl)methyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 242
[1005] To (1-(oxazol-2-yl)cyclopentyl)methanamine A89 (0.045 g, 0.270 mmol) in EtOH (0.250 mL) was added ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide 12 (0.049 g, 0.193 mmol). The mixture was subjected to microwave irradiation at 100° C. for 30 min. The reaction was cooled and EtOH removed in vacuo. The residue was taken up in EtOAc (3 mL) and washed with 1M aqueous HCl (3 mL), brine (3 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo to give the title compound (0.060 g, 84% yield) as a white solid. LCMS-B: rt 3.162 min; m/z 375.1 [M+H].sup.+.
Example 243: methyl (1-cyclohexyl-2-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)ethyl)carbamate 243
[1006] ##STR00310##
a) tert-Butyl methyl (1-cyclohexylethane-1,2-diyl)dicarbamate A90
[1007] To a solution of the tert-butyl (2-amino-2-cyclohexylethyl)carbamate (0.500 g, 2.063 mmol) in DCM (15 mL) was added NEt.sub.3 (0.316 mL, 2.269 mmol). This was allowed to stir for 10 min upon which the reaction was cooled to 0° C. and methyl chloroformate (0.189 mL, 2.269 mmol) was added dropwise. The reaction slowly warmed to RT and was allowed to stir overnight. 1M aqueous HCl (15 mL) was added and the layers separated. The organics were washed with saturated aqueous Na.sub.2CO.sub.3 (15 mL), brine (15 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo to give the title compound (0.450 g, 73% yield) as a white solid. .sup.1H NMR (400 MHz, Chloroform-d): δ 4.86-4.69 (m, 1H), 3.65 (s, 3H), 3.58-3.45 (m, 1H), 3.20 (m, 2H), 1.81-1.62 (m, 6H), 1.42 (s, 9H), 1.29-0.95 (m, 4H).
b) Methyl (2-amino-1-cyclohexylethyl)carbamate A91
[1008] To a solution of tert-butyl methyl (1-cyclohexylethane-1,2-diyl)dicarbamate A90 (0.450 g, 1.498 mmol) in DCM (6 mL) was added TFA (0.6 mL). This was allowed to stir at RT for 2 h upon which time the reaction was concentrated in vacuo to give the crude product. A portion of the crude material (0.162 g) in MeOH (˜1 mL) was gravity loaded onto a SCX cartridge (5 g). The cartridge was washed with 3 column volumes of MeOH, then 3 column volumes of a 10% solution of NH.sub.3 in MeOH. The methanolic ammonia washes were combined and concentrated in vacuo to give the title compound (0.059 g) as a clear oil which was used directly in the next step.
c) Methyl (1-cyclohexyl-2-(1,1-dioxido-2H-benzo[e][1,2,4]thiadiazine-3-carboxamido)ethyl)carbamate 243
[1009] To methyl (2-amino-1-cyclohexylethyl)carbamate A91 (0.059 g, 0.295 mmol) in EtOH (0.125 mL) was added ethyl 2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide 12 (0.050 g, 0.197 mmol). The mixture was subjected to microwave irradiation at 100° C. for 30 min. The reaction was cooled and the solvent evaporated. The material was partitioned between 1M aqueous HCl (3 mL) and EtOAc (3 mL). The layers were separated and the organic phase was washed with brine (3 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo to give the title compound (0.062 g, 77% yield) as a white solid. LCMS-A: rt 6.007 min; m/z 407.2 [M−H].sup.−. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.65 (s, 1H), 9.03 (t, J=5.8, 5.8 Hz, 1H), 7.86 (dd, J=8.0, 1.4 Hz, 1H), 7.84-7.80 (m, 1H), 7.73 (ddd, J=8.5, 7.2, 1.5 Hz, 1H), 7.53 (ddd, J=8.2, 7.3, 1.2 Hz, 1H), 6.96 (d, J=9.1 Hz, 1H), 3.63-3.54 (m, 1H), 3.50 (s, 3H), 3.44 (dt, J=13.0, 5.4, 5.4 Hz, 1H), 3.24 (dt, J=13.7, 7.1, 7.1 Hz, 1H), 1.75-1.63 (m, 4H), 1.59 (d, J=10.0 Hz, 1H), 1.46-1.33 (m, 1H), 1.26-1.06 (m, 3H), 1.06-0.89 (m, 2H).
Example 244: N-(2-(1H-pyrazol-1-yl)-2-(pyridin-2-yl)ethyl)-7-bromo-4H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 244
[1010] ##STR00311##
a) 2-((1H-Pyrazol-1-yl)methyl)pyridine A92
[1011] To a solution of pyrazole (0.5 g, 7.35 mmol) in toluene (15 mL) was added 2-(chloromethyl)pyridine hydrochloride (1.44 g, 8.8 mmol), aqueous NaOH (40% w/v, 10 mL) and 40% w/v aqueous tetrabutylammonium hydrogen sulphate (catalytic 12 drops). The reaction mixture was heated at reflux for 20 hours and then partitioned between water (50 mL) and diethyl ether (3×50 mL). The combined organic layers were dried (MgSO.sub.4) and evaporated in vacuo, and the crude product was purified by chromatography (24 g SiO.sub.2 cartridge, 0-95% EtOAc in petroleum benzine 40-60° C.) to give the title compound (1.24 g, 89% yield) as a colourless viscous oil. .sup.1H NMR (400 MHz, Chloroform-d) δ 8.57 (d, J=6.14 Hz, 2H), 7.60 (d, J=1.80 Hz, 1H), 7.45 (d, J=2.33 Hz, 1H), 7.03 (d, J=6.15 Hz, 2H), 6.35 (t, J=2.12 Hz, 1H), 5.36 (s, 2H). LCMS-B: R.sub.t 0.587 min, m/z 160.1 [M+H].sup.+.
b) 2-(2-(1H-Pyrazol-1-yl)-2-(pyridin-2-yl)ethyl)isoindoline-1,3-dione A93
[1012] To a solution of 2-((1H-pyrazol-1-yl)methyl)pyridine A92 (0.412 g, 2.59 mmol) in anhydrous THF (10 mL) at −78° C. under nitrogen was added N-(bromomethyl)phthalimide (0.808 g, 3.36 mmol) dropwise. A solution of lithium bis(trimethylsilyl)amide, 1.0 M solution in hexane (3.36 mL, 3.36 mmol) in anhydrous THF (8 mL) was then added dropwise and the mixture allowed to warm slowly to room temperature and stirred overnight. The mixture was diluted with a saturated aqueous NH.sub.4Cl solution (50 mL) and water (25 mL), then extracted with DCM (50 mL×3). The combined organic extracts were washed with brine, dried over anhydrous MgSO.sub.4, concentrated and purified by column chromatography (0-100% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.145 g, 18% yield) as a pale yellow solid. .sup.1H NMR (400 MHz, Chloroform-d) δ 8.61 (s, 2H), 7.81 (dd, J=3.07, 5.47 Hz, 2H), 7.72 (dd, J=3.06, 5.50 Hz, 2H), 7.59 (d, J=1.80 Hz, 1H), 7.51 (dd, J=0.60, 2.43 Hz, 1H), 7.43 (d, J=5.30 Hz, 2H), 6.27 (d, J=2.04 Hz, 1H), 5.99 (dd, J=6.38, 9.09 Hz, 1H), 4.63 (dd, J=9.14, 14.04 Hz, 1H), 4.41 (dd, J=6.40, 14.04 Hz, 1H). LCMS-A: R.sub.t 4.60 min, m/z 318.9 [M+H].sup.+.
c) 2-(1H-Pyrazol-1-yl)-2-(pyridin-2-yl)ethan-1-amine A94
[1013] To a suspension of 2-(2-(1H-pyrazol-1-yl)-2-(pyridin-2-yl)ethyl)isoindoline-1,3-dione A93 (0.15 g, 0.46 mmol) in ethanol (30 mL) was added 64-65% v/v hydrazine hydrate (0.500 mL, 6.58 mmol) and the resulting solution was stirred at room temperature overnight. The mixture was filtered and the solid was washed with ethanol. The filtrate was partitioned between DCM (50 mL) and saturated aqueous NaHCO.sub.3(50 mL). The layers were separated and the aqueous layer was extracted with DCM (100 mL×3). The combined organic extracts were washed with brine, dried over magnesium sulphate and concentrated to give the title compound (0.0550 g, 64% yield) as a yellow oil. .sup.1H NMR (400 MHz, Chloroform-d) δ 8.55 (s, 2H), 7.63 (s, 1H), 7.48 (d, J=2.46 Hz, 1H), 7.11-7.02 (m, 2H), 6.34 (s, 1H), 5.36-5.28 (m, 1H), 3.70 (obscured by solvent), 3.44-3.22 (m, 1H).
d) N-(2-(1H-Pyrazol-1-yl)-2-(pyridin-2-yl)ethyl)-7-bromo-4H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide 244
[1014] Ethyl 7-bromo-2H-benzo[e][1,2,4]thiadiazine-3-carboxylate 1,1-dioxide 15 (65 mg, 0.20 mmol), 2-(1H-pyrazol-1-yl)-2-(pyridin-2-yl)ethan-1-amine A94 (0.055 g, 0.29 mmol) and absolute ethanol (0.5 mL) were heated in the microwave at 100° C. for 30 minutes. The reaction mixture was heated in the microwave once more at 100° C. for 30 minutes, then cooled to room temperature and filtered. The filtrate was dried in vacuo then purified by chromatography (4 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C. followed by 0-10% MeOH in EtOAc) to give the title compound as an off-white solid (2.7 mg, 2% yield). .sup.1H NMR (400 MHz, methanol-d.sub.4) δ 8.50 (d, J=6.3 Hz, 2H), 7.99 (d, J=2.2 Hz, 1H), 7.85-7.80 (m, 2H), 7.64 (d, J=1.8 Hz, 1H), 7.53 (d, J=8.9 Hz, 1H), 7.32 (dd, J=4.8, 1.5 Hz, 2H), 6.38 (t, J=2.2 Hz, 1H), 5.87 (dd, J=8.6, 5.4 Hz, 1H), 4.31 (dd, J=13.9, 8.7 Hz, 1H), 4.14 (dd, J=13.9, 5.4 Hz, 1H). LCMS R.sub.t 2.99 min, m/z 476.7 [M+H].sup.+.
[1015] Assays
[1016] Acetyltransferase Biochemical Assay
[1017] Compounds may be tested for in vitro activity in the following assay:
[1018] To determine the inhibition of HAT enzymatic activity by test compounds, assay reactions were conducted in a volume of 8 μL in 384-well low volume assay plates. The reactions were performed in assay buffer (100 mM Tris-HCl, pH 7.8, 15 mM NaCl, 1 mM EDTA, 0.01% Tween-20, 1 mM Dithiothreitol, and 0.02% m/v chicken egg white albumin). Reactions were set up with 0.4 μM Acetyl coenzyme A (for all assays apart from KAT6A which was set up with 10 μM Acetyl coenzyme A), 100 nM of full-length recombinant histone labelled by limited biotinylation (KAT6A, KAT6B, KAT7: H3.1, KAT5, KAT8: H4), 10/5/8/40/20 nM of KAT5/KAT6A/KAT6B/KAT7/KAT8 enzyme respectively, and an acetyl-lysine specific antibody (H3.1: Cell Signaling Technology, H4: Abcam). 11-point dilution series of the test compounds were prepared in DMSO; a volume of 100 nL was transferred using a pin tool into assay plates containing substrates, before adding enzyme to start the reaction. Positive (no compound) and negative (AcCoA omitted) control reactions were included on the same plates and received the same amount of DMSO as the compound treated wells. After adding all reagents, the plates were sealed with adhesive seals and incubated for 90 min at room temperature. An additional 4 μL of assay buffer containing AlphaScreen® Protein A acceptor beads and Streptavidin donor beads (PerkinElmer, Waltham, Mass.) to a final concentration of 8 μg/mL was then added. After incubation for 2 hours the plates were read using an EnVision 2103 multi label plate reader (PerkinElmer) in HTS AlphaScreen® mode. IC.sub.50 values were obtained from the raw readings by calculating percent inhibition (% I) for each reaction relative to controls on the same plate (% I=(I−CN)/(CP−CN) where CN/CP are the averages of the negative/positive reactions, respectively), then fitting the % l data vs. compound concentration [I] to % I=(A+((B−A)/(1+((C/[I]){circumflex over ( )}D)))) where A is the lower asymptote, B is the upper asymptote, C is the 1050 value, and D is the slope.
[1019] The results are shown in tables 1 to 5 below:
TABLE-US-00011 TABLE 1 (TIP60-KAT5) Example IC50 (μM) 1 0.286 2 >125 3 96.5 4 5.33 5 1.17 6 90.1 7 11.7 8 4.4 9 12.4 10 79.7 11 11.8 12 2.62 13 0.727 14 2.36 15 1.4 16 23.8 17 51 18 >125 19 33.2 20 29.5 22 72.4 23 3.73 24 7.16 25 6.89 26 1.66 27 1.29 28 63.5 29 >125 30 112 31 15.1 32 5.04 33 6.95 34 >125 35 >125 36 19.6 37 44 38 1.96 39 5.88 40 >125 41 0.0613 42 0.642 43 2.39 44 >125 45 109 46 9.71 49 >125 51 25.3 52 125 53 19.8 54 57.9 55 36.5 56 0.269 57 2.8 58 2.58 60 0.327 61 >125 62 >125 63 >125 64 92.1 65 85.4 66 >125 67 >125 68 14.5 69 >125 70 >125 73 10.1 74 >125 75 56.6 76 >125 77 87 78 16.7 79 87.8 80 >125 81 4.9 82 7.82 83 7.38 84 0.778 85 5.97 86 1.17 87 4.47 88 1.19 89 2.06 90 0.96 91 0.209 92 0.367 93 9.2 94 2.82 95 5.18 96 94.7 97 >125 98 >125 99 >125 100 40.5 101 >125 102 27.1 103 >125 104 >125 105 46.3 106 >125 107 20.8 108 77.7 109 3.42 110 75.6 111 16.6 112 18.5 113 >125 114 0.954 115 0.423 116 4.44 118 2.29 119 5.26 120 1.24 121 40.8 122 >125 123 5.01 124 24.6 125 >125 126 31.3 127 61.2 128 >125 129 >125 131 >125 133 >125 134 2.17 135 3.13 136 27.6 137 3.08 138 0.0952 139 1.3 142 4.27 143 13.8 144 1.65 145 18.9 146 0.0468 147 0.445 148 45.7 149 4.88 150 3.17 152 52.8 153 38.7 154 >125 206 36.8
TABLE-US-00012 TABLE 2 (MOZ-KAT6A) Example IC50 (μM) 1 0.0241 2 38.1 3 7.66 4 0.1 5 0.667 7 2.8 9 0.0421 10 0.0906 11 1.81 13 0.229 15 0.211 16 1.37 17 3.33 18 3.12 19 1.35 20 6.05 22 1.98 23 0.056 24 0.127 25 0.0512 26 0.0287 27 0.0195 28 4.42 29 28.6 31 8.23 32 0.0498 33 0.126 34 51.6 35 59.9 36 0.661 37 0.771 38 0.532 41 0.0179 43 0.243 44 125 45 35.2 46 0.324 49 7.67 51 4.82 52 36.1 53 0.273 54 8.87 55 5.66 56 0.0809 61 >125 62 >125 63 >125 64 102 65 53.9 66 >125 67 >125 68 3.81 69 >125 70 >125 74 67.5 75 1.72 76 >125 77 35.5 78 3.74 79 35.4 80 58.8 81 1.61 82 9.19 83 2.61 84 0.256 85 8.1 86 2.7 87 8.93 91 0.594 92 0.783 93 2.2 96 1.17 97 4 98 36.1 99 15.8 100 41.7 101 10.2 102 10.6 103 125 107 12 108 11.6 112 4.58 113 125 114 0.861 115 0.476 116 2.26 131 62.3 133 >125 134 0.149 135 0.168 136 8.03 137 0.107 139 0.464 142 0.0211 143 0.346 144 0.12 145 3.73 146 0.0259 147 0.645 148 5.39 149 0.102 152 47.5 154 >125 206 9.64
TABLE-US-00013 TABLE 3 (HBO-KAT7) Example IC50 (μM) 1 0.0638 4 2.56 5 2.04 7 11.9 8 1.2 9 20.1 11 2.53 12 5.87 13 0.981 14 1.78 24 0.141 25 1.93 26 1.48 28 15.7 29 84.4 30 125 31 5.84 32 4.64 33 6.78 34 60.3 35 31.6 36 0.538 38 0.154 39 0.192 40 9.45 41 0.0944 42 0.255 43 1.99 46 2.65 54 4.01 55 4.51 56 0.219 57 2.53 58 1.59 60 0.555 68 0.462 73 26.4 78 4.56 79 29.5 80 104 84 0.0836 86 1.33 87 12 88 0.659 89 3.37 90 0.915 91 0.339 92 0.675 93 9.59 94 3.8 95 4.22 96 3.17 97 49.4 98 68.6 99 9.16 100 112 101 >125 102 60.2 103 >125 104 >125 105 >125 106 >125 107 23.3 108 50.1 109 5.95 110 101 111 81.4 112 4.11 114 0.529 115 0.229 118 3.02 119 18.5 120 3.52 121 47 122 >125 123 1.72 124 18.7 125 >125 126 12.4 127 34.7 128 >125 129 >125 134 3.32 135 2.53 136 0.633 137 0.913 138 0.234 139 0.0615 142 6.57 143 1.75 146 0.16 147 0.167 153 3.41 173 0.051 174 7.49 175 0.162 176 0.207 177 0.064 178 0.571 206 7.17 216 0.063 217 1.74 233 0.038
TABLE-US-00014 TABLE 4 (MOF-KAT8) Example IC50 (μM) 1 14.6 4 28.8 5 27.7 7 >125 24 69.6 25 78.2 26 23.7 32 74.1 33 89.6 41 4.87 46 88.2 82 >125 84 33.3 86 39.4 87 114 88 47 91 12.1 92 21.8 114 >125 115 31.2 116 56.7 136 >125 137 100 138 8.07 139 19.1 142 56.7 143 30 146 4.19 147 26.1 162 4.20 163 9.78 164 29.6 165 43.1 167 6.48 168 3.39 169 5.14 170 3.75 171 41.7 172 5.13 173 39.1 174 >125 175 29.3 176 92.9 177 6.25 178 106 179 10.4 180 77.0 181 104 182 50.0 183 36.3 184 9.22 186 71.5 187 22.8 188 39.8 189 7.96 190 48.9 203 103 204 >125 208 24.1 212 40.8 213 3.54 214 7.058 215 8.74 216 64.3 217 22.5 218 >125 219 >125 228 6.52 233 6.13 234 57.3 235 6.59 236 20.2 237 6.35 238 41.4 239 >125 243 82.5 244 82.9
TABLE-US-00015 TABLE 5 (QKF-KAT6B) Example IC50 (μM) 18 0.268 46 0.122
[1020] Histone H3 Lysine 14 Acetylation Biomarker Assay
[1021] Compounds may be tested for their ability to inhibit acetylation of the histone H3K14 marker (which is HBO1 mediated) in the following assay:
[1022] The cell line U2OS was seeded at a density of 12,000 cells per well in 96 well optical quality tissue culture plates in RPMI medium and 10% foetal bovine serum, and allowed to adhere for 24 hours under standard culture conditions (37 degree Celsius, 5% CO.sub.2). At the end of this period the cells were washed with serum free medium. Compound dilutions prepared in DMSO were added to the serum free medium, with negative control wells reserved for treatment with DMSO only and positive controls receiving a potent inhibitor compound (e.g. Example 36 in WO2016/198507) at 10 μM concentration. After incubation for 24 hours, the cells were fixed with 3.7% formaldehyde in PBS for 20 minutes at room temperature, washed with phosphate buffer saline containing 0.1% Tween 20 and blocked with Odyssey blocking buffer (LI-COR, Lincoln, Nebr.) containing 0.1% TritonX100. Anti-H3K14ac specific antibody (Cell Signalling Technologies) in Odyssey blocking buffer containing 0.1% Tween 20 was added and incubated for 14 hours at 4 degree Celsius. After washing, a secondary antibody labelled with Alexa647 dye (LifeTechnologies) and Hoechst 33342 (1 μg/mL, SigmaAldrich) were added for 1 hour incubation. Plates were washed and read on a PerkinElmer Phenix high content imaging platform. Using a Columbus image analysis pipeline, individual nuclei were located by Hoechst 33342 stain and the acetylation level was calculated from the Alexa647-related intensity in the same area. The resulting mean intensity per cell was directly converted to percent inhibition relative to controls on the same plate and the data fitted against a four-parameter logistic model to determine the 50% inhibitory concentration (IC.sub.50).
[1023] The results are shown in table 6 below:
TABLE-US-00016 Example IC50 (μM) 1 0.317 4 30 8 9.68 36 9.98 38 1.5 39 2.49 41 0.0861 46 8.16 56 0.65 60 1.61 84 0.765 91 0.615 92 1.39 93 30 101 30 115 1.06 136 7.89 137 2.45 138 0.145 139 0.263 142 17.5 143 14.6 146 0.429 147 0.193
[1024] H.sub.2A.Z Lysine 7 Acetylation Biomarker Assay
[1025] To discover a global TIP60/KAT5 cellular biomarker useful for monitoring PD responses of TIP60 inhibition in vitro and in vivo, various histone modifications were assessed for TIP60 dependence through genetic (TIP60 siRNA and CRISPR/Cas9) or TIP60 pharmacological inhibition. This analysis clearly identified acetylation of the histone variant H.sub.2A.Z at Lysine 7 (H.sub.2A.ZK7ac) as a global histone mark which is TIP60-dependent in both human and mouse cells. To a lesser extent, TIP60 also acetylated lysine 4 and 11 of H.sub.2A.Z.
[1026] Compounds may be tested for their ability to inhibit the histone H.sub.2A.Z Lysine 7 acetylation biomarker (which is TIP60 mediated) in the following assay:
[1027] The cell line U2OS was seeded at a density of 9,000 cells per well in 96 well optical quality tissue culture plates in RPMI medium and 10% foetal bovine serum, and allowed to adhere for 24 hours under standard culture conditions (37 degree Celsius, 5% CO.sub.2). At the end of this period the cells were washed with serum free medium. Compound dilutions prepared in DMSO were added to the serum free medium, with negative control wells reserved for treatment with DMSO only and positive controls receiving a potent inhibitor compound (e.g. Example 146) at 20 μM concentration. After incubation for 24 hours, the cells were fixed with 3.7% formaldehyde in PBS for 20 minutes at room temperature, washed with phosphate buffer saline containing 0.1% Tween 20 and blocked with Odyssey blocking buffer (LI-COR, Lincoln, Nebr.) containing 0.1% TritonX100. Anti-H.sub.2A.Z K7ac specific antibody (Abcam) in Odyssey blocking buffer containing 0.1% Tween 20 was added and incubated for 14 hours at 4 degree Celsius. After washing, a secondary antibody labelled with Alexa647 dye (LifeTechnologies) and Hoechst 33342 (10 μM, SigmaAldrich) were added for 1 hour incubation. Plates were washed and read on a PerkinElmer Phenix high content imaging platform. Using a Columbus image analysis pipeline, individual nuclei were located by Hoechst 33342 stain and the acetylation level was calculated from the Alexa647-related intensity in the same area. The resulting mean intensity per cell was directly converted to percent inhibition relative to controls on the same plate and the data fitted against a four-parameter logistic model to determine the 50% inhibitory concentration (IC.sub.50).
[1028] The results are shown in table 7 below:
TABLE-US-00017 Example IC50 (μM) 1 2.18 4 10 12 26.8 13 5.78 41 1 46 30 60 2.06 91 10 101 30 122 10 137 10 138 1.46 139 5.05 146 0.447 147 1.43
[1029] Further Assays
[1030] Protein Preparation
[1031] KAT5
[1032] Molecular Biology: A codon optimized DNA sequence (for expression in Escherichia cob) encoding amino acid residues 2 to 461 (Uniprot Q92993-2) of human KAT5 isoform was synthesised by GenScript USA Inc (Piscataway, N.J., USA). This was ligated into a modified pET43a E. coli expression vector designed to encode an N-terminal hexahistidine tag followed by a tobacco etch virus protease (TEV) cleavage site and by the KAT5 sequence. The resulting protein sequence is listed below.
TABLE-US-00018 MGHHHHHHGTENLYFQGSAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILS VKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGL PGSRPGSPEREVKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPG RKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECI ELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDL RHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDP FLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLL IEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGE RPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHE RAMLKRLLRIDSKCLHFTPKDWSKRGKWAS*
[1033] Protein Expression: To produce recombinant KAT5 protein, expression plasmid was transformed into E. coli BL21 DE3 strain and grown with shaking at 37° C. in 1 L volumes of Terrific broth (TB) supplemented with 100 μg/mL Ampicillin and 50 μM zinc until an OD600 of 0.8 was reached. Cultures were transferred to 18° C. and protein expression induced by the addition of Isopropyl β-D-1-thiogalactopyranoside to a final concentration of 0.5 mM and the cultures shaken overnight for further 16 hours. Following expression, cell cultures were centrifuged at 5000×g for 20 min and cell pellet stored frozen at −20° C.
[1034] Protein Purification: Protein purification was initiated by thawing the cell pellet (25 g wet weight) in Lysis buffer (50 mM Hepes pH 7.4, 500 mM NaCl, 5 mM imidazole, 5% [v/v] glycerol, 0.1% [w/v] CHAPS, 2 mM 2-mercaptoethanol, 3 mM MgCl.sub.2, 0.5 mg/mL lysozyme, benzonase endonuclease [EMD Millipore], 1 mM PMSF, complete protease inhibitor tablets EDTA-free [Roche]) using a ratio of 6 mL of buffer per 1 g of cells. Cells were further lysed by sonication using a Misonix Liquid Processor (6×30 second pulses, amplitude 60 [70 watts]) and then centrifuged at 48,000×g at 4° C. Supernatant (cell lysate) was mixed with 20 mL of Q-Sepharose FF resin (GE Healthcare) pre-equilibrated with Q buffer (20 mM Hepes pH 7.4, 1 M NaCl). The unbound fraction from Q-Sepharose FF was then incubated with 5 mL of cOmplete His-Tag Purification Resin (Roche), pre-equilibrated with IMAC Wash Buffer (20 mM hepes pH 7.4, 500 mM NaCl, 35 mM imidazole). The resin was washed with IMAC Wash Buffer, and bound KAT5 eluted with IMAC Elution buffer (20 mM hepes pH 7.4, 500 mM NaCl, 300 mM imidazole). IMAC-eluted protein was immediately desalted into Storage buffer (50 mM Na citrate pH 6.5, 500 mM NaCl, 5% [v/v] glycerol) using 2× HiPrep 26/10 desalting columns (GE Healthcare) in series. Desalted protein was further purified by passing through a HiLoad 26/60 Superdex 75 column pre-equilibrated in Storage buffer. Finally, KAT5 protein was concentrated to 1.5 mg/mL using Amicon Ultra centrifugal filter unit (Utra-15 MWCO 10 kDa), flash-frozen in liquid nitrogen and stored in −70° C. freezer.
[1035] KAT6A
[1036] Molecular Biology: The DNA sequence encoding amino acid residues 507 to 778 (Uniprot Q92794-1) of human KAT6A was amplified by PCR and was ligated into a modified pET E. coli expression vector designed to encode a NusA solubility tag followed by a hexahistidine tag and a tobacco etch virus protease (TEV) cleavage site and by the KAT6A sequence. The resulting protein sequence is listed below.
TABLE-US-00019 MNKEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQID RKSGDFDTFRRWLVVDEVTQPTKEITLEAARYEDESLNLGDYVEDQIESV TFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNI SLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPEARGAQLFVTRS KPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGA CVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDE DKHTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMTVDDLQAKHQA EAHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDE PTVEALRERAKNALATIAQAQEESLGDNKPADDLLNLEGVDRDLAFKLAA RGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEATSGSG HHHHHHSAGENLYFQGAMGRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKL YLCEFCLKYMKSRTILQQHMKKCGWFHPPVNEIYRKNNISVFEVDGNVST IYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKH CQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLG RLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRML DFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTP*
[1037] Protein Expression: To produce recombinant KAT6A protein, expression plasmid was transformed into E. coli BL21 DE3 strain and grown with shaking at 37° C. in 1 L volumes of Terrific broth (TB) supplemented with 100 μg/mL Ampicillin until an OD600 of 0.8 was reached. Cultures were transferred to 18° C. and protein expression induced by the addition of Isopropyl β-D-1-thiogalactopyranoside to a final concentration of 0.5 mM and the cultures shaken overnight for further 16 hours. Following expression, cell cultures were centrifuged at 5000×g for 20 min and cell pellet stored frozen at −20° C.
[1038] Protein Purification: Protein purification was initiated by thawing the cell pellet (40 g wet weight) in Lysis buffer (25 mM Tris-HCl pH 7.8, 500 mM NaCl, 5 mM DTT, 0.01% [v/v] Triton-X 100, 5% [v/v] glycerol, 2 mM MgCl.sub.2, 10 mM Imidazole, 0.5 mg/mL lysozyme, benzonase endonuclease [EMD Millipore], 1 mM PMSF, complete protease inhibitor tablets EDTA-free [Roche]) using a ratio of 5 mL of buffer per 1 g of cells. Cells were further lysed by 3 passes (at 15000 psi) through an ice cooled Avestin C.sub.5 cell crusher and then centrifuged at 48,000×g at 4° C. Supernatant (cell lysate) was filtered through a 5 μm filter and applied onto 5 mL HiTrap IMAC Sepharose FF column (GE Healthcare) pre-equilibrated with IMAC wash buffer (25 mM Tris-HCl pH 7.8, 500 mM NaCl, 5 mM DTT, 0.01% [v/v] Triton-X 100, 5% [v/v] glycerol, 20 mM Imidazole) using a Profinia Affinity chromatography purification system (Bio-Rad). The IMAC column was then washed with IMAC Wash buffer and bound KAT6A protein eluted with IMAC Elution buffer (25 mM Tris-HCl pH 7.8, 500 mM NaCl, 5% [v/v] glycerol, 5 mM DTT, 250 mM Imidazole). IMAC-eluted protein was further purified by passing through a HiLoad 26/60 Superdex 200 column pre-equilibrated in Storage buffer (25 mM Tris-HCl pH 7.8, 500 mM NaCl, 5 mM DTT, 5% [v/v] glycerol). Finally, KAT6A protein was concentrated to 1 mg/mL using Amicon Ultra centrifugal filter unit (Utra-15 MWCO 10 kDa), flash-frozen in liquid nitrogen and stored in −70° C. freezer.
[1039] KAT6B was obtained from SignalChem, catalog ID: K315-381BG
[1040] KAT7
[1041] Molecular Biology: A codon optimized DNA sequence encoding amino acid residues 325 to 611 (Uniprot 095251-1) of human KAT7 was synthesised by GenScript USA Inc (Piscataway, N.J., USA). This was ligated into a modified pET43a E. coli expression vector designed to encode an N-terminal hexahistidine tag followed by a tobacco etch virus protease (TEV) cleavage site and by the KAT7 sequence. The resulting protein sequence is listed below.
TABLE-US-00020 MGHHHHHHGTENLYFQGSRLQGQITEGSNMIKTIAFGRYELDTWYHSPYP EEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISV FEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHL IGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGS PERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIV STLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWT PPKGTAS
[1042] Protein Expression: To produce recombinant KAT7 protein, expression plasmid was transformed into E. coli BL21 DE3 RIL strain and grown with shaking at 37° C. in 1 L volumes of Terrific broth (TB) supplemented with 100 μg/mL Ampicillin and 50 μM zinc until an OD600 of 0.8 was reached. Cultures were transferred to 18° C. and protein expression induced by the addition of Isopropyl β-D-1-thiogalactopyranoside to a final concentration of 0.5 mM and the cultures shaken overnight for further 16 hours. Following expression, cell cultures were centrifuged at 5000×g for 20 min and cell pellet stored frozen at −20° C.
[1043] Protein Purification: Protein purification was initiated by thawing the cell pellet (10 g wet weight) in Lysis buffer (50 mM Hepes pH 7.5, 300 mM NaCl, 5 mM DTT, 5 mM Imidazole, 0.05% [v/v] Brij 35, 10% [v/v] glycerol, 3 mM MgCl.sub.2, 0.5 mg/mL lysozyme, benzonase endonuclease [EMD Millipore], 1 mM PMSF, complete protease inhibitor tablets EDTA-free [Roche]) using a ratio of 10 mL of buffer per 1 g of cells. Cells were further lysed by sonication using a Misonix Liquid Processor (6×30 second pulses, amplitude 60 [70 watts]) and then centrifuged at 48,000×g at 4° C. Supernatant (cell lysate) was incubated with 1 mL of cOmplete His-Tag Purification Resin (Roche), pre-equilibrated with IMAC Wash Buffer 1 (25 mM Hepes pH 7.5, 800 mM NaCl, 5 mM imidazole, 10% [v/v] glycerol, 5 mM DTT, 0.01% [v/v] Brij 35, 50 mM arginine, 50 mM glutamic acid). The resin was sequentially washed with IMAC Wash buffer 1 and IMAC Wash buffer 2 (25 mM hepes pH 7.5, 300 mM NaCl, 20 mM imidazole, 10% [v/v] glycerol, 5 mM DTT, 0.01% [v/v] Brij 35, 50 mM arginine, 50 mM glutamic acid). Bound KAT7 protein was eluted with IMAC Elution buffer (25 mM hepes pH 7.5, 200 mM NaCl, 500 mM imidazole, 10% [v/v] glycerol, 5 mM DTT 0.01% [v/v] Brij 35, 50 mM arginine, 50 mM glutamic acid). The eluting protein was collected directly into 4 volumes of Desalt Buffer (50 mM Na citrate pH 6.5, 200 mM NaCl, 0.01% [v/v] Brij 35, 10% [v/v] glycerol, 5 mM DTT) to bring the final imidazole concentration to 100 mM. IMAC-eluted protein was immediately desalted into Desalt buffer using 2× HiPrep 26/10 desalting columns (GE Healthcare) in series. Desalted protein was further purified by passing through a HiLoad 26/60 Superdex 75 column pre-equilibrated in Storage Buffer (50 mM Na citrate pH 6.5, 200 mM NaCl, 10% [v/v] glycerol, 5 mM DTT). Finally, KAT7 protein was concentrated to 3.5 mg/mL using Amicon Ultra centrifugal filter unit (Utra-15 MWCO 10 kDa), flash-frozen in liquid nitrogen and stored in −70° C. freezer.
[1044] KAT8
[1045] Molecular Biology: A codon optimized DNA sequence (for expression in E. coli) encoding amino acid residues 177 to 447 (Uniprot Q9H7Z6-1) of human KAT8 was synthesised by Thermo Fisher Scientific GENEART GmbH (Regensberg, Germany). This was ligated into pPROEX Hta E. coli expression vector designed to encode an N-terminal hexahistidine tag followed by a tobacco etch virus protease (TEV) cleavage site and by the KAT8 sequence. The resulting protein sequence is listed below.
TABLE-US-00021 MSYYHHHHHHDYDIPTTENLYFQGAKYVDKIHIGNYEIDAWYFSPFPEDY GKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEV DGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGY FSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEK PLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQ SLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAP*
[1046] Protein Expression: To produce recombinant KAT8 protein, expression plasmid was transformed into E. coli BL21 DE3 strain and grown with shaking at 37° C. in 1 L volumes of
[1047] Terrific broth (TB) supplemented with 100 μg/mL Ampicillin until an OD600 of 0.8 was reached. Cultures were transferred to 18° C. and protein expression induced by the addition of Isopropyl β-D-1-thiogalactopyranoside to a final concentration of 0.5 mM and the cultures shaken overnight for further 16 hours. Following expression, cell cultures were centrifuged at 5000×g for 20 min and cell pellet stored frozen at −20° C.
[1048] Protein Purification: Protein purification was initiated by thawing the cell pellet (34 g wet weight) in Lysis buffer (20 mM Hepes pH 7.5, 500 mM NaCl, 5 mM Imidazole, 5% [v/v] glycerol, 0.01% [v/v] Triton-X 100, 5 mM 2-mercaptoethanol, 2 mM MgCl.sub.2, 0.5 mg/mL lysozyme, benzonase endonuclease [EMD Millipore], 1 mM PMSF, complete protease inhibitor tablets EDTA-free [Roche]) using a ratio of 3 mL of buffer per 1 g of cells. Cells were further lysed by 3 passes (at 15000 psi) through an ice cooled Avestin C.sub.5 cell crusher and then centrifuged at 48,000×g at 4° C. Supernatant (cell lysate) was filtered through a 0.2 μm filter and applied onto 5 mL HiTrap IMAC Sepharose FF column (GE Healthcare) pre-equilibrated with IMAC wash buffer 1 (20 mM Hepes pH 7.5, 500 mM NaCl, 0.5 mM TCEP, 5 mM Imidazole) using a Profinia Affinity chromatography purification system (Bio-Rad). The IMAC column was then sequentially washed with IMAC Wash buffer 1 and IMAC Wash buffer 2 (20 mM Hepes pH 7.5, 500 mM NaCl, 0.5 mM TCEP, 10 mM Imidazole) and bound KAT8 protein eluted with IMAC Elution buffer (20 mM Hepes pH 7.5, 500 mM NaCl, 0.5 mM TCEP, 500 mM Imidazole). IMAC-eluted protein was further purified by passing through a HiLoad 26/60 Superdex 200 column pre-equilibrated in Storage buffer (20 mM Hepes pH 7.5, 500 mM NaCl, 1 mM TCEP). Finally, KAT8 protein was concentrated to 0.2 mg/mL using Amicon Ultra centrifugal filter unit (Utra-15 MWCO 10 kDa), flash-frozen in liquid nitrogen and stored in −70° C. freezer.
[1049] Revised Acetyltransferase Biochemical Assay
[1050] To determine the inhibition of KAT enzymatic activity by test compounds, assay reactions were conducted in a volume of 8 μL in 384-well low volume assay plates. The reactions were performed in assay buffer (100 mM Tris-HCl, pH 7.8, 15 mM NaCl, 1 mM EDTA, 0.01% Tween-20, 1 mM Dithiothreitol, and 0.01% m/v chicken egg white albumin).
[1051] Reactions were set up with 1 μM Acetyl coenzyme A, 100 nM of full-length recombinant histone labelled by limited biotinylation (KAT6A, KAT6B, KAT7: H3.1, KAT5, KAT8: H4), 10/5/8/40/20 nM of KAT5/KAT6A/KAT6B/KAT7/KAT8 enzyme respectively, and an acetyl-lysine specific antibody (H3.1: Cell Signaling Technology, H4: Abcam). 11-point dilution series of the test compounds were prepared in DMSO; a volume of 100 nL was transferred using a pin tool into assay plates containing substrates, before adding enzyme to start the reaction. Positive (no compound, DMSO only) and negative (AcCoA omitted) control reactions were included on the same plates and received the same amount of DMSO as the compound treated wells. After adding all reagents, the plates were sealed with adhesive seals and incubated for 90 min at room temperature. An additional 4 μL of assay buffer containing AlphaScreen® Protein A acceptor beads and Streptavidin donor beads (PerkinElmer, Waltham, Mass.) to a final concentration of 8 μg/mL was then added. After incubation for 2 hours the plates were read using an EnVision 2103 multi label plate reader (PerkinElmer) in HTS AlphaScreen® mode. IC.sub.50 values were obtained from the raw readings by calculating percent inhibition (% I) for each reaction relative to controls on the same plate (% I=(I−CN)/(CP−CN) where CN/CP are the averages of the negative/positive reactions, respectively), then fitting the %1 data vs. compound concentration [I] to % I=(A+((B−A)/(1+((C/[I]){circumflex over ( )}D)))) where A is the lower asymptote, B is the upper asymptote, C is the IC.sub.50 value, and D is the slope.
[1052] The results are shown in tables 8 to 12 below:
TABLE-US-00022 TABLE 8 (MOZ-KAT6A) Example IC50 (μM) 1 0.005 2 5.139 3 4.954 5 0.069 6 18.658 7 0.316 8 0.011 13 0.010 14 0.010 15 0.682 19 0.270 20 0.490 23 0.120 24 0.110 25 0.064 26 0.041 32 0.030 33 0.047 34 5.782 36 0.074 39 0.032 41 0.005 43 0.014 46 0.064 49 1.685 50 6.186 56 0.010 57 0.403 59 0.032 60 0.010 68 0.108 75 0.308 78 0.203 81 0.552 84 0.017 86 0.096 91 0.024 93 0.098 96 0.149 97 0.417 113 98.977 118 0.046 120 0.017 129 0.250 134 0.024 135 0.047 139 0.100 144 0.021 145 0.649 146 0.002 147 0.029 150 1.022 153 0.054 155 0.595 157 8.797 158 1.732 159 0.371 160 0.471 161 0.269 162 0.029 163 0.017 164 0.017 165 0.031 166 0.007 167 0.004 168 0.008 169 0.023 170 0.143 171 0.024 172 0.005 173 0.011 174 0.573 175 0.013 176 0.076 177 0.004 178 0.021 179 0.005 180 0.229 181 0.032 182 0.006 183 0.044 184 0.008 185 0.042 186 0.024 187 0.015 188 0.041 189 0.075 190 0.008 191 0.043 192 0.613 193 0.493 194 5.564 195 0.209 196 0.080 197 0.290 198 0.351 199 0.838 200 9.800 201 0.268 202 1.043 203 0.427 204 0.122 205 0.970 206 1.391 208 1.597 209 0.378 210 0.303 211 2.180 212 0.241 213 0.002 214 0.009 215 0.004 216 0.028 217 0.265 218 0.153 219 3.586 220 0.020 221 0.572 222 0.131 223 0.216 224 0.165 225 0.447 226 0.075 227 1.362 228 0.007 230 0.761 231 0.100 232 0.252 233 0.013 234 0.072 235 0.009 236 0.010 237 0.010 238 0.188 239 0.017 240 0.021 241 0.082 242 2.774 243 12.281 244 6.828
TABLE-US-00023 TABLE 9 (HBO-KAT7) Example IC50 (μM) 1 0.076 2 28.029 3 49.934 6 21.294 7 1.176 8 0.134 13 0.128 14 0.083 15 0.874 19 1.003 20 1.253 23 2.884 24 0.583 25 12.045 26 5.071 32 0.356 33 0.551 34 11.469 36 3.380 39 0.299 41 0.059 43 0.086 46 1.078 49 3.133 50 49.069 56 0.063 57 0.840 59 0.403 60 0.201 68 0.601 75 1.148 78 3.526 81 4.600 84 0.062 86 0.787 91 0.074 93 1.794 96 1.114 113 6.411 118 0.412 120 0.140 129 24.812 134 0.720 135 0.419 139 0.184 144 1.387 146 0.036 147 0.057 150 3.594 153 0.672 155 9.516 157 22.305 158 5.465 159 0.295 160 1.662 161 4.387 162 0.512 163 0.115 164 0.242 165 1.768 166 0.183 167 0.062 168 0.621 169 0.386 170 1.635 171 0.785 172 0.041 173 0.161 174 4.150 175 0.478 176 0.869 177 0.124 178 0.112 179 0.028 180 0.557 181 0.320 182 0.237 183 0.718 184 0.114 185 0.264 186 1.962 187 0.115 188 0.215 189 0.214 190 0.414 191 0.243 192 2.304 193 1.937 194 26.048 195 2.215 196 0.025 197 7.530 198 8.374 199 6.566 200 >125 201 56.499 202 >125 203 1.671 204 59.533 205 2.728 206 1.207 208 4.509 209 1.675 210 1.121 211 6.072 212 1.091 213 0.111 214 0.050 215 0.020 216 0.152 217 1.189 218 9.410 219 104.980 220 0.214 221 0.072 222 0.023 223 1.008 224 0.204 225 1.460 226 1.926 227 4.485 228 0.092 230 2.300 231 0.143 232 0.393 233 0.014 234 0.089 235 0.115 236 0.073 237 0.121 238 0.881 239 0.686 240 0.134 241 0.948 242 32.984 243 77.338 244 3.835
TABLE-US-00024 TABLE 10 (TIP60-KAT5) Example IC50 (μM) 1 0.068 2 60.736 3 99.577 5 0.493 6 >125 7 5.922 8 2.009 13 0.111 14 0.156 15 5.547 19 14.646 20 13.769 23 1.733 24 5.402 25 5.914 26 5.936 32 5.330 33 3.780 34 70.321 36 5.471 39 3.060 41 0.032 43 0.266 46 4.050 49 >125 50 >125 56 0.061 57 0.725 59 0.721 60 0.058 68 7.215 75 14.078 78 4.541 81 6.652 84 0.426 86 0.521 91 0.090 93 1.999 96 13.329 97 26.114 113 >125 118 0.208 120 0.224 129 58.315 134 0.648 135 0.646 139 0.707 144 1.061 145 7.455 146 0.013 147 0.132 150 1.375 153 3.374 155 2.685 157 >125 158 26.795 159 3.201 160 13.225 161 9.163 162 1.541 163 0.221 164 0.781 165 6.015 166 0.714 167 0.056 168 0.458 169 0.412 170 13.255 171 1.161 172 0.025 173 0.651 174 15.259 175 0.311 176 5.114 177 0.023 178 0.852 179 0.029 180 0.249 181 0.123 182 0.284 183 0.068 184 0.099 185 0.994 186 0.734 187 0.242 188 1.439 189 2.845 190 0.303 191 0.919 192 11.112 193 4.167 194 125.000 195 1.847 196 0.818 197 23.574 198 42.346 199 15.551 200 >125 201 43.711 202 >125 203 3.750 204 >125 205 30.020 206 13.658 208 13.297 209 8.447 210 10.867 211 24.658 212 4.003 213 0.193 214 0.070 215 0.025 216 0.506 217 1.458 218 16.764 219 >125 220 1.432 221 1.573 222 0.149 223 3.325 224 9.008 225 5.124 226 3.728 227 98.725 228 0.111 230 4.899 231 0.306 232 2.741 233 0.154 234 1.368 235 0.034 236 0.113 237 0.163 238 1.815 239 0.597 240 0.309 241 1.011 242 122.908 243 39.941 244 14.557
TABLE-US-00025 TABLE 11 (MOF-KAT8) Example IC50 (μM) 1 4.541 2 >125 3 12.168 7 81.608 8 10.526 13 36.448 14 37.823 19 >125 20 62.808 25 >125 26 39.893 32 >125 33 >125 41 9.785 43 71.630 46 99.430 56 1.303 57 11.346 59 26.833 60 23.981 68 16.547 75 >125 78 >125 84 77.003 86 42.366 91 21.080 93 >125 96 >125 113 >125 118 >125 120 41.456 129 >125 134 15.671 139 75.833 144 46.671 146 2.857 147 28.611 153 20.085 157 >125 158 30.651 159 16.307 160 4.889 161 22.952 162 34.488 163 14.704 164 34.379 165 >125 166 36.777 167 8.402 168 26.451 169 43.737 170 >125 171 >125 172 6.098 173 30.359 175 30.171 176 30.179 177 8.206 178 60.964 179 9.661 181 31.222 182 24.460 183 30.515 184 10.244 187 14.120 188 54.274 189 28.697 190 68.365 196 78.602 203 114.969 204 >125 213 15.171 214 20.058 215 5.724 216 58.551 218 >125 219 >125 220 26.838 225 >125 226 >125 227 >125 228 9.660 231 6.533 232 34.952 233 9.251 234 23.550 235 3.227 236 19.618 237 15.260 238 25.625 239 75.640 240 62.623
TABLE-US-00026 TABLE 12 (QKF-KAT6B) Example IC50 (μM) 1 0.060 8 0.210 14 0.058 25 0.610 26 0.120 32 0.155 36 0.724 41 0.028 46 0.589 60 0.039 91 0.350 93 1.782 113 >125 144 0.459 146 0.019 147 0.311 159 4.049 163 0.117 166 0.072 167 0.027 168 0.037 172 0.281 179 0.088 181 0.077 182 0.059 196 0.991 197 0.780 198 1.383 199 6.172 201 5.259 202 >125 203 3.313 204 >125 213 0.022 215 0.065 220 0.134 221 4.335 231 3.239 233 0.254 238 5.869
[1053] Histone H3 Lysine 14 Acetylation Biomarker Assay
[1054] Compounds may be tested for their ability to inhibit acetylation of the histone H3 Lysine 14 (which is HBO1 mediated) marker in the following assay:
[1055] The cell line U2OS was seeded at a density of 3,000 cells per well in 384-well optical quality tissue culture plates in RPMI medium supplemented with 10% foetal bovine serum and 10 mM Hepes. The cells were allowed to adhere for 24 hours under standard culture conditions (37 degree Celsius, 5% CO2). At the end of this period the cells were washed with serum free medium. Compound dilutions prepared in DMSO were added to the serum free medium, with negative control wells reserved for treatment with DMSO only and 100% inhibition positive controls receiving a potent inhibitor compound (e.g. (Z)-4-fluoro-N-((3-hydroxyphenyl)sulfonyl)-5-methyl-[1,1′-biphenyl]-3-carbohydrazonic acid) at 10 μM concentration. After incubation for 24 hours, the cells were fixed with 4% formaldehyde in PBS for 15 minutes at room temperature, washed with phosphate buffer saline and blocked with blocking buffer containing 0.2% TritonX100 and 2% BSA. Anti-H3K14ac specific antibody (Cell Signalling Technologies) in blocking buffer was added and incubated overnight at 4 degree Celsius. After washing, a secondary antibody labelled with AlexaFluor 488 dye (ThermoFisher) and Hoechst 33342 (1 μg/mL, Life Technologies) were added for 2 hours incubation at room temperature. Plates were washed and read on a
[1056] PerkinElmer Opera HCS high content imaging platform. Using a Columbus image analysis pipeline, individual nuclei were located by Hoechst 33342 stain and the acetylation level was calculated from the AlexaFluor 488-related intensity in the same area. The resulting mean intensity per cell was converted to percent inhibition relative to controls on the same plate and the data fitted against a four-parameter logistic model to determine the 50% inhibitory concentration (IC50).
[1057] The results are shown in Table 13 below:
TABLE-US-00027 TABLE 13 Example IC50 (μM) 162 6.52 163 0.892 164 2.08 166 0.611 167 0.349 168 6.44 169 1.30 171 10.4 172 2.87 175 1.84 176 4.43 177 1.03 179 0.219 181 35.3 182 0.488 186 >40.0 187 0.491 188 0.427 189 >20.0 190 4.95 193 31.2 196 0.095 201 >40.0 203 2.26 212 4.15 213 4.94 214 3.60 215 0.221 216 14.1 217 1.29 220 0.917 221 1.66 222 0.437 225 >40.0 226 24.4 228 3.25 231 3.88 233 3.20 237 0.498 238 13.7 239 19.2 240 3.32 244 >40.0
[1058] H.sub.2A.Z Lysine 7 Acetylation Biomarker Assay
[1059] Compounds may be tested for their ability to inhibit the histone H.sub.2A.Z Lysine 7 acetylation marker (which is TIP60 mediated) in the following assay:
[1060] The cell line U2OS was seeded at a density of 3,000 cells per well in 384-well optical quality tissue culture plates in RPMI medium supplemented with 10% foetal bovine serum and 10 mM Hepes. The cells were allowed to adhere for 24 hours under standard culture conditions (37 degree Celsius, 5% CO.sub.2). At the end of this period the cells were washed with serum free medium. Compound dilutions prepared in DMSO were added to the serum free medium, with negative control wells reserved for treatment with DMSO only and 100% inhibition positive controls receiving a potent inhibitor compound enantiomer 1 of 7-iodo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide, which is compound 146, at 30 μM concentration. After incubation for 24 hours, the cells were fixed with 4% formaldehyde in PBS for 15 minutes at room temperature, washed with phosphate buffer saline and blocked with blocking buffer containing 0.2% TritonX100 and 2% BSA. Anti-H.sub.2A.ZK7ac specific antibody (Abcam) in blocking buffer was added and incubated overnight at 4 degree Celsius. After washing, a secondary antibody labelled with AlexaFluor 488 dye (ThermoFisher) and Hoechst 33342 (1 μg/mL, Life Technologies) were added for 2 hours incubation at room temperature. Plates were washed and read on a PerkinElmer Opera HCS high content imaging platform. Using a Columbus image analysis pipeline, individual nuclei were located by Hoechst 33342 stain and the acetylation level was calculated from the AlexaFluor 488-related intensity in the same area. The resulting mean intensity per cell was converted to percent inhibition relative to controls on the same plate and the data fitted against a four-parameter logistic model to determine the 50% inhibitory concentration (IC.sub.50).
[1061] The results are shown in Table 14 below:
TABLE-US-00028 TABLE 14 Example IC50 (μM) 162 10.9 163 1.52 164 2.82 166 5.35 167 0.516 168 8.85 169 9.88 171 >40.0 172 2.09 175 11.9 176 15.4 177 1.18 178 20.5 179 1.10 180 37.5 181 >40.0 182 8.10 183 33.2 184 8.28 186 >40.0 187 5.46 189 >40.0 190 31.1 191 >40.0 193 >40.0 196 0.882 201 >40.0 203 >40.0 204 >40.0 213 29.5 214 8.78 215 4.44 216 15.9 217 32.1 220 7.81 221 6.87 222 1.28 225 >40.0 226 >40.0 228 5.71 231 4.52 233 1.99 234 6.15 235 1.08 236 7.85 237 3.41 240 11.21 241 >40.0
[1062] Histone H3 Lysine 23 Acetylation Biomarker Assay
[1063] Compounds may be tested for their ability to inhibit acetylation of the histone H3K23 marker, which is KATE mediated, in the following assay:
[1064] The cell line U2OS was seeded at a density of 9,000 cells per well in 96 well optical quality tissue culture plates in RPMI medium and 10% foetal bovine serum, and allowed to adhere for 24 hours under standard culture conditions (37 degree Celsius, 5% CO.sub.2). At the end of this period the medium was aspirated. Compound dilutions prepared in DMSO were added to medium, with negative control wells reserved for treatment with DMSO only and 100% inhibition positive controls receiving a potent inhibitor compound (e.g. cas 2055397-28-7, benzoic acid, 3-fluoro-5-(2-pyridinyl)-, 2-[(2-fluorophenyl)sulfonyl]hydrazide) (Baell, J., Nguyen, H. N., Leaver, D. J., Cleary, B. L., Lagiakos, H. R., Sheikh, B. N., Thomas. T. J., Aryl sulfonohydrazides, WO2016198507A1, 2016) at 10 μM concentration and 200 μL transferred to the cells. After incubation for 24 hours, the cells were fixed with 3.7% formaldehyde in PBS for 20 minutes at room temperature, washed (5×5 minutes) with phosphate buffer saline containing 0.1% Tween 20 and blocked with Odyssey blocking buffer (LI-COR, Lincoln, Nebr.) containing 0.1% TritonX100. Anti-H3K23ac specific antibody (Abcam ab177275) in Odyssey blocking buffer containing 0.1% Tween 20 was added and incubated for 16 hours at 4 degree Celsius. After washing (as above), a secondary antibody labelled with Alexa647 dye (LifeTechnologies) and Hoechst 33342 (1 μg/mL, SigmaAldrich) were added for 1 hour incubation. Plates were washed as previously and read on a PerkinElmer Phenix high content imaging platform. Using a Columbus image analysis pipeline, individual nuclei were located by Hoechst 33342 stain and the acetylation level was calculated from the Alexa647-related intensity in the same area. The resulting mean intensity per cell was directly converted to percent inhibition relative to controls on the same plate and the data fitted against a four-parameter logistic model to determine the 50% inhibitory concentration (IC50).
[1065] The results are shown in Table 15 below:
TABLE-US-00029 TABLE 15 Example IC50 (μM) 1 0.064 8 5.865 14 1.063 25 3.822 26 1.078 32 >10 36 0.263 41 0.035 46 0.178 57 >10 60 1.418 91 7.687 93 >10 97 >10 113 >10 144 0.104 146 0.016 147 0.482 159 5.089 163 0.453 166 0.093 167 0.057 168 0.525 172 >10 175 0.154 177 0.195 179 0.112 181 >10 182 0.084 186 >10 193 9.078 196 1.009 197 3.040 198 5.198 199 10.000 201 >10 202 >10 203 >10 204 >10 213 0.116 215 0.953 220 0.540 221 >10 222 7.148 231 >10
REFERENCES
[1066] Aggarwal and Calvi, Nature, 2004, 430, 372-376 doi:10.1038/nature02694 [1067] Avvakumov et al., Oncogene, 2007, 26, 5395-5407 doi:10.1038/sj.onc.1210608 [1068] Berge et al., J. Pharm. Sci., 1977, 66, 1-19 doi:10.1002/jps.2600660104 [1069] Borrow et al., Nat. Genet., 1996, 14, 33-41 doi:10.1038/ng0996-33 [1070] Dekker et al., Drug, Discov. Today, 2014, 19, 654-660 doi:10.1016/j.drudis.2013.11.012 [1071] Doyon et al., Mol. Cell., 2006, 21, 51-64 doi:10.1016/j.molcel.2005.12.007 [1072] Dhuban et al., Sci. Immunol., 2017, 2, 9297 doi:10.1126/sciimmunol.aai9297 [1073] Duong et al., Cancer Res., 2013, 73, 5556-5568 doi:10.1158/0008-5472.CAN-13-0013 [1074] Ghizzoni et al., Eur. J. Med. Chem., 2012, 47, 337-344 doi:10.1016/j.ejmech.2011.11.001 [1075] Gil et al., J. Proteomics, 2017, 150, 297-309 doi:10.1016/j.jprot.2016.10.003 [1076] Gobert, M. et al., Cancer Research, 2009, 69, 2000-2009 doi:10.1158/0008-5472.CAN-08-2360 [1077] Holbert et al., J. Biol. Chem., 2007, 282, 36603-36613 doi:10.1074/jbc.M705812200 [1078] Iizuka et al., Mol. Cell. Biol., 2006, 26, 1098-1108 doi:10.1128/MCB.26.3.1098-1108.2006 [1079] Iizuka et al., Cancer Sci., 2013, 104, 1647-1655 doi:10.1111/cas.12303 [1080] Jeong, et al., Blood Res 2016 51(3), 152-154 doi:10.5045/br.2016.51.3.152 [1081] Joshi, et al., Immunity 2015, 43, 579-590 doi:10.1016/j.immuni.2015.08.006 [1082] Li, B. et al., PNAS, 2007, 104, 4571-4576 doi:10.1073/pnas.0700298104 [1083] Melero, et al. Nature Reviews Cancer, 2015, 15, 457-472 doi:10.1038/nrc3973 [1084] Merson et al., J. Neurosci., 2006, 26, 11359-11370 doi:10.1523/JNEUROSCI.2247-06.2006 [1085] Miller, A. M. et al. J. Immunol., 2006, 177, 7398-7405 doi:10.4049/jimmunol.177.10.7398 [1086] Persa, E. et al. Cancer Letters, 2015 368(2), 252-261 doi:10.1016/j.canlet.2015.03.003 [1087] Sheikh et al., Blood, 2015, 125(12), 1910-21 doi:10.1182/blood-2014-08-594655 [1088] Shi et al, Nature Biotech, 2015, 33, 661-667 doi:10.1038/nbt.3235 [1089] Su et al., Int. J. Mol. Sci., 2016, 17, 1-18 doi:10.3390/ijms17101594 [1090] Stern et al., Crit. Rev. Oncol. Hematol., 2005, 54, 11-29 doi:10.1016/j.critrevonc.2004.10.011 [1091] Thomas et al., Development, 2000, 127, 2537-2548 PMID:10821753 [1092] Tao, H. et al., Lung Cancer, 2012, 75, 95-101 doi:10.1016/j.lungcan.2011.06.002 [1093] Turner-Ivey et al., Neoplasia, 2014, 16(8): 644-655 doi:10.1016/j.neo.2014.07.007 [1094] Valerio et al., Cancer Research, 2017, 77(7), 1753-62 doi:10.1158/0008-5472.CAN-16-2374 [1095] Vizmanos et al., Genes Chromosomes Cancer, 2003, 36(4), 402-405 doi:10.1002/gcc.10174 [1096] Voss et al., BioEssays, 2009, 31(10), 1050-1061 doi:10.1002/bies.200900051 [1097] Wang, L., et al. EBioMedicine, 2016, 13, 99-156 doi:10.1016/j.ebiom.2016.10.018 [1098] Wang, X. et al., Oncogene, 2017, 36, 3048-3058 doi:10.1038/onc.2016.458 [1099] Xiao, Y. et al., Cell reports, 2014, 7, 1471-1480 doi:10.1016/j.celrep.2014.04.021 [1100] Yan, M. et al., Breast Cancer Research, 2011, 13, R47 doi:10.1186/bcr2869 [1101] Zack et al., Nature Genetics 2013 45, 1134-1140 doi:10.1038/ng.2760 [1102] Zhang et al., Mini. Rev. Med. Chem., 2017, 17, 1-8 doi:10.2174/1389557516666160923125031