METHOD FOR PRODUCING LONG-CHAIN PEPTIDE

20210380632 · 2021-12-09

Assignee

Inventors

Cpc classification

International classification

Abstract

The objective of the present invention is to provide a method for efficiently producing a long-chain peptide which method is suitable even for an industrial large scale production. The method for producing a long-chain peptide according to the present invention is characterized in comprising a step to deprotect an N-terminal site protected with BOC of a raw material peptide fragment with using a sulfonic acid compound, a step to selectively deprotect a C-terminal site protected with ONBn of a raw material peptide, and a step to condensate the obtained peptide fragment having the deprotected N-terminal site and the obtained peptide fragment having the deprotected C-terminal site in a liquid phase condition.

Claims

1. A method for producing a long-chain peptide, the method comprising: selectively deprotecting an N-terminal site of a compound of formula (I) in a reaction mixture using at least one sulfonic acid compound and then adding a basic compound to neutralize the reaction mixture to obtain a compound of formula (II) in the reaction mixture; selectively deprotecting a C-terminal site of a compound of formula (III) to obtain a compound of formula (IV); and adding the compound of formula (IV) to the reaction mixture to condensate the compounds of formula (II) and (IV) to obtain a compound of formula (VI), wherein:
formula (I) is Boc-(AA.sup.1).sub.m-Pro.sup.1  (I),
formula (II) is H-(AA.sup.1).sub.m-Pro.sup.1  (II),
formula (III) is Boc-(AA.sup.2).sub.n-ONBn  (III),
formula (IV) is Boc-(AA.sup.2).sub.n-OH  (IV), and
formula (VI) is Boc-(AA.sup.2).sub.n-(AA.sup.1).sub.m-Pro.sup.1  (VI); and wherein: Boc is a t-butoxycarbonyl group as a protective group at the N-terminal site, (AA.sup.1).sub.m is a peptide chain wherein a reactive side chain functional group is protected, m is an integer of 2 or more and 50 or less, Pro.sup.1 is a protective group at a C-terminal site, (AA.sup.2).sub.n is a peptide chain wherein a reactive side chain functional group is protected, n is an integer of 2 or more and 50 or less, and NBn is a nitrobenzyl group represented of formula (V) wherein p, q and r are independently 0 or 1, and p+q+r is 1, 2 or 3: ##STR00005##

2. The method according to claim 1, wherein the C-terminal site is selectively deprotected by using a combination of a metal and an acid or a dithionous acid compound.

3. The method according to claim 1, wherein the at least one sulfonic acid compound is selected from the group consisting of methanesulfonic acid, trifluoromethanesulfonic acid and p-toluenesulfonic acid.

4. The method according to claim 1, the basic compound is an organic amine compound.

5. The method according to claim 4, wherein the organic amine compound is triethylamine and/or diisopropylamine.

6. (canceled)

7. The method according to claim 1, wherein each step is repeated multiple times, wherein the protective group (Pro.sup.1) at the C-terminal site of the compound of formula (VI) comprises NH.sub.2 or ONBn.

8. The method according to claim 1, the method further comprising deprotecting the reactive side chain functional group of at least the compound represented by the formula (VI).

9. The method according to claim 1, wherein the adding step comprises at least one amide solvent.

10. The method according to claim 9, wherein the at least one amide solvent is selected from the group consisting of dimethylformamide, dimethylacetamide and dibutylformamide.

11. The method according to claim 1, wherein the long-chain peptide is exenatide.

12. (canceled)

13. The method according to claim 1, the method further comprising (i) producing a peptide fragment F.sup.9, wherein the compound of formula (I) is a peptide fragment F.sup.1 having an N-terminal site protected with Boc and a C-terminal site protected with NH.sub.2 wherein, the compound of formula (III) is a peptide fragment F.sup.2 having an N-terminal site protected with Boc and a C-terminal site protected with ONBn, and wherein the long-chain peptide has the following amino acid sequence: TABLE-US-00030 F.sup.9: (SEQ ID NO: 8) Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, (ii) producing a peptide fragment F.sup.10, wherein the compound of formula (I) is a peptide fragment F.sup.3 having an N-terminal site protected with Boc and a C-terminal site protected with NH.sub.2 wherein, the compound of formula (III) is a peptide fragment F.sup.4 having an N-terminal site protected with Boc and a C-terminal site protected with ONBn, and wherein the long-chain peptide has the following amino acid sequence: TABLE-US-00031 F.sup.10: (SEQ ID NO: 9) Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly, (iii) producing a peptide fragment F.sup.12, wherein the compound of formula (I) is a peptide fragment r having an N-terminal site protected with Boc and a C-terminal site protected with NH.sub.2 wherein, the compound of formula (III) is a peptide fragment F.sup.8 having an N-terminal site protected with Boc and a C-terminal site protected with ONBn, and wherein the long-chain peptide has the following amino acid sequence: TABLE-US-00032 F.sup.11: (SEQ ID NO: 10) His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu, (iv) producing a peptide fragment F.sup.12, wherein the compound of formula (I) is a peptide fragment F.sup.10 having an N-terminal site protected with Boc and a C-terminal site protected with NH.sub.2 as the compound represented by the formula (I) and using wherein, the compound of formula (III) is a peptide fragment F.sup.5 having an N-terminal site protected with Boc and a C-terminal site protected with ONBn, and wherein the long-chain peptide has the following amino acid sequence: TABLE-US-00033 F.sup.12: (SEQ ID NO: 11) Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn- Gly, (v) producing peptide fragment F.sup.13, wherein the compound of formula (I) is a peptide fragment F.sup.9 having an N-terminal site protected with Boc and a C-terminal site protected with NH.sub.2 wherein, the compound of formula (III) is a peptide fragment F.sup.2 having an N-terminal site protected with Boc and a C-terminal site protected with ONBn, and wherein the long-chain peptide has the following amino acid sequence: TABLE-US-00034 F.sup.13: (SEQ ID NO: 12) Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn- Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, (vi) producing a peptide fragment F.sup.14, wherein the compound of formula (I) is a peptide fragment F.sup.13 having an N-terminal site protected with Boc and a C-terminal site protected with NH.sub.2 wherein, the compound of formula (III) is a peptide fragment F.sup.6 having an N-terminal site protected with Boc and a C-terminal site protected with ONBn, and wherein the long-chain peptide has the following amino acid sequence: TABLE-US-00035 F.sup.14: (SEQ ID NO: 13) Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe- Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly- Ala-Pro-Pro-Pro-Ser, (vii) producing a peptide fragment F.sup.15, wherein the compound of formula (I) is a peptide fragment F.sup.14 having an N-terminal site protected with Boc and a C-terminal site protected with NH.sub.2 wherein, the compound of formula (III) is a peptide fragment F.sup.11 having an N-terminal site protected with Boc and a C-terminal site protected with ONBn, and wherein the long-chain peptide has the following amino acid sequence: TABLE-US-00036 F.sup.15: (SEQ ID NO: 14) His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys- Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu- Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro- Pro-Pro-Ser and (viii) deprotecting an N-terminal site and a reactive side chain functional group of the peptide fragment F.sup.15, and wherein: TABLE-US-00037 F.sup.1: (SEQ ID NO: 1) Ala-Pro-Pro-Pro-Ser, F.sup.2: (SEQ ID NO: 2) Gly-Pro-Ser-Ser-Gly, F.sup.3: Asn-Gly, F.sup.4: (SEQ ID NO: 3) Phe-Ile-Glu-Trp-Leu-Lys, F.sup.5: (SEQ ID NO: 4) Glu-Ala-Val-Arg-Leu, F.sup.6: (SEQ ID NO: 5) Ser-Lys-Gln-Met-Glu-Glu, F.sup.7: (SEQ ID NO: 6) Thr-Phe-Thr-Ser-Asp-Leu, and F.sup.8: (SEQ ID NO: 7) His-Gly-Glu-Gly.

Description

MODE FOR CARRYING OUT THE INVENTION

[0040] Hereinafter, each step of the present invention method is described in detail. The phrase “compound represented by the formula (X)” is hereinafter abbreviated as “Compound (X)”.

[0041] Step A: Step to Deprotect N-Terminal Site

[0042] In this step A, Compound (II) is obtained by selectively deprotecting an N-terminal site of Compound (I) with a sulfonic acid compound and then a reaction mixture is neutralized by adding a basic compound.


Boc-(AA.sup.1).sub.m-Pro.sup.1  (I)


H-(AA.sup.1).sub.m-Pro.sup.1  (II)

in the formulae, Boc is a t-butoxycarbonyl group as the protective group at the N-terminal site, (AA.sup.1).sub.m is a peptide chain wherein a reactive side chain functional group is protected, m is an integer of 2 or more and 50 or less, and Pro.sup.1 is a protective group at a C-terminal site.

[0043] The (AA.sup.1).sub.m represents a peptide chain of which a reactive side chain functional group is protected and has the following structure unit. The AA.sup.1 represents an amino acid residue, and a plurality of AA.sup.1 may be the same as or different from each other.

##STR00003##

wherein R is a side chain of an amino acid.

[0044] It goes without saying that a side chain functional group which is not reactive, such as a side chain functional group of Gly, Ala, Val, Leu, Ile, Met, Asn, Gln, Pro and Phe, is not needed to be protected in (AA.sup.1).sub.m. The term “reactive side chain functional group” means a highly reactive functional group in an amino acid side chain and is specifically exemplified by hydroxy group, thiol group, carboxy group, amino group, guanidino group and imidazole group. A methylthio group of Met and an amide group of Asn and Gln are not included in a reactive side chain functional group in this disclosure but may be protected to completely inhibit a side reaction. Specifically, a thioether group (—S—) in a side chain of Met may be subjected to sulfoxidation, and an example of a protective group of an amide group includes xanthyl, bis-2,4-dimethoxybenzyl and 4,4′-dimethoxybenzhydryl. A thiol group in a side chain of Cys may be oxidized. A thioether group in a side chain of Met and an amide group in a side chain of Asn and Gln are referred to as “quasi reactive side chain functional group” in some cases in this disclosure.

[0045] It is preferred that a protective group for a reactive side chain functional group is not deprotected in an acidic condition due to the sulfonic acid compound to deprotect an N-terminal site. A protective group for a hydroxy group in a side chain is exemplified by benzyl (Bzl), 4-methylbenzyl (4-MeBzl), 4-methoxybenzyl (4-MeOBzl) and 2-bromobenzyloxycarbonyl (Br—Z); a protective group for a thiol group in a side chain is exemplified by benzyl (Bzl), 4-methylbenzyl (4-MeBzl), 4-methoxybenzyl (4-MeOBzl) and t-butyl (tBu); a protective group for a carboxy group in a side chain is exemplified by benzyloxy (OBzl) and cyclohexyloxy (O-cHex); and a protective group for an amino group in a side chain is exemplified by formyl, 2,4,6-trimethylbenzensulfonyl (Mts), benzyloxycarbonyl (Z), nitro (NO.sub.2), p-toluenesulfonyl (Tos), benzyloxymethyl (BOM), 2,4-dinitrophenyl (Dnp) and 2-chlorobenzyloxycarbonyl (Cl—Z); but the protective groups are not particularly restricted thereto.

[0046] Preferably, a protective group for a side chain of Ser and Thr is Bn group, a protective group for a side chain of Lys is 2-Cl—Z group or Z group, a protective group for a side chain of Trp is formyl group, a protective group for a side chain of Glu and Asp is Bn group, a protective group for a side chain of Arg is Z group or NO.sub.2 group, a protective group for a side chain of His is BOM group, and a protective group for a side chain of Tyr is Bn group, Z group or 2-Br—Z group. A protective group removable by an acid, such as Boc, may be also used as a protective group for a side chain of an N-terminal amino acid.

[0047] The upper limit of “m” is not particularly restricted. When a peptide fragment is excessively large, it may possibly become difficult to progress the reaction. Thus, the “m” is preferably 100 or less, and more preferably 50 or less. The “m” is preferably 2 or more, more preferably 3 or more, and even more preferably 4 or more.

[0048] The Pro.sup.1 represents a protective group for a C-terminal site. It is preferred that the protective group for a C-terminal site is not removed in an acidic condition due to the sulfonic acid compound to deprotect an N-terminal site among the protective groups described in Theodora W. Greene and Peter G. M. Wuts, “Protective Groups in Organic Chemistry Fourth Edition” published by WILEY-INTERSCIENCE, pp. 533-646. An example of such a protective group for the C-terminal site includes an ester protective group such as methyl ester, ethyl ester, benzyl ester, 4-nitrobenzyl ester, 2-nitrobenzyl ester, 2,4-dinitrobenzyl ester and 4-methoxybenzyl ester; and an amide protective group such as amide, dimethylamide, pyrrolidinylamide, piperidinylamide and o-nitroanilide.

[0049] When Compound (VI) obtained by Steps A to C is used as Compound (III) in Step B to newly repeat Steps A to C, a nitrobenzyl alcohol group (ONBn) selected from the group essentially consisting of 4-nitrobenzyl alcohol, 2-nitrobenzyl alcohol, 2,4-dinitrobenzyl alcohol, 4,6-dinitrobenzyl alcohol and 2,4,6-trinitrobenzyl alcohol is used as Pro′.

[0050] Boc is used as a protective group for an N-terminal site of Compound (I), and the N-terminal site of Compound (I) is deprotected with using a sulfonic acid compound in this Step A. An N-terminal site protected with Boc is generally deprotected by using trifluoroacetic acid, but when trifluoroacetic acid is used, it is necessary to completely remove the trifluoroacetic acid in order to inhibit a side reaction. Such a procedure is not preferred in terms of a production efficiency and should be particularly avoided for an industrial large scale synthesis. On the one hand, when a reaction to remove Boc is carried out by using the sulfonic acid compound, an efficient production is possible, since the sulfonic acid compound is not needed to be removed and the reaction mixture can be subsequently used in the condensation step.

[0051] An example of the usable sulfonic acid compound includes methanesulfonic acid, trifluoromethanesulfonic acid and/or p-toluenesulfonic acid. A mixture of the compounds may be used. The sulfonic acid compound is particularly preferred from the standpoint that no significant by-product is generated even if the reaction mixture in which there remains the sulfonic acid compound is subjected to the coupling reaction in the next step without isolating the compound (II).

[0052] A usage amount of the sulfonic acid compound is not particularly restricted and may be appropriately adjusted, and may be adjusted to, for example, 0.1 times or more by mole and 400 times or less by mole to Compound (I). The amount is preferably 0.5 mol times or more by mole and 200 mol times or less by mole.

[0053] In this step A, a solvent may be used for the purpose that the liquid property of the reaction mixture is improved, the reaction is accelerated and a side reaction is inhibited. Such a solvent may be appropriately selected and is not particularly restricted, and is exemplified by water; an alcohol solvent such as methanol, ethanol, isopropanol, n-butanol and ethylene glycol; an aliphatic hydrocarbon solvent such as hexane and heptane; a halogenated hydrocarbon solvent such as dichloromethane, 1,2-dichloroethane, chloroform and chlorobenzene; an ether solvent such as tetrahydrofuran, 2-methyltetrahydrofuran, 1,4-dioxane, tert-butyl methyl ether and cyclopentyl methyl ether; an ester solvent such as ethyl acetate, isopropyl acetate and methyl propionate; a nitrile solvent such as acetonitrile, propionitrile and benzonitrile; a ketone solvent such as acetone, methyl ethyl ketone and acetophenone; an amide solvent such as dimethylformamide, dimethylacetamide, diethylformamide, dipropylformamide and dibutylformamide; and an aprotic polar solvent such as dimethylsulfoxide, N-methylpyrrolidone and 1,3-dimethylpropyleneurea. The solvent is preferably a halogenated hydrocarbon solvent, an ether solvent, an amide solvent and an aprotic polar solvent, more preferably a halogenated hydrocarbon solvent, an ether solvent and an amide solvent, and even more preferably 1 or more solvents selected from the group essentially consisting of dichloromethane, chlorobenzene, tetrahydrofuran, 2-methyltetrahydrofuran, dimethylformamide, dimethylacetamide and dibutylformamide. One of the solvents may be used alone or two or more of the solvents may be mixed to be used. When the solvents are mixed, a mixing ratio is not particularly restricted.

[0054] A usage amount of the solvent may be appropriately determined, and the usage amount to 1 g of Compound (I) may be 1 mL or more and 300 mL or less and preferably 5 mL or more and 100 mL or less.

[0055] An order to add each reagent is not particularly restricted, and for example, the sulfonic acid compound may be added to a mixture of Compound (I) and a solvent. A ratio of Compound (I) to the whole reaction mixture is preferably 0.2 WV % or more and 50 WV % or less and more preferably 1 WV % or more and 20 WV % or less.

[0056] A reaction temperature to deprotect the N-terminal site of Compound (I) is not particularly restricted and is preferably a boiling point of the used solvent or lower in terms of safety. The reaction temperature is preferably, for example, −40° C. or higher and 160° C. or lower, more preferably −20° C. or higher and 100° C. or lower, and even more preferably 0° C. or higher and 60° C. or lower.

[0057] A reaction time to deprotect the N-terminal site of Compound (I) is also not particularly restricted, and may be determined by a preliminary experiment or the reaction may be continued until it is confirmed that Compound (I) is consumed by HPLC, thin-layer chromatography or the like. For example, the reaction time may be adjusted to 10 minutes or more and 24 hours or less.

[0058] In this step A, the N-terminal site of Compound (I) is deprotected and then the reaction mixture is neutralized by adding a basic compound.

[0059] The basic compound is not particularly restricted, may be an inorganic base or an organic base, and is preferably an organic base in terms of a solubility to the reaction mixture. An example of the basic compound includes an alkali metal hydroxide such as lithium hydroxide, sodium hydroxide, potassium hydroxide and cesium hydroxide; a carbonate salt of an alkali metal, such as lithium carbonate, sodium carbonate, potassium carbonate and cesium carbonate; a hydrogencarbonate salt of an alkali metal, such as lithium hydrogencarbonate, sodium hydrogencarbonate and potassium hydrogencarbonate; a metal alkoxide such as lithium methoxide, lithium ethoxide, lithium isopropoxide, lithium tert-butoxide, sodium methoxide, sodium ethoxide, sodium isopropoxide, sodium tert-butoxide, potassium methoxide, potassium ethoxide, potassium isopropoxide and potassium t-butoxide; a metal hydride such as sodium hydride, potassium hydride and calcium hydride; and an organic amine compound such as trimethylamine, triethylamine, tributylamine, diisopropylethylamine, N-methylpyrrolidine, N-methylmorpholine, 1,8-diazabicyclo[5,4,0]undec-7-ene, pyridine, quinoline and imidazole. One of the basic compounds may be used alone or two or more of the basic compounds may be used in combination. The basic compound is preferably an organic amine compound, and more preferably triethylamine and/or diisopropylethylamine.

[0060] A usage amount of the basic compound may be appropriately adjusted. For example, the usage amount may be adjusted such that a pH value of the reaction mixture after the basic compound is added becomes 6.5 or more. When the pH value is higher, the latter condensation reaction proceeds more successfully. Thus, the pH is preferably 6.5 or more and more preferably 7.0 or more. On the one hand, when the pH value is lower, an epimerization during the condensation reaction can be inhibited. Thus, the pH is preferably 10 or less and more preferably 8.0 or less.

[0061] An embodiment to add the basic compound is not particularly restricted. For example, after the deprotecting reaction at the N-terminal site of Compound (I) is completed, the basic compound may be directly added to the reaction mixture. Alternatively, the basic compound is dispersed or dissolved in a solvent, and the dispersion or solution may be added to the reaction mixture. As the solvent used in the above case, the solvent exemplified in the explanation of the deprotecting reaction at the N-terminal site of Compound (I) may be used. The same solvent as that used for the deprotecting reaction may be used or a different solvent may be used.

[0062] A temperature during the addition of the basic compound is not particularly restricted and may be appropriately determined. It is preferred that the basic compound is added after the reaction mixture is cooled, since a reaction heat may be sometimes generated due to the neutralization. For example, the basic compound is preferably added after the reaction mixture is cooled to −10° C. or higher and 20° C. or lower. It is also preferred that the reaction mixture is stirred during and after the addition of the basic compound.

[0063] Step B: Step to Deprotect C-Terminal Site

[0064] In this step B, Compound (IV) is obtained by selectively deprotecting the C-terminal site of Compound (III). This step B is preferably carried out separately from the above-described Step A.


BOC-(AA.sup.2).sub.n-ONBn  (III)


BOC-(AA.sup.2).sub.n-OH  (IV)

in the formulae, (AA.sup.2).sub.n is a peptide chain wherein a reactive side chain functional group is protected, n is an integer of 2 or more and 50 or less, NBn is a nitrobenzyl group represented by the following formula (V) wherein p, q and r are independently 0 or 1, and p+q+r is 1, 2 or 3.

##STR00004##

[0065] The (AA.sup.2).sub.n in the formula (III) and the formula (IV) is not necessarily the same as (AA.sup.1).sub.m but the above-described explanation for (AA.sup.1).sub.m in Step A can be directly applied to (AA.sup.2).sub.n. The “n” is preferably 100 or less, more preferably 50 or less, and preferably 2 or more, more preferably 3 or more, even more preferably 4 or more.

[0066] The NBn is specifically 1 or more nitrobenzyl groups selected from the group essentially consisting of 4-nitrobenzyl, 2-nitrobenzyl, 2,4-dinitrobenzyl, 4,6-dinitrobenzyl and 2,4,6-trinitrobenzyl. A benzyl-type protective group is used for protecting a hydroxy group and a carboxy group, such as a carboxy group at a C-terminal site, in a peptide, since a benzyl-type protective group can be easily removed by a hydrogenation reaction. On the one hand, when a general benzyl-type protective group is used for protecting a C-terminal site, the C-terminal site may not be selectively deprotected in some cases. In the present invention, a C-terminal site can be selectively deprotected by protecting the C-terminal site with ONBn.

[0067] Specifically, when there is not a reactive side chain functional group or a reactive side chain functional group is protected with only a protective group other than a benzyl-type protective group in (AA.sup.2).sub.n, NBn at the C-terminal site of Compound (III) can be easily removed by a general hydrogenation reaction. In addition, when there is a general benzyl-type protective group in a protective group to protect a reactive side chain functional group, only NBn at the C-terminal site can be selectively removed in a mild reductive condition. For more information, since a nitro group on a benzene ring in NBn can be easily reduced, only the nitro group of NBn can be reduced with maintaining a general benzyl-type protective group. When the nitro group in NBn is reduced, NBn is removed due to a subsequent electron transfer and only the C-terminal site can be deprotected.

[0068] A condition to reduce only the nitro group of NBn with maintaining a general benzyl-type protective group may be appropriately selected, and for example, a dithionous acid compound, which is a mild reducing agent, can be used. Specifically, a dithionous acid compound may be added to Compound (III) with a solvent, a dithionous acid compound may be added to a solution or a dispersion of Compound (III), or a solution or a dispersion of a dithionous acid compound may be added to a solution or a dispersion of Compound (III). An example of the dithionous acid compound includes sodium dithionite. Alternatively, NBn can be also selectively removed by using a reduction reaction with a combination of a metal and an acid. An example of such a metal includes Fe, Zn and Sn, and an example of such an acid includes ammonium chloride, acetic acid, hydrochloric acid and an acidic buffer.

[0069] A usage amount of the dithionous acid compound may be appropriately adjusted as long as the C-terminal site of Compound (III) can be selectively deprotected, and for example, 1 time or more by mole and 30 times or less by mole of the dithionous acid compound to Compound (III) can be used. The usage amount is preferably 20 times or less by mole, and preferably 3 times or more by mole, more preferably 5 times or more by mole. The term “time(s) by mole” means a molar number of an objective compound to 1 mole of a standard compound in this disclosure.

[0070] As a solvent usable in this Step B, the solvent exemplified in the explanation of the deprotecting reaction at the N terminal site of Compound (I) can be used. The solvent may be the same as or different from the solvent used in the deprotecting reaction. The solvent is preferably a mixed solvent of water and an amide solvent or a sulfoxide solvent, and more preferably a mixed solvent of water and 1 or more of organic solvents selected from the group essentially consisting of dimethylformamide (DMF), dimethylacetamide (DMA), dibutylformamide and dimethylsulfoxide (DMSO).

[0071] A reaction temperature of this Step B is not particularly restricted and is preferably a boiling point or lower of a used solvent in terms of safety. In addition, it is preferred to appropriately determine the temperature in consideration of the inhibition of impurity generation and the reaction rate. For example, the reaction temperature is preferably 20° C. or higher and 150° C. or lower, more preferably 30° C. or higher and 100° C. or lower, and even more preferably 50° C. or higher and 90° C. or lower.

[0072] Also, a reaction time of this Step B is not particularly restricted. The reaction time may be determined by a preliminary experiment, or the reaction may be continued until a consumption of Compound (III) is confirmed by HPLC, thin layer chromatography or the like. For example, the reaction time can be adjusted to 30 minutes or more and 24 hours or less.

[0073] A general posttreatment may be conducted after the reaction of this Step B. For example, the reaction mixture is cooled to room temperature, a poor solvent is added thereto to precipitate Compound (IV), and the precipitated Compound (IV) is collected by filtration, washed with a poor solvent and dried.

[0074] Step C: Condensation Step

[0075] In this Step C, Compound (VI) is obtained by adding Compound (IV) to the reaction mixture of the above-described Step A to condensate Compound (II) and Compound (IV). The reaction mixture of the above-described Step B and alternatively purified or roughly purified Compound (IV) may be added to the reaction mixture of the above-described Step A, and it is preferred that purified or roughly purified Compound (IV) is added to the reaction mixture of the above-described Step A. In other words, the above-described Step A and this Step C are performed within the same system, i.e. in a one-pot manner.


BOC-(AA.sup.2).sub.n-(AA.sup.1).sub.m-Pro.sup.1  (VI)

in the formula, Boc, (AA.sup.2).sub.n, n, (AA.sup.1).sub.m, and Pro.sup.1 have the same meanings as the above.

[0076] Usage amounts of Compound (II) and Compound (IV) in this Step C may be appropriately adjusted and for example, the amount to Compound (II) can be 0.4 times or more by mole and 5 times or less by mole, preferably 0.8 times or more by mole and 2 times or less by mole, and more preferably 0.9 times or more by mole and 1.5 times or less by mole.

[0077] A method for condensating Compound (II) and Compound (IV) in this Step C is not particularly restricted and for example, a carbodiimide compound or a dehydrating condensating agent is preferably used in the presence of an activating additive such as a hydroxyamine compound.

[0078] An example of the hydroxyamine compound includes 1-hydroxybenzotriazole (HOBt), 1-hydroxy-7-azabenzotriazole (HOAt), 3-hydroxy-4-oxo-3,4-dihydro-1,2,3-benzotriazine (HOOBt), N-hydroxysuccinimide (NHS), ethyl 2-oxime-cyanoglyoxylate (Oxyma), 1-hydroxy-6-chloro-benzotriazole (6-Cl-HOBt), N-hydroxyphthalimide and N-hydroxypiperidine, preferably 1-hydroxybenzotriazole (HOBt), 1-hydroxy-7-azabenzotriazole (HOAt) and 3-hydroxy-4-oxo-3,4-dihydro-1,2,3-benzotriazine (HOOBt), and more preferably 3-hydroxy-4-oxo-3,4-dihydro-1,2,3-benzotriazine (HOOBt).

[0079] A usage amount of the hydroxyamine compound may be appropriately adjusted and for example, the usage amount to Compound (III) may be 0.1 times or more by mole and 10 times or less by mole, and is preferably 0.5 times or more by mole and 5 times or less by mole.

[0080] An example of the carbodiimide compound includes dicyclohexylcarbodiimide (DCC) and 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride (EDC), and preferably 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride (EDC) in terms of easiness of posttreatment and accessibility.

[0081] An example of the dehydrating condensating agent includes 1H-benzotriazole-1-yloxy-tris-dimethylaminophosphonium hexafluorophosphate (BOP), 1H-benzotriazole-1-yloxy-tris-pyrrolidinophosphonium hexafluorophosphate (PyBOP), 0-(benzotriazole-1-yl)-N,N,N′,N′-tetramethyluronium hexafluorophosphate (HBTU), 0-(7-azabenzotriazole-1-yl)-N,N,N′,N′-tetramethyluronium hexafluorophosphate (HATU), 0-(benzotriazole-1-yl)-N,N,N′,N′-tetramethyluronium tetrafluoroborate (TBTU), O-[(ethoxycarbonyl)cyanomethylenamino]-N,N,N′,N′-tetramethyluronium hexafluorophosphate (HOTU), (1-cyano-2-ethoxy-2-oxoethylideneaminooxy)dimethylamino-morpholino-carbenium hexafluorophosphate (COMU) and 4-(4,6-dimethoxy-1,3,5-triazine-2-yl)-4-methylmorpholinium chloride (DMT-MM), preferably O-(benzotriazole-1-yl)-N,N,N′,N′-tetramethyluronium hexafluorophosphate (HBTU), O-(benzotriazole-1-yl)-N,N,N′,N′-tetramethyluronium tetrafluoroborate (TBTU) and (1-cyano-2-ethoxy-2-oxoethylideneaminooxy)dimethylamino-morpholino-carbenium hexafluorophosphate (COMU), and more preferably O-(benzotriazole-1-yl)-N,N,N′,N′-tetramethyluronium hexafluorophosphate (HBTU).

[0082] Usage amounts of the carbodiimide compound and the dehydrating condensating agent may be appropriately adjusted, are not particularly restricted, and for example, the usage amounts to Compound (III) may be 0.1 times or more by mole and 10 times or less by mole and preferably 0.5 times or more by mole and 5 times or less by mole.

[0083] A solvent may be used in this Step C. The same solvent exemplified in the explanation of the above-described Step A can be used as the solvent. When a solubility of the raw material in this Step C is low, the solvent preferably contains an amide solvent to accelerate the reaction by dissolving the raw material, and the solvent preferably contains 1 or more amide solvents selected from the group essentially consisting of dimethylformamide, dimethylacetamide and dibutylformamide. In order to use an amide solvent-containing solvent in this Step C, this Step C may be continuously started in the case where an amide solvent is used as at least a part of the solvent in the above-described Step A and Step B, or an amide solvent may be added in this Step C in the case where an amide solvent is not used in the above-described Step A and Step B. When an amide solvent is used as a part of the solvent in this Step C, a ratio of the amide solvent in the whole solvent in this Step C is preferably 2 v/v % or more, more preferably 30 v/v % or more, and even more preferably 70 v/v % or more. The above ratio means a ratio of the amide solvent before mixing to the total volume of each solvent before mixing.

[0084] A reaction temperature and a reaction time of this Step C are not particularly restricted and may be appropriately adjusted. For example, the reaction temperature may be adjusted to a boiling point or lower of the used solvent, is preferably adjusted to 50° C. or lower in terms of an inhibition of a side reaction, and the reaction may be carried out under an ordinary temperature. The lower limit of the reaction temperature is not particularly restricted, and the reaction temperature is preferably −10° C. or higher in terms of an effective progress of the reaction. The reaction time is not particularly restricted, and may be determined by a preliminary experiment, or the reaction may be continued until a consumption of Compound (II) or Compound (IV) is confirmed by HPLC, thin layer chromatography or the like. For example, the reaction time can be adjusted to 1 minute or more and 48 hours or less.

[0085] A general posttreatment may be conducted after the reaction of this Step C. For example, the reaction mixture is washed with water, saturated aqueous sodium chloride solution, saturated aqueous sodium hydrogencarbonate solution, sodium carbonate aqueous solution or the like, and then an organic phase is dried using anhydrous sodium sulfate or anhydrous magnesium sulfate and condensated. Compound (VI) may be further purified by column chromatography, crystallization procedure or the like.

[0086] The above Steps A to C may be repeated by using Compound (VI) obtained by this Step C as Compound (III) of the above Step B to extend the peptide chain. In such a case, ONBn is used as the protective group Pro.sup.1 at the C-terminal site of Compound (VI) in common with Compound (III).

[0087] Alternatively, the above Steps A to C may be repeated by using Compound (VI) obtained by this Step C as Compound (I) of the above Step A to extend the peptide chain. In such a case, the protective group Pro.sup.1 at the C-terminal site of Compound (VI) may be appropriately selected. For example, when exenatide described later is produced, exenatide can be efficiently produced by using NH.sub.2 as Pro′, since the C-terminal site of exenatide is —CONH.sub.2. In addition, when Compound (VI) is used as a peptide chain in N-terminal side, Pro.sup.1 may be ONBn.

[0088] Step D: Step for Deprotection

[0089] In this Step D, at least a reactive side chain functional group of Compound (VI) is deprotected to obtain a target peptide. It goes without saying that when AA.sup.2 and AA.sup.1 of Compound (VI) do not have a reactive side chain functional group or when the AA.sup.2 or AA.sup.1 has a quasi reactive side chain functional group but the quasi reactive side chain functional group is not protected, this Step D is not needed to be performed. If needed, at least one of the N-terminal site and the C-terminal site may be deprotected. A publically known condition can be applied as a condition to remove each protective group.

[0090] A general posttreatment may be conducted after the reaction of this Step D. For example, the reaction mixture is concentrated, and then a target peptide may be purified by column chromatography or the like.

[0091] A useful long chain peptide can be efficiently produced by the above-described present invention method. For example, the present invention method can be used for producing exenatide, which is a GLP-1 receptor agonist and which is widely used worldwide as a type 2 diabetes drug. Exenatide has an amino acid sequence of His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS) (SEQ ID NO: 15), and the carboxy group at the C-terminal site thereof is amidated.

[0092] For example, when a long-chain peptide is produced by the present invention method, peptide fragments are designed by the cleavage of the long-chain peptide at an appropriate position where an epimerization is hardly caused, each peptide fragment is produced by the present invention method or a conventional method, and each peptide fragment may be condensated by the present invention method. In such a case, among neighboring peptide fragments, a peptide fragment of the C-terminal side is used as Compound (I) and a peptide fragment of the N-terminal side is used as Compound (III). When the peptide fragment has a reactive side chain functional group, a protective group which is not removed in the condition to selectively deprotect the N-terminal site and/or the C-terminal site, in other word, in the condition to remove Boc and/or NBn, is used as a protective group of the reactive side chain functional group.

[0093] For example, when exenatide is produced by the present invention method, the peptide fragments F.sup.1 to F.sup.8 (Fragments 1 to 8) having the following amino acid sequences are designed toward the N-terminal site from the C-terminal site, and each peptide fragment may be condensated by the present invention method.

TABLE-US-00009 F.sup.1: (SEQ ID NO: 1) Ala-Pro-Pro-Pro-Ser F.sup.2: (SEQ ID NO: 2) Gly-Pro-Ser-Ser-Gly F.sup.3: Asn-Gly F.sup.4: (SEQ ID NO: 3) Phe-Ile-Glu-Trp-Leu-Lys F.sup.5: (SEQ ID NO: 4) Glu-Ala-Val-Arg-Leu F.sup.6: (SEQ ID NO: 5) Ser-Lys-Gln-Met-Glu-Glu F.sup.7: (SEQ ID NO: 6) Thr-Phe-Thr-Ser-Asp-Leu F.sup.8: (SEQ ID NO: 7) His-Gly-Glu-Gly,

[0094] In the above peptide fragments, the C-terminal site of the peptide fragment F.sup.1 corresponding to the C-terminal part of exenatide is preferably protected with NH.sub.2, since the C-terminal site of exenatide is amidated and an amide group is relatively stable. Since the other peptide fragments F.sup.2 to F.sup.7 are condensated with a peptide fragment in the C-terminal side in any one of the stages, ONBn is preferably used as the protective group of the C-terminal sites of the peptide fragments F.sup.2 to F.sup.8.

[0095] More specifically, the peptide fragment F.sup.1 used as Compound (I) and the peptide fragment F.sup.2 used as Compound (III) are condensated to obtain the peptide fragment F.sup.9 having the following amino acid sequence,

TABLE-US-00010 F.sup.9: (SEQ ID NO: 8) Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

[0096] the peptide fragment F.sup.3 used as Compound (I) and the peptide fragment F.sup.4 used as Compound (III) are condensated to obtain the peptide fragment F.sup.10 having the following amino acid sequence,

TABLE-US-00011 F.sup.10: (SEQ ID NO: 9) Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly

[0097] the peptide fragment F.sup.7 used as Compound (I) and the peptide fragment F.sup.8 used as Compound (III) are condensated to obtain the peptide fragment F.sup.11 having the following amino acid sequence, [0098] F.sup.11: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu (SEQ ID NO: 10)

[0099] the peptide fragment F.sup.12 used as Compound (I) and the peptide fragment F.sup.5 used as Compound (III) are condensated to obtain the peptide fragment F.sup.12 having the following amino acid sequence,

TABLE-US-00012 F.sup.12: (SEQ ID NO: 11) Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly

[0100] the peptide fragment F.sup.9 used as Compound (I) and the peptide fragment F.sup.12 used as Compound (III) are condensated to obtain the peptide fragment F.sup.13 having the following amino acid sequence,

TABLE-US-00013 F.sup.13: (SEQ ID NO: 12) Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn- Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

[0101] the peptide fragment F.sup.13 used as Compound (I) and the peptide fragment F used as Compound (III) are condensated to obtain the peptide fragment F.sup.14 having the following amino acid sequence,

TABLE-US-00014 F.sup.14: (SEQ ID NO: 13) Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe- Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly- Ala-Pro-Pro-Pro-Ser

[0102] the peptide fragment F.sup.14 used as Compound (I) and the peptide fragment F.sup.11 used as Compound (III) are condensated to obtain the peptide fragment F.sup.15 having the following amino acid sequence,

TABLE-US-00015 F.sup.15: (SEQ ID NO: 14) His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys- Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu- Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro- Pro-Pro-Ser.

[0103] Exenatide can be obtained by using NH.sub.2 as the protective group of the C-terminal site of the above peptide fragment F.sup.1, removing Boc as the protective group of the N-terminal site of the above peptide fragment F.sup.15 and deprotecting the reactive side chain functional group with an ordinary method.

[0104] The present application claims the benefit of the priority date of Japanese patent application No. 2018-65298 filed on Mar. 29, 2018. All of the contents of the Japanese patent application No. 2018-65298 filed on Mar. 29, 2018, are incorporated by reference herein.

EXAMPLES

[0105] Hereinafter, the examples are described to demonstrate the present invention more specifically, but the present invention is in no way restricted by the examples, and the examples can be appropriately modified to be carried out within a range which adapts to the contents of this specification. Such a modified example is also included in the scope of the present invention.

Example 1: Production of Fragment F.SUP.9 .from Fragment F.SUP.1 .and Fragment F.SUP.2

[0106]

TABLE-US-00016 (1) Production of (SEQ ID NO: 16) Boc-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-OH

[0107] Na.sub.2S.sub.2O.sub.4 (0.86 g, 5.0 mmol), DMA (5 mL) and water (0.5 mL) were added to Boc-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-O(4-NBn) (SEQ ID NO: 17) (0.82 g, 1.0 mmol), and the mixture was stirred at 90° C. for 2 hours. Ethyl acetate (8 mL) and water (8 mL) were added to the reaction mixture for extraction, and the aqueous layer and the oil layer were separated to obtain Boc-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-OH (SEQ ID NO: 16) as Fragment F.sup.2.

TABLE-US-00017 (2) Production of (SEQ ID NO: 18) Boc-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-Ala-Pro-Pro- Pro-Ser(Bzl)-NH.sub.2 

[0108] Dichloromethane (5 mL) and methanesulfonic acid (0.58 g, 6.0 mmol) were added to Boc-Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2 (SEQ ID NO: 19) (0.69 g, 1.1 mmol), and the mixture was stirred at room temperature for 1.5 hours. The reaction mixture was cooled in an ice bath, and triethylamine (0.62 g, 6.1 mmol) was added thereto. The mixture was stirred at room temperature for 10 minutes. Then, the reaction mixture was added to a dichloromethane solution of Boc-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-OH (SEQ ID NO: 16) obtained in the above-described Example 1(1) (6 mL). Subsequently, HOBt.H.sub.2O (0.23 g, 1.5 mmol) was added thereto and EDC hydrochloride (0.29 g, 1.5 mmol) was finally added thereto. The mixture was stirred at room temperature for 16 hours. Next, the reaction was stopped and Boc-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2(SEQ ID NO: 18) was obtained as Fragment F.sup.9 by extraction (0.93 mmol, purity: 95.0%).

Example 2: Production of Fragment F.SUP.10 .from Fragment F.SUP.3 .and Fragment F.SUP.4

[0109]

TABLE-US-00018 (1) Production of (SEQ ID NO: 20) Boc-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl-Z)-OH

[0110] DMA (6 g), Na.sub.2S.sub.2O.sub.4 (0.82 g, 4.7 mmol) and water (0.6 g) were added to Boc-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)—O(4-NBn) (SEQ ID NO: 21) (1.0 g, 0.94 mmol), and the mixture was stirred at 90° C. for 2 hours. Then, the mixture was cooled to 20° C., and 5% potassium hydrogensulfate aqueous solution (40 g) was added thereto. The precipitated solid was obtained by filtration and dried under reduced pressure to obtain 0.87 g of Boc-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)—OH(SEQ ID NO: 20) as Fragment F.sup.4.

TABLE-US-00019 (2) Production of (SEQ ID NO: 22) Boc-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl-Z)-Asn- Gly-O(4-NBn)

[0111] Dichloromethane (160 mL) and methanesulfonic acid (5.4 g, 56 mmol) were added to Boc-Asn-Gly-O(4-NBn) (3.5 g, 8.3 mmol), and the mixture was stirred for 3 hours. The reaction mixture was cooled in an ice bath, and triethylamine (5.8 g, 57 mmol) was added thereto. The mixture was stirred for 5 minutes to deprotect the N-terminal site.

[0112] Boc-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)—OH(SEQ ID NO: 20) (8.5 g, 7.0 mmol) obtained in the above-described Example 2(1) and HOOBt (2.0 g, 13 mmol) were added to a solution of H-Asn-Gly-O(4-NBn), and an aqueous solution (5.8 mL) of EDC hydrochloride (2.0 g, 10 mmol) was added thereto over 3 hours. The mixture was stirred at 20° C. for 4 hours. Next, water (160 g) was added thereto and the precipitate of Boc-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)-Asn-Gly-O(4-NBn) (SEQ ID NO: 22) was obtained by filtration as Fragment F.sup.10 (9.7 g, 6.3 mmol).

Example 3: Production of Fragment F.SUP.11 .from Fragment F.SUP.7 .and Fragment F.SUP.8

[0113]

TABLE-US-00020 (1) Production of (SEQ ID NO: 23) Boc-His(BOM)-Gly-Glu(OBzl)-Gly-OH

[0114] DMA (15 g), Na.sub.2S.sub.2O.sub.4 (5.2 g, 30 mmol) and water (1.1 g) were added to Boc-His(BOM)-Gly-Glu(OBzl)-Gly-O(4-NBn) (SEQ ID NO: 24) (5.0 g, 5.9 mmol), and the mixture was stirred at 100° C. for 3 hours. The mixture was cooled to 10° C. Then, water (30 g) and dichloromethane (30 g) were added thereto for extraction, and an aqueous layer and an oil layer were separated to obtain Boc-His(BOM)-Gly-Glu(OBzl)-Gly-OH (SEQ ID NO: 23) as Fragment F.sup.8.

TABLE-US-00021 (2) Production of (SEQ ID NO: 25) Boc-His(BOM)-Gly-Glu(OBzl)-Gly-Thr(Bzl)-Phe-Thr (Bzl)-Ser(Bzl)-Asp(OBzl)-Leu-O(4-NBn)

[0115] Dichloromethane (11 g) and methanesulfonic acid (2.4 g, 25 mmol) were added to Boc-Thr(Bzl)-Phe-Thr(Bzl)-Ser(Bzl)-Asp(OBzl)-Leu-O(4-NBn) (SEQ ID NO: 26) (6.3 g, 4.9 mmol), and the mixture was stirred for 2 hours. The reaction mixture was cooled in an ice bath, and triethylamine (2.6 g, 25 mmol) was added thereto. The mixture was stirred for 15 minutes, and then a solution of Boc-His(BOM)-Gly-Glu(OBzl)-Gly-OH (SEQ ID NO: 23) (42 g, 5.9 mmol) obtained in the above-described Example 3(1), HOBt.H.sub.2O (1.1 g, 7.4 mmol) and EDC hydrochloride (1.4 g, 7.4 mmol) were added thereto in this order. After the mixture was stirred at 0° C. for 18 hours, 5% sodium carbonate aqueous solution (60 g) was added thereto. The precipitated solid of Boc-His(BOM)-Gly-Glu(OBzl)-Gly-Thr(Bzl)-Phe-Thr(Bzl)-Ser(Bzl)-Asp(OBzl)-Leu-O(4-NBn) (SEQ ID NO: 25) was obtained by filtration as Fragment F.sup.11 (8.6 g, 4.6 mmol, purity: 93.5%).

Example 4: Production of Fragment F.SUP.12 .from Fragment F.SUP.5 .and Fragment F.SUP.10

[0116]

TABLE-US-00022 (1) Production of (SEQ ID NO: 27) Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-OH

[0117] DMA (60 mL), Na.sub.2S.sub.2O.sub.4 (6.2 g, 36 mmol) and water (6 mL) were added to Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-O(4-NBn) (SEQ ID NO: 28) (8.5 g, 7.2 mmol), and the mixture was stirred at 90° C. for 4 hours. Then, water (60 mL) was added thereto, and the mixture was cooled to room temperature. Ethyl acetate (60 mL) was added thereto, and the mixture was stirred at room temperature for 2 hours. The precipitated solid was obtained by filtration and washed with water and ethyl acetate to obtain Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-OH(SEQ ID NO: 27) as Fragment F.sup.5 (7.5 g, 7.2 mmol, Purity: 96.5%).

TABLE-US-00023 (2) Production of (SEQ ID NO: 29) Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile-Glu (OBzl)-Trp(CHO)-Leu-Lys(Cl-Z)-Asn-Gly-O(4-NBn)

[0118] Dichloromethane (105 mL) and methanesulfonic acid (3.0 g, 31 mmol) were added to Boc-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)-Asn-Gly-O(4-NBn) (SEQ ID NO: 22) (9.5 g, 6.2 mmol) produced in the above-described Example 2, and the mixture was stirred for 1 hour. The reaction mixture was cooled in an ice bath, and triethylamine (2.8 g, 28 mmol) was added thereto. The mixture was stirred for 5 minutes. DMA (146 g) was further added thereto, and the mixture was warmed up to 20° C.

[0119] Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-OH (SEQ ID NO: 27) (6.5 g, 6.2 mmol) produced in the above-described Example 4(1) and HOOBt (1.5 g, 9.3 mmol) were added to the above reaction mixture, and DMA solution (311 mL) of EDC hydrochloride (1.8 g, 9.3 mmol) was finally added thereto over 5 hours. The mixture was stirred at 20° C. for 13 hours and then at 30° C. for 17 hours. Further, HOOBt (0.25 g, 1.6 mmol), EDC hydrochloride (0.30 g, 1.6 mmol), Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-OH(SEQ ID NO: 27) (0.97 g, 0.94 mmol) and triethylamine (0.22 g, 2.2 mmol) were added thereto, and the mixture was stirred for 15 hours. Then, water (570 mL) was added thereto. After a part of the mixture was concentrated at 40° C. under reduced pressure. Water (285 mL) was added again. The mixture was cooled to 0° C., and the precipitate of Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)-Asn-Gly-O(4-NBn) (SEQ ID NO: 29) was obtained by filtration as Fragment F.sup.12 (15.7 g).

Example 5: Production of Fragment F.SUP.13 .from Fragment F.SUP.9 .and Fragment F.SUP.12

[0120]

TABLE-US-00024 (1) Production of (SEQ ID NO: 30) Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile- Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl-Z)-Asn-Gly-OH DMA (90 g) was added to (SEQ ID NO: 29) Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile- Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl-Z)-Asn-Gly-O(4-NBn)
(15 g, 6.1 mmol) produced in the above-described Example 4, and the mixture was warmed up to 55° C. Then, water (9.0 g) and Na.sub.2S.sub.2O.sub.4 (5.3 g, 30 mmol) were added thereto, and the mixture was heated up to 90° C. After the mixture was stirred at 90° C. for 2 hours, water (90 g) was added and the precipitate of Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)-Asn-Gly-OH (SEQ ID NO: 30) was obtained by filtration as Fragment F.sup.12 (13.4 g, 5.8 mmol).

TABLE-US-00025 (2) Production of (SEQ ID NO: 31) Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile- Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl-Z)-Asn-Gly-Gly-Pro- Ser(Bzl)-Ser(Bzl)-Gly-Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2

[0121] Methanesulfonic acid (3.7 g, 39 mmol) was added to the dichloromethane solution (96 g) of Boc-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2(SEQ ID NO: 18) (7.1 g, 5.8 mmol) obtained in the above-described Example 1, and the mixture was stirred for 3 hours. The reaction mixture was cooled in an ice bath. Triethylamine (4.2 g, 41 mmol) was added thereto, and the mixture was stirred for 5 minutes. After DMA (106 g) was further added thereto, dichloromethane was distilled away under reduced pressure.

[0122] Then, Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)-Asn-Gly-OH (SEQ ID NO: 30) (11.2 g, 4.8 mmol) obtained in the above-described Example 5(1), DMA (106 g) and HOOBt (1.6 g, 9.7 mmol) were added thereto, and EDC hydrochloride (1.9 g, 9.7 mmol) was finally added. The mixture was stirred for 2 hours. Further, EDC hydrochloride (0.46 g, 2.4 mmol) and triethylamine (0.24 g, 2.4 mmol) were added 3 times every 1 hour, and the mixture was stirred for 1 hour. Next, triethylamine (0.49 g, 4.8 mmol) was added, and the mixture was stirred for 13 hours. Water (106 g) was added, and the precipitate of Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)-Asn-Gly-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2(SEQ ID NO: 31) was obtained by filtration as Fragment F.sup.13 (13.3 g, 3.9 mmol).

Example 6: Production of Fragment F.SUP.14 .from Fragment F.SUP.13 .and Fragment F.SUP.6

[0123]

TABLE-US-00026 (1) Production of (SEQ ID NO: 32) Boc-Ser(Bzl)-Lys(Cl-Z)-Gln-Met(O)-Glu(OBzl)- Glu(OBzl)-OH

[0124] DMA (6.0 g), water (0.6 g) and Na.sub.2S.sub.2O.sub.4 (1.2 g, 6.9 mmol) were added to Boc-Ser(Bzl)-Lys(Cl—Z)-Gln-Met(O)-Glu(OBzl)-Glu(OBzl)-O(4-NBn) (SEQ ID NO: 33) (1.0 g, 0.69 mmol), and the mixture was stirred at 90° C. for 4 hours. Water (60 g) was subsequently added, and the precipitated solid of Boo-Ser(Bzl)-Lys(Cl—Z)-Gln-Met(O)-Glu(OBzl)-Glu(OBzl)-OH (SEQ ID NO: 32) was obtained by filtration as Fragment F.sup.6 (0.89 g, 0.68 mmol, Purity: 94.6%).

TABLE-US-00027 (2) Production of (SEQ ID NO: 34) Boc-Ser(Bzl)-Lys(Cl-Z)-Gln-Met(O)-Glu(OBzl)- Glu(OBzl)-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile- Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl-Z)-Asn-Gly-Gly-Pro- Ser(Bzl)-Ser(Bzl)-Gly-Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2 

[0125] Dichloromethane (104 g) was added to Boc-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)-Asn-Gly-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2(SEQ ID NO: 31) (13 g, 3.8 mmol) obtained in the above-described Example 5. Methanesulfonic acid (7.3 g, 76 mmol) was subsequently added, and the mixture was stirred for 2 hours. The reaction mixture was cooled in an ice bath. Triethylamine (8.3 g, 82 mmol) was added thereto, and the mixture was stirred for 5 minutes. DMA (169 g), Boc-Ser(Bzl)-Lys(Cl—Z)-Gln-Met(0)-Glu(OBzl)-Glu(OBzl)-OH (SEQ ID NO: 32) (3.9 g, 3.0 mmol) obtained in the above-described Example 6(1) and HOOBt (1.2 g, 7.6 mmol) were added thereto. Subsequently, EDC hydrochloride (0.36 g, 1.9 mmol) was added 4 times every 30 minutes. After the mixture was stirred for 1 hour, Boc-Ser(Bzl)-Lys(Cl—Z)-Gln-Met(O)-Glu(OBzl)-Glu(OBzl)-OH (SEQ ID NO: 32) (2.0 g, 1.5 mmol) was added. The mixture was stirred for 2 hours. Triethylamine (0.19 g, 1.9 mmol) and EDC hydrochloride (0.36 g, 1.9 mmol) were added again, and the mixture was stirred for 13 hours. After water (273 g) was added and the mixture was concentrated under reduced pressure, water (104 g) was added again, and the precipitated solid of Boc-Ser(Bzl)-Lys(Cl—Z)-Gln-Met(O)-Glu(OBzl)-Glu(OBzl)-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)-Asn-Gly-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2(SEQ ID NO: 34) was obtained by filtration as Fragment F.sup.14 (16.1 g).

Example 7: Production of Fragment F.SUP.15 .from Fragment F.SUP.14 .and Fragment

[0126]

TABLE-US-00028 (1) Production of (SEQ ID NO: 35) Boc-His(BOM)-Gly-Glu(OBzl)-Gly-Thr(Bzl)-Phe- Thr(Bzl)-Ser(Bzl)-Asp(OBzl)-Leu-OH

[0127] DMSO (81 g) was added to Boc-His(BOM)-Gly-Glu(OBzl)-Gly-Thr(Bzl)-Phe-Thr(Bzl)-Ser(Bzl)-Asp(OBzl)-Leu-O(4-NBn) (SEQ ID NO: 25) (11 mmol) obtained in the above-described Example 3, and the mixture was warmed to 45° C. Na.sub.2S.sub.2O.sub.4 (5.6 g, 32 mmol) was added thereto, and the mixture was stirred at 65° C. for 7 hours. Then, Na.sub.2S.sub.2O.sub.4 (1.9 g, 11 mmol) was added again, and the mixture was stirred for 3 hours. Water (0.58 g) and Na.sub.2S.sub.2O.sub.4 (2.8 g, 16 mmol) were added. The mixture was stirred for 1 hour and then at 70° C. for 3 hours. After the mixture was cooled to 20° C., water (302 g) was added and the precipitate of Boc-His(BOM)-Gly-Glu(OBzl)-Gly-Thr(Bzl)-Phe-Thr(Bzl)-Ser(Bzl)-Asp(OBzl)-Leu-OH (SEQ ID NO: 35) was obtained by filtration as Fragment F.sup.11 (20 g).

TABLE-US-00029 (2) Production of (SEQ ID NO: 36) Boc-His(BOM)-Gly-Glu(OBzl)-Gly-Thr(Bzl)-Phe- Thr(Bzl)-Ser(Bzl)-Asp(OBzl)-Leu-Ser(Bzl)-Lys(Cl- Z)-Gln-Met(O)-Glu(OBzl)-Glu(OBzl)-Glu(OBzl)-Ala- Val-Arg(Z).sub.2-Leu-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu- Lys(Cl-Z)-Asn-Gly-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly- Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2

[0128] Dichloromethane (177 g) was added to Boc-Ser(Bzl)-Lys(Cl—Z)-Gln-Met(O)-Glu(OBzl)-Glu(OBzl)-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)-Asn-Gly-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2(SEQ ID NO: 34) (15 g, 3.2 mmol) obtained in the above-described Example 6. Methanesulfonic acid (9.3 g, 96 mmol) was subsequently added, and the mixture was stirred for 2 hours. The reaction mixture was cooled in an ice bath. Triethylamine (10 g, 103 mmol) was added, and the mixture was stirred for 5 minutes. DMA (177 g) was added, and Boc-His(BOM)-Gly-Glu(OBzl)-Gly-Thr(Bzl)-Phe-Thr(Bzl)-Ser(Bzl)-Asp(OBzl)-Leu-OH (SEQ ID NO: 35) (6.1 g, 3.5 mmol) obtained in the above-described Example 7(1) and HOOBt (1.1 g, 6.4 mmol) were further added. EDC hydrochloride (1.2 g, 6.4 mmol) was subsequently added, and the mixture was stirred for 4 hours. Boc-His(BOM)-Gly-Glu(OBzl)-Gly-Thr(Bzl)-Phe-Thr(Bzl)-Ser(Bzl)-Asp(OBzl)-Leu-OH (SEQ ID NO: 35) (0.56 g, 0.32 mmol) was further added, and the mixture was stirred for 3 hours. The reaction mixture was subsequently concentrated under reduced pressure. After water (354 g) was added to the residue and the mixture was cooled to 10° C., the precipitated solid of Boc-His(BOM)-Gly-Glu(OBzl)-Gly-Thr(Bzl)-Phe-Thr(Bzl)-Ser(Bzl)-Asp(OBzl)-Leu-Ser(Bzl)-Lys(Cl—Z)-Gln-Met(O)-Glu(OBzl)-Glu(OBzl)-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)-Asn-Gly-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2 (SEQ ID NO: 36) was obtained by filtration as Fragment F.sup.15 (19.3 g).

Example 8: Production of Exenatide

[0129] Dichloromethane (15 g) was added to Boc-His(BOM)-Gly-Glu(OBzl)-Gly-Thr(Bzl)-Phe-Thr(Bzl)-Ser(Bzl)-Asp(OBzl)-Leu-Ser(Bzl)-Lys(Cl—Z)-Gln-Met(O)-Glu(OBzl)-Glu(OBzl)-Glu(OBzl)-Ala-Val-Arg(Z).sub.2-Leu-Phe-Ile-Glu(OBzl)-Trp(CHO)-Leu-Lys(Cl—Z)-Asn-Gly-Gly-Pro-Ser(Bzl)-Ser(Bzl)-Gly-Ala-Pro-Pro-Pro-Ser(Bzl)-NH.sub.2 (SEQ ID NO: 36) (1.0 g, 0.2 mmol) obtained in the above-described Example 7. Methanesulfonic acid (1.2 g, 13 mmol) was subsequently added, and the mixture was stirred for 1 hour. The reaction mixture was cooled in an ice bath, DMF (10 g) was added thereto, and the mixture was concentrated under reduced pressure. Then, after hydrogenation reaction was carried out using Pd/C under hydrogen atmosphere, piperidine was added to obtain exenatide.