Compositions and methods for vaccination against influenza

11191825 · 2021-12-07

Assignee

Inventors

Cpc classification

International classification

Abstract

Described herein are methods and compositions for vaccination against influenza. The compositions comprise recombinant engineered influenza hemagglutinin polypeptides. Also disclosed are methods of producing recombinant engineered influenza hemagglutinin polypeptides in cell-based systems.

Claims

1. A polynucleotide comprising: a nucleotide sequence that encodes three or more isolated, engineered influenza polypeptides; wherein the three or more isolated, engineered influenza polypeptides (a) comprise a hemagglutinin HA.sub.1 domain, and (b) do not comprise a hemagglutinin HA.sub.2 domain or a transmembrane domain; wherein any of the three or more isolated, engineered influenza polypeptides comprises a signal sequence that directs secretion of the polypeptide from a cell; wherein said cell is a yeast cell.

2. The polynucleotide of claim 1, wherein any of the three or more isolated, engineered influenza polypeptides is from an influenza type A or B.

3. The composition of claim 2, wherein any of the three or more isolated, engineered influenza polypeptides is from an influenza type B.

4. The polynucleotide of claim 2, wherein any of the one three or more isolated, engineered influenza polypeptides is from an influenza type A.

5. The polynucleotide of claim 4, wherein any of the three or more isolated, engineered influenza polypeptides is from an H3N2 subtype.

6. The polynucleotide of claim 1, wherein the HA.sub.1 domain of any of the three or more isolated, engineered influenza polypeptides is greater than 40 amino acids in length.

7. The polynucleotide of claim 1 wherein any of the three or more isolated, engineered influenza polypeptides is immunogenic in a human.

8. The polynucleotide of claim 1, wherein the polypeptide sequence of the HA.sub.1 domain is A/Victoria/361/2011.

9. The composition of claim 1 wherein any of the three or more isolated, engineered influenza polypeptides comprises an amino acid sequence with at least 90% amino acid sequence identity to any of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, and combinations thereof.

10. The polynucleotide of claim 1, wherein the nucleotide sequence that encodes any of the three or more isolated, engineered influenza polypeptides comprises an amino acid sequence with at least 90% amino acid sequence identity to any of SEQ ID NO: 19 and is codon optimized for expression in yeast.

11. The polynucleotide of claim 1 further comprising: a pharmaceutically acceptable excipient.

12. The polynucleotide of claim 11, further comprising an immunological adjuvant.

13. A method for immunizing a subject against influenza comprising administering to the subject a composition comprising three or more isolated, engineered influenza polypeptides of claim 1.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 depicts a schematic of the production of an isolated, engineered influenza polypeptide.

(2) FIG. 2 depicts a schematic illustration of a non-limiting embodiment of an engineered hemagglutinin polypeptide of this disclosure.

(3) FIG. 3 illustrates a process flowchart depicting steps taken during isolation/purification of an engineered hemagglutinin of this disclosure.

(4) FIG. 4 shows a coomassie stained SDS-PAGE gel of isolated, engineered hemagglutinin polypeptides.

(5) FIG. 5A shows a coomassie stained SDS-PAGE gel of engineered hemagglutinin polypeptides in supernatant taken after 12 hours of bioreactor culture.

(6) FIG. 5B shows a western blot of engineered hemagglutinin polypeptides in supernatant taken after 12 hours of bioreactor culture.

(7) FIG. 6A shows a coomassie stained SDS-PAGE gel of engineered hemagglutinin polypeptides before purification (lane 1) and after (lane 4); lane 2 depicts engineered hemagglutinin polypeptide from the flow through obtained from loading of the Ni column; and lane 3 depicts engineered hemagglutinin polypeptide obtained from the wash steps of the Ni column.

(8) FIG. 6B shows a western blot of engineered hemagglutinin polypeptides before purification (lane 1) and after (lane 4); lane 2 depicts engineered hemagglutinin polypeptide from the flow through obtained from loading of the Ni column; and lane 3 depicts engineered hemagglutinin polypeptide obtained from the wash steps of the Ni column.

DETAILED DESCRIPTION OF THE INVENTION

Certain Definitions

(9) As used herein “isolated” is synonymous with “purified” and means that a polypeptide that is produced in a cell-based production system is subjected to one or more steps that remove impurities such as non-influenza proteins and polypeptides; cell membrane or cell wall components; and factors secreted from a cell-based system that are not influenza polypeptides; such as carbohydrates, lipids, peptides, or other small molecules. Steps that remove impurities include, but are not limited to, organic extraction, precipitation, concentration, filtration, ultrafiltration, tangential-flow filtration, dialysis, centrifugation, ultracentrifugation, liquid chromatography, including the use of affinity columns or resins. The isolation step can result in different levels of purity. For example, after isolation the engineered influenza polypeptides comprise less than 10%, 5%, 2%, or 1% impurities.

(10) As used herein “engineered” is synonymous with “modified” and means that an influenza polypeptide has one or more differences when compared to the natural sequence of that particular peptide. This difference can be a deletion of one or more amino acids from the NH.sub.2-terminal or C-terminal ends, or addition of one or more amino acids to the NH.sub.2-terminal or C-terminal ends. The difference can also be a one or more point mutations in a given wild-type influenza polypeptide.

(11) As used herein “about” means with 10% of the stated value.

(12) Percent (%) sequence identity with respect to a reference polypeptide sequence is the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are known for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Appropriate parameters for aligning sequences are able to be determined, including algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif., or may be compiled from the source code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.

(13) In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows: 100 times the fraction X/Y, where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program.

(14) Engineered Hemagglutinin Polypeptides

(15) Influenza hemagglutinin (HA) protein forms into a homotrimeric complex expressed on the surface of the mature influenza virion. The protein has two major domains: the globular HA.sub.1; and the α-helical HA.sub.2. HA.sub.1 mediates cell entry of influenza by binding to sialic acid on the surface of a target cell. After the cell internalizes the virion into an endosomal/lysosomal compartment, at a pH of about 6.0, the conformation of the HA protein changes so that the HA.sub.2 domain anchors the virion into the lipid bilayer of the endosomal compartment, allowing entry into the cytoplasm of the host cell, and viral replication.

(16) Described herein are compositions comprising one or more isolated, engineered influenza polypeptides. The polypeptides are useful for the prophylactic immunization against influenza. In certain embodiments, any of the one or more isolated, engineered influenza polypeptides comprises the HA protein. In certain embodiments, any of the one or more isolated, engineered influenza polypeptides comprises a fragment of the HA protein. In certain embodiments, the fragment of the HA protein is the HA.sub.1 domain. In certain embodiments, the HA.sub.1 domain fragment can extend into the HA.sub.2 domain by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, or 20 amino acids or less. In certain embodiments, the fragment of the HA protein: (a) comprises an HA.sub.1 domain, and (b) does not comprise a HA.sub.2 domain or a transmembrane domain. In certain embodiments, the fragment of the HA protein comprises greater than 10 amino acids. In certain embodiments, the fragment of the HA protein comprises greater than 40 amino acids. In certain embodiments, the fragment of the HA protein comprises greater than 50 amino acids. In certain embodiments, the fragment of the HA protein comprises greater than 100 amino acids. In certain embodiments, the fragment of the HA protein comprises less than the 300 amino acids from the NH.sub.2-terminus of the HA protein. In certain embodiments, the 300 amino acids from the NH.sub.2-terminus of the HA protein lack the influenza signal sequence. In certain embodiments, the fragment of the HA protein does not comprise the HA.sub.2 domain. In certain embodiments, the fragment of the HA protein does not comprise a transmembrane domain. In certain embodiments, the fragment of the HA protein comprises an amino acid set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the fragment of the HA protein comprises an HA.sub.1 domain with an amino acid sequence at least 80% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the fragment of the HA protein comprises an HA.sub.1 domain with an amino acid sequence at least 90% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the fragment of the HA protein comprises an HA.sub.1 domain with an amino acid sequence at least 95% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the fragment of the HA protein comprises an HA.sub.1 domain with an amino acid sequence at least 97% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the fragment of the HA protein comprises an HA.sub.1 domain with an amino acid sequence at least 98% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the fragment of the HA protein comprises an HA.sub.1 domain with an amino acid sequence at least 99% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the HA protein has not been modified or mutated at a cysteine residue.

(17) The one or more isolated, engineered influenza polypeptides can be modified in several ways in order to increase immunogenicity of the polypeptide, or to increase yield from a cell-based protein production system. In certain embodiments, the transmembrane domain may be deleted to improve solubility, and/or allow secretion from a cell. In certain embodiments, a signal peptide is attached to the NH.sub.2-terminus of any of the influenza polypeptides in order to direct secretion from a cellular protein production system. In certain embodiments, the signal peptide is the yeast alpha factor signal sequence. In certain embodiments, the signal peptide comprises an amino acid sequence set forth in SEQ ID NO: 22. In certain embodiments, the signal peptide comprises an amino acid sequence 80% identical to that set forth in SEQ ID NO: 22. In certain embodiments, the signal peptide comprises an amino acid sequence 90% identical to that set forth in SEQ ID NO: 22. In certain embodiments, the signal peptide comprises an amino acid sequence 95% identical to that set forth in SEQ ID NO: 22. In certain embodiments, the signal peptide comprises an amino acid sequence 98% identical to that set forth in SEQ ID NO: 22. In certain embodiments, the signal peptide comprises an amino acid sequence 99% identical to that set forth in SEQ ID NO: 22. In certain embodiments, the polypeptide comprises one or more purification tags, to facilitate purification of a recombinant polypeptide such as: a poly-histidine tag (e.g., 5-10 histidine residues in length); a 6×HIS tag; a poly-glutamine tag; a c-MYC tag (EQKLISEEDL); a FLAG tag (DYKDDDDK); a V5 tag (GKPIPNPLLGLDST); VSV-tag (YTDIEMNRLGK); an Xpress tag; or any combination thereof. In certain embodiments, the purification tag comprises an amino acid sequence set forth in SEQ ID NO: 21. In certain embodiments, the purification tag is covalently attached to the NH.sub.2-terminus of the polypeptide. In certain embodiments, the purification tag is covalently attached to the C-terminus of the polypeptide. In certain embodiments, any of the one or more influenza polypeptides comprises a cleavage site between the HA polypeptide and the purification tag. In certain embodiments, the cleavage site is an enterokinase/enteropeptidase cleavage site. In certain embodiments, any of the one or more isolated, engineered influenza polypeptides consists of an NH.sub.2-terminal alpha secretion factor signal peptide, the HA.sub.1 domain of an influenza hemagglutinin protein, and a polyhistidine purification tag. In certain embodiments, any of the one or more isolated, engineered influenza polypeptides comprise an NH.sub.2-terminal alpha secretion factor signal peptide, the HA.sub.1 domain of an influenza hemagglutinin protein with an amino acid sequence set forth in any of SEQ ID NOs:1-20, and a polyhistidine purification tag. In certain embodiments, any of the one or more isolated, engineered influenza polypeptides consist of an NH.sub.2-terminal alpha secretion factor signal peptide, the HA.sub.1 domain of an influenza hemagglutinin protein set forth in any of SEQ ID NOs:1-20, and a polyhistidine purification tag. In certain embodiments, any of the one or more isolated, engineered influenza polypeptides consists of an NH.sub.2-terminal alpha secretion factor signal peptide, the HA.sub.1 domain of an influenza hemagglutinin protein, an enterokinase cleavage site (Asp-Asp-Asp-Asp-Lys), and a polyhistidine purification tag. In certain embodiments, any of the one or more isolated, engineered influenza polypeptides consist of an NH.sub.2-terminal alpha secretion factor signal peptide, the HA.sub.1 domain of an influenza hemagglutinin protein with an amino acid sequence set forth in any of SEQ ID NOs:1-20, an enterokinase cleavage site (Asp-Asp-Asp-Asp-Lys), and a polyhistidine purification tag. In certain embodiments, any of the one or more isolated, engineered influenza polypeptides consist of an HA.sub.1 domain of an influenza hemagglutinin protein with an amino acid sequence set forth in any of SEQ ID NOs:1-20, an enterokinase cleavage site (Asp-Asp-Asp-Asp-Lys), and a polyhistidine purification tag. In certain embodiments, any of the one or more isolated, engineered influenza polypeptides consist of an HA.sub.1 domain of an influenza hemagglutinin protein with an amino acid sequence set forth in any of SEQ ID NOs:1-20, and an enterokinase cleavage site (Asp-Asp-Asp-Asp-Lys). In certain embodiments, an isolated engineered influenza polypeptide is less than 50 kDa. In certain embodiments, an isolated engineered influenza polypeptide is less than 40 kDa. In certain embodiments, an isolated engineered influenza polypeptide is greater than 10 kDa. In certain embodiments, an isolated engineered influenza polypeptide is greater than 20 kDa. In certain embodiments, an isolated engineered influenza polypeptide is greater than 30 kDa.

(18) Different organisms display different patterns of glycosylation at amino acid residues in proteins. Generally, high-mannose glycans are attached to asparagines in the endoplasmic reticulum (ER) and are modified during subsequent transit through the ER and Golgi apparatus. For proteins that are produced in cellular expression systems, different systems can generate different types of glycans. For example, proteins produced from insect cells tend to lack terminal sialyation. In humans, however, most asparagine linked glycans display modification by terminal sialic acid or N-Acetylneuraminic acid (Neu5Ac) attached to N-acetylglucosamine (GlcNAc). Any of the one or more isolated, engineered influenza polypeptides can be glycosylated in a way that mimics human glycosylation. In certain embodiments, greater than 50% of all N-linked glycans of an isolated, engineered influenza polypeptide comprise a sialic acid or N-Acetylneuraminic acid (Neu5Ac). In certain embodiments, greater than 60% of all N-linked glycans of an isolated, engineered influenza polypeptide comprise a sialic acid or N-Acetylneuraminic acid (Neu5Ac). In certain embodiments, greater than 70% of all N-linked glycans of an isolated, engineered influenza polypeptide comprise a sialic acid. In certain embodiments, greater than 80% of all N-linked glycans of an isolated, engineered influenza polypeptide comprise a sialic acid or N-Acetylneuraminic acid (Neu5Ac). In certain embodiments, greater than 90% of all N-linked glycans of an isolated, engineered influenza polypeptide comprise a sialic acid or N-Acetylneuraminic acid (Neu5Ac).

(19) Strains of Influenza and HA Polypeptides

(20) This disclosure describes a flexible platform for the production of engineered influenza polypeptides which is broadly applicable to any soluble influenza polypeptide or antigen. In a certain embodiment, the compositions of the current disclosure comprise one or more HA polypeptides from any strain currently used in flu vaccine production, or that may occur in association with human disease. In certain embodiments, the composition contains at least one, two, three, four, or five different influenza HA polypeptides, each from a different strain. In certain embodiments, the influenza HA polypeptide may be derived from any H1N1 or H3N2 strain. In certain embodiments, the influenza HA polypeptide may be derived from any H5N1 strain. In certain embodiments, influenza HA polypeptides may be derived from any one, two, three, four, or five of the following strains: A/Moscow/10/1999; A/New_Caledonia/20/1999; B/Sichuan/379/1999; A/Panama/2007/1999; B/Hong_Kong/330/2001; A/Wyoming/03/2003; B/Shanghai/361/2002; A/Wisconsin/67/2005; B/Malaysia/2506/2004; A/Hiroshima/52/2005; B/Ohio/1/2005; A/Solomon Islands/3/2006; A/Brisbane/59/2007; A/Brisbane/10/2007; B/Florida/4/2006; B/Brisbane/60/2008; A/California/7/2009; A/Perth/16/2009; A/Victoria/361/2011; B/Massachusetts/02/2012, and combinations thereof.

(21) Any of the one or more isolated, engineered influenza polypeptides can be linked to a purification tag using a fusion tag cleavage site that facilitate removal of the purification tag from the engineered influenza polypeptide. Fusion tag cleavage sites comprise, for example, an enterokinase cleavage site (Asp-Asp-Asp-Asp-Lys), Facto Xa cleavage site (Ile-Glu or Asp-Gly-Arg-X), HRV3C Protease (Leu-Glu-Val-Leu-Phe-Gln-Gly-Pro-X), TEV Protease (Glu-Asn-Leu-Tyr-Phe-Gln-Gly-X), or a thrombin cleavage site. In certain embodiments, any of the one or more isolated, engineered influenza polypeptides can comprise a remnant of a fusion tag cleavage site, that is the amino acids that remain after an enzyme that cleaves the fusion tag cleavage site. For example, enterokinase specifically cleaves polypeptides at the specific sequence, Asp-Asp-Asp-Asp-Lys-X, with X being any amino acid other than proline, at the C-terminal end of the lysine, making the remnant (Asp-Asp-Asp-Asp-Lys).

(22) Mixtures of Isolated, Engineered Polypeptides

(23) The isolated, engineered influenza polypeptides of the current disclosure are useful for prophylactic vaccination against influenza. Current seasonal influenza vaccines are made up of at least three, and sometimes four different influenza strains. In certain embodiments, described herein, are compositions comprising one or more isolated, engineered influenza polypeptides. In certain embodiments, are compositions comprising two or more isolated, engineered influenza polypeptides. In certain embodiments, are compositions comprising three or more isolated, engineered influenza polypeptides. In certain embodiments, are compositions comprising four or more isolated, engineered influenza polypeptides. In certain embodiments, are compositions comprising five or more isolated, engineered influenza polypeptides. In certain embodiments, described herein, are compositions consisting essentially of one or more isolated, engineered influenza polypeptides. In certain embodiments, are compositions consisting essentially of two or more isolated, engineered influenza polypeptides. In certain embodiments, are compositions consisting essentially of three or more isolated, engineered influenza polypeptides. In certain embodiments, are compositions consisting essentially of four or more isolated, engineered influenza polypeptides. In certain embodiments, are compositions consisting essentially of five or more isolated, engineered influenza polypeptides. In certain embodiments, described herein, are compositions consisting essentially of one or more isolated, engineered influenza polypeptides and an immunological adjuvant. In certain embodiments, are compositions consisting essentially of two or more isolated, engineered influenza polypeptides and an immunological adjuvant. In certain embodiments, are compositions consisting essentially of three or more isolated, engineered influenza polypeptides and an immunological adjuvant. In certain embodiments, are compositions consisting essentially of four or more isolated, engineered influenza polypeptides and an immunological adjuvant. In certain embodiments, are compositions consisting essentially of five or more isolated, engineered influenza polypeptides and an immunological adjuvant. Consisting essentially means that the composition contains the recited constituents plus non-active, inert ingredients that act merely to preserve, stabilize, solubilize, or provide volume and viscosity to the composition without imparting additional antigenicity or immunogenicity to the vaccine.

(24) Cell Based Systems for Production of Engineered Hemagglutinin Polypeptides

(25) The isolated, engineered influenza polypeptides of the current disclosure are purified from a cell based protein production system that has been transformed, transfected, or infected with a nucleic acid encoding an engineered influenza polypeptide. In certain embodiments, the cell based protein production system is stably transformed with the nucleic acid, such that the nucleic acid integrates into at least one chromosome of the cell based protein production system. In certain embodiments, the eukaryotic system is yeast. In certain embodiments, the yeast is a Pichia pastoris strain. In certain embodiments, the Pichia pastoris strain is GS115, KM71H, SMD1168, BG08, BG, 09, BG10, BG11, or SMD1168H. In certain embodiments, the Pichia pastoris strain is GS115. In certain embodiments, the strain of Pichia pastoris is modified to produce a human glycosylation pattern in polypeptides produced using the system. In certain embodiments, the strain of Pichia pastoris is modified to delete the endogenous yeast glycosylation pathway. In certain embodiments, the yeast comprises a human gene encoding any of mannosidase I, mannosidase II, N-acetylglucosaminyl transferase I, N-acetylglucosaminyl transferase II, and uridine 5′-diphosphate (UDP)-N-acetylglucosamine transporter. In certain embodiments, the strain of Pichia pastoris is modified to produce terminal sialyation on N-linked glycans. In certain embodiments, the strain of Pichia pastoris is modified to produce terminal sialyation on N-linked glycans. In certain embodiments, the cell based protein purification system does not comprise insect cells. In certain embodiments, the cell based protein purification system does not comprise eggs.

(26) Nucleic Acids Encoding Engineered Hemagglutinin Proteins

(27) The isolated, engineered influenza polypeptides of the current disclosure can be produced in cell based protein production systems that have been modified by nucleic acids to express the engineered influenza polypeptides. Therefore, any of the engineered influenza polypeptides described herein can be encoded by a nucleic acid. In certain embodiments, the nucleic acid is a plasmid. In certain embodiments, the plasmid comprises an origin or replication for propagation in E. coli. In certain embodiments, the nucleic acid is encoded on a plasmid suitable for transforming yeast. In certain embodiments, the plasmid is suitable for homologous recombination in yeast. In certain embodiments, the plasmid comprises a gene for a yeast auxotrophy such as histidine, tryptophan, leucine, lysine, methionine, or uracil. In certain embodiments, the plasmid has a gene that confers antibiotic resistance to ampicillin, kanamycin, neomycin, G418, carbenicillin, chloramphenicol, blasticidin, zeocin, or any combination thereof. In a certain embodiment, the plasmid is pPIC9 SHUTTLE. In certain embodiments, the nucleic acid is a linear single or double stranded DNA molecule able to undergo homologous recombination in yeast. In certain embodiments, the nucleic acid is a double stranded linear DNA molecule that comprises any of the engineered influenza polypeptides of the current disclosure. In certain embodiments, the nucleic acid is a PCR product that comprises any of the engineered influenza polypeptides of the current disclosure. In certain embodiments, the nucleic acid comprises a sequence that encodes any of the polypeptides set forth in SEQ ID NOs:1-20. In certain embodiments, the nucleic acid comprises a sequence that encodes any of the polypeptides set forth in SEQ ID NOs:1-20. In certain embodiments, the nucleic acid comprises a sequence that encodes a polypeptide with an amino acid sequence at least 80% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the nucleic acid comprises a sequence that encodes a polypeptide with an amino acid sequence at least 90% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the nucleic acid comprises a sequence that encodes a polypeptide with an amino acid sequence at least 95% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the nucleic acid comprises a sequence that encodes a polypeptide with an amino acid sequence at least 97% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the nucleic acid comprises a sequence that encodes a polypeptide with an amino acid sequence at least 98% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the nucleic acid comprises a sequence that encodes a polypeptide with an amino acid sequence at least 99% identical to that set forth in any of SEQ ID NOs: 1-20. In certain embodiments, the engineered influenza polypeptide is encoded by a nucleic acid that has been codon optimized for expression in yeast.

(28) Subjects for Vaccination

(29) In certain embodiments, the one or more isolated, engineered influenza polypeptides are administered to an individual in order to induce a primary immune response in the individual. In certain embodiments, the individual is a human, pig, or chicken. In certain embodiments, the individual is a human. In certain embodiments, the one or more isolated, engineered influenza polypeptides are administered to an individual previously subject to influenza vaccination in order to boost an immune response in the individual previously subject to influenza vaccination. In certain embodiments, the one or more isolated, engineered influenza polypeptides are administered to an individual with at least one risk factor associated with influenza related mortality such as a child under 2 years of age, a pregnant woman, an immunocompromised individual, an individual afflicted with COPD/emphysema, an individual over the age of 65, a person diagnosed with HIV, a person receiving chemotherapy or radiation therapy, or a person with a genetic immunodeficiency disorder, such as X-SCID. In certain embodiments, the one or more isolated, engineered influenza polypeptides are administered to an individual with an egg allergy. In certain embodiments, the one or more isolated, engineered influenza polypeptides are administered to an individual with a severe egg allergy. In certain embodiments, the one or more isolated, engineered influenza polypeptides are suitable for administration to an individual with a severe egg allergy. In certain embodiments, the one or more isolated, engineered influenza polypeptides are administered to an individual mixed with an immunological adjuvant. In certain embodiments, the one or more isolated, engineered influenza polypeptides are administered to an individual mixed with a pharmaceutically acceptable vehicle, carrier, or excipient.

(30) Dosage Schedules and Amounts

(31) In certain embodiments, the one or more isolated, engineered influenza polypeptides of the current disclosure are formulated as a liquid for administration via an intramuscular injection. In certain embodiments, the liquid form is formulated in single use vials or syringes. In certain embodiments, the liquid form is lyophilized and can be reconstituted with a suitable liquid such as sterile water or saline. In certain embodiments, the liquid form is formulated for a dose of between 0.1 and 1.0 mL. In certain embodiments, the liquid form is formulated for a dose of between 0.2 and 0.8 mL. In certain embodiments, the liquid form is formulated for a dose of between 0.4 and 0.6 mL. In certain embodiments, the liquid form is formulated for a dose of about 0.5 mL. In certain embodiments, the concentration of any of the isolated, engineered influenza polypeptides is between 1 μg/mL and 100 μg/mL. In certain embodiments, the concentration of any of the isolated, engineered influenza polypeptides is between 10 μg/mL and 100 μg/mL. In certain embodiments, the concentration of any of the isolated, engineered influenza polypeptides is between 40 μg/mL and 60 μg/mL. In certain embodiments, the concentration of any of the isolated, engineered influenza polypeptides is greater than 1 μg/mL. In certain embodiments, the concentration of any of the isolated, engineered influenza polypeptides is greater than 10 μg/mL. In certain embodiments, the concentration of any of the isolated, engineered influenza polypeptides is greater than 20 μg/mL. In certain embodiments, the concentration of any of the isolated, engineered influenza polypeptides is greater than 40 μg/mL. In certain embodiments, the concentration of any of the isolated, engineered influenza polypeptides is less than 100 μg/mL. In certain embodiments, the concentration of any of the isolated, engineered influenza polypeptides is less than 80 μg/mL. In certain embodiments, the concentration of any of the isolated, engineered influenza polypeptides is less than 60 μg/mL. In certain embodiments, any of the isolated, engineered influenza polypeptides are administered seasonally or once a year. In a certain embodiment, the one or more isolated, engineered influenza polypeptides of the current disclosure are administered to a subject in a therapeutically or prophylactically acceptable amount. A prophylactically acceptable amount is one that induces an antibody response sufficient to prevent or lessen the impact of a subsequent natural infection with an influenza strain corresponding to the one used for immunization. The prophylactically acceptable amount can vary depending on the exact strain or immunological adjuvant used in the isolated, engineered influenza polypeptide composition.

(32) Immunological Adjuvants

(33) In certain embodiments, described herein, are compositions of matter that comprise one or more isolated, engineered influenza polypeptides and an immunological adjuvant in an amount effective to enhance an immune response. In certain embodiments, the adjuvant comprises an adjuvant currently used in flu vaccination, such as MF59, an oil-in-water emulsion using squalene. In certain embodiments, the adjuvant is a mineral salt. In certain embodiments, the adjuvant comprises alum salt. In certain embodiments, the adjuvant comprises aluminum phosphate or aluminum hydroxide. In certain embodiments, the adjuvant comprises Quil A or saponin QS-21. In certain embodiments, the adjuvant comprises N-acetyl muramyl-L-alanyl-D-isoglutamine (MDP). In certain embodiments, the adjuvant comprises a Freund's adjuvant, such as CFA or IFA; Montanide; Adjuvant 65; Lipovant; or any combination thereof. In certain embodiments, the adjuvant comprises a cytokine such as interferon gamma or GM-CSF. In certain embodiments, described herein, the adjuvant comprises one or more Toll-like receptor (TLR) ligands. In certain embodiments, the TLR ligand is LPS or a CpG oligonucleotide. In certain embodiments, the TLR ligand activates signaling through any one of TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, or TLR9.

(34) Pharmaceutically Acceptable Vehicle, Carrier, or Excipient

(35) In certain embodiments, described herein, are compositions of matter that comprise one or more isolated, engineered influenza polypeptides and a pharmaceutically acceptable vehicle, carrier, or excipient. In certain embodiments, the pharmaceutically acceptable vehicle, carrier, or excipient comprises a pH buffer or pH modifier. In certain embodiments, the pH buffer or pH modifier comprises sodium bicarbonate, HEPES, MOPS, MEPES, phosphate buffer, succinate buffer, citric acid, ascorbic acid, or any combination thereof. In certain embodiments, the pharmaceutically acceptable vehicle, carrier or excipient comprises a salt solution. In certain embodiments, the salt solution comprises sodium chloride, potassium chloride, calcium chloride, hemin chloride, benzethonium chloride, or any combination thereof. In certain embodiments, the pharmaceutically acceptable vehicle, carrier or excipient comprises a carbohydrate. In certain embodiments, the carbohydrate comprises sucrose, dextrose, trehalose, lactose, cellulose, sorbitol, galactose, dextran, xanthan, or any combination thereof. In certain embodiments, the pharmaceutically acceptable vehicle, carrier or excipient comprises an amino acid or protein. In certain embodiments, the amino acid or protein comprises gelatin, egg protein, yeast extract, glutamate, albumin, In certain embodiments, the pharmaceutically acceptable vehicle, carrier or excipient comprises an emulsifier. In certain embodiments, the emulsifier comprises octylphenol ethoxylate (Triton X-100), polysorbate 20, polysorbate 80 (Tween 80), sodium deoxy cholate, or any combination thereof. In certain embodiments, the pharmaceutically acceptable vehicle, carrier or excipient comprises a chelating agent. In certain embodiments, the chelating agent comprises ethylene diamine tetra acetic acid sodium (EDTA), EGTA, or any combination thereof. In certain embodiments, the carrier is poly D,L-lactide-co-glycolide (PLGA).

(36) Master Cell Bank and Transgenic Yeast

(37) In a certain embodiment, described herein is a master cell bank comprising a yeast that comprises a nucleic acid encoding one or more influenza polypeptides integrated into its genome creating a transgenic yeast strain. In some embodiments, the master cell bank comprises a plurality of yeast cells that each comprise a nucleic acid encoding an influenza polypeptide from a different strain of influenza integrated into its genome creating a transgenic yeast strain. In certain embodiments, the influenza polypeptide is an engineered polypeptide comprising an HA.sub.1 domain. In certain embodiments, the influenza polypeptide (a) comprises a hemagglutinin HA.sub.1 domain; and (b) does not comprise a hemagglutinin HA.sub.2 domain or a transmembrane domain. In certain embodiments, the nucleic acid is maintained extrachromosomally on a plasmid or yeast artificial chromosome. In certain embodiments, the nucleic acid is integrated into a chromosomal location. In certain embodiments, the yeast is Pichia pastoris. In certain embodiments, the Pichia pastoris is a GS115 strain. In certain embodiments, the transgenic yeast is created by transformation with linearized plasmid, a PCR product, or a synthesized double stranded DNA molecule. In certain embodiments, the transgenic yeast is created by homologous recombination. In certain embodiments, the master cell bank comprises a cryopreservative suitable for freezing to at least about −80° or below. In certain embodiments, the master cell bank comprises glycerol at between 10 and 30%, and is suitable for long term storage at about −80° or below. In certain embodiments, the master cell bank can preserve a transgenic yeast strain for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more years.

EXAMPLES

(38) The following examples are for illustrative purposes and do not serve to restrict the scope of this disclosure.

Example 1—Yeast Production of an Isolated, Engineered Influenza Polypeptide for Use in Vaccination Against the Influenza Virus

(39) Referring to FIG. 1, in step I, a suitable influenza polypeptide is selected for further modification and molecular engineering 1. A schematic of an exemplary engineered hemagglutinin polypeptide is shown in FIG. 2. In this case, the HA.sub.1 domain of a full-length hemagglutinin polypeptide is defined. Optionally, the structure of the defined HA.sub.1 domain can be checked using protein structure modeling software, such as Swiss-Model. See Arnold et al. “The SWISS-MODEL Workspace: A web-based environment for protein structure homology modelling,” Bioinformatics, 22, 195-201. If the overall tertiary structure of the HA.sub.1 polypeptide fragment is not preserved, the polypeptide can be further modified by deleting or adding residues from the original full-length hemagglutinin polypeptide to better preserve structure after expression. In any case, this HA.sub.1 domain will lack the influenza signal sequence and the transmembrane domain of the full-length HA protein, and a substantial portion of the HA.sub.2 domain. This should leave a soluble antigenic HA.sub.1 polypeptide.

(40) After the antigenic HA.sub.1 sequence is determined, a full construct can be engineered that allows for efficient production of the polypeptide in a yeast system. First, a polyhistidine sequence consisting of 6 histidine residues is added, and optionally, an enterokinase cleavage site (DDDDK) is added between the HA polypeptide sequence and the polyhistidine tag. The enterokinase cleavage site allows removal of the polyhistidine tag after or during purification so that the tag will not be present in the final polypeptide preparation. Additionally, a secretory leader sequence, such as the yeast alpha factor signal peptide, is added to the NH.sub.2-terminus in order to direct secretion from yeast. After this step the amino acid sequence should comprise a fully soluble HA.sub.1 sequence, which lacks both the HA.sub.2 and transmembrane domains, and the endogenous HA signal sequence; with the addition of an NH.sub.2-terminal alpha factor secretory leader and a C-terminal 6×HIS purification tag, that is separated from the fully soluble HA.sub.1 sequence by an enterokinase cleavage site. After the amino acid sequence of the polypeptide is determined, a DNA sequence is reverse translated from this amino acid sequence, and optionally, the sequence may be codon optimized resulting in high expression levels in yeast. Restriction sites are then added to flank the full construct for ease of cloning into a shuttle vector. The DNA sequence can then be synthesized by methods that are known in the art and commercially available.

(41) After synthesis, the DNA encoding the engineered HA.sub.1 polypeptide is cloned into a shuttle vector that facilitates homologous recombination in yeast (e.g., pPIC9 SHUTTLE). Briefly, the DNA encoding the engineered HA.sub.1 polypeptide is digested with restriction enzymes and ligated into a shuttle vector (i.e., plasmid vector) that has been digested with the same enzymes. After the ligation reaction is carried out the ligated shuttle plasmid/engineered HA.sub.1 polypeptide DNA is transformed into E. coli (e.g., DH5α), and transformed bacteria are selected using plates containing a selective antibiotic corresponding to an antibiotic resistance gene in present in the shuttle plasmid/engineered HA.sub.1 polypeptide (e.g., Kanamycin). The plates are incubated at 37° overnight, and colonies that grow under antibiotic selection are chosen for further analysis. Colonies are then grown in liquid culture to high density, and plasmid DNA is prepared using the alkaline lysis method. The plasmid DNA can then be analyzed by restriction mapping, PCR, or sequencing to verify the accuracy of the DNA encoding the engineered HA.sub.1 polypeptide.

(42) Referring to FIG. 1, step II, once the shuttle plasmid encoding the engineered HA.sub.1 polypeptide is designed, constructed and prepared it can be introduced into a suitable yeast system by cell engineering 2. The shuttle plasmid is linearized by restriction enzyme digestion and transformed into yeast where it stably integrates into the genome by homologous recombination. The Pichia pastoris strain GS115 is grown at 30° in 500 mL of rich media (e.g., YPD) to log phase at an O.D of 1.5 at 590 nm, harvested, washed and resuspended in 1 mL of 1M sorbitol. The yeast cells are then transformed by electroporation using 20 μg of linearized shuttle plasmid encoding the engineered HA.sub.1 polypeptide at 1500 V, 25 μF, 200Ω over 5-10 seconds with an electrode gap of 0.2 cm. The cells are then grown in a dextrose based recovery media, and plated on minimal media corresponding to an auxotrophy of GS115 strain and selection marker present on the linearized shuttle plasmid encoding the engineered HA.sub.1 polypeptide (e.g., Histidine). This first round of selection results in GS115 clones that have at least one integrated a copy of the linearized shuttle plasmid encoding the engineered HA.sub.1 polypeptide.

(43) After the first round of selection, GS115 clones are selected that have integrated multiple copies of the plasmid in a second round of selection. Selection for the first selection marker (histidine), is followed by selection for a second marker present on the linearized shuttle plasmid encoding the engineered HA.sub.1 polypeptide (the ability metabolize methanol). After GS115 clones have been selected on minimal media lacking histidine, the clones are re-plated on histidine minimal media with the addition of methanol to select for clones that are able to grow in the presence of methanol. In this step multiple different selections can be carried out at different concentrations of methanol to select for GS115 that are more or less sensitive to methanol, and should express different levels of the engineered HA polypeptides. From this second round of selection clones are selected and tested for expression and secretion of the engineered HA.sub.1 polypeptide. This can be done using any suitable protein analysis technique such as SDS-PAGE, ELISA, or Western blot.

(44) Referring to FIG. 1, Step III, selected GS115 clones can be chosen and scaled-up for large scale protein isolation and purification in a bioprocess engineering step 3. FIG. 3 elaborates steps in the purification. For example, GS115 clones can be thawed from a cryopreserved frozen stock 301, grown in a low volume starter culture 302 and expanded using a using a fed-batch reactor system 303 with a methanol gradient at a rate of 3.6 mL/h/L to 10.9 mL/h/L in 64 hours. After achieving a maximum cell density supernatants can be harvested by centrifugation 305, the supernatants are filtered 306 to remove cellular debris, then subjected to ultrafiltration 307 to remove high molecular weight protein aggregates or low molecular components. The engineered influenza HA polypeptide can be loaded onto a nickel column 308, and unbound or weakly bound proteins and cellular components can be washed at step 309 virtue of the 6×HIS tag. Polypeptides can be eluted from the column 310 using an imidazole gradient, or by cleavage of the enterokinase cleavage site, yielding a recombinant influenza antigen 4.

(45) Alternatively, a “frozen stock” or “master cell bank” can be created by freezing GS115 clones in 20-30% glycerol, and storing at −80° C. or below. This facilitates rapid production of vaccines by allowing for immediate thawing and scale up of clones that have already been selected for optimal expression and efficient production.

Example 2—Yeast Production of an Isolated, Engineered Influenza Polypeptide for Use in Vaccination Against the Influenza Virus

(46) Purification by IMAC

(47) FIGS. 4 through 6 show influenza polypeptides produced by the methods described herein. The purification process was started after 84 hours of induction, the sample was centrifuged at 20,000 g at 4° C. for 20 minutes, afterwards the supernatant was concentrated in a Pellicon XL Ultrafiltration Module Biomax (Millipore, Darmstaddt, Germany) with a pore size of 10 kDa. The concentrated solution was filtered through a membrane of 0.45 μm (Pall Corporation, USA) and stored at 4° C. for further processing in IMAC columns. The purifications were carried out on an IMAC pre-packed chromatographic column: 1 and 5 mL His Trap FF (GE Healthcare, UK) and processed as follows: the supernatant was poured into a previously equilibrated Ni+ column. PBS was used as a mobile phase. The supernatant was washed with 10 mL of PBS, followed by another wash with 10 mL PBS+10 mM Imidazole. The protein was eluted with 10 mL of PBS+500 mM Imidazole, the eluted volume was filtered through a 10 kDa membrane (Amicon, Millipore, Darmstadt, Germany) to salt the sample out. The process was repeated tree times and finally the concentration of HA was evaluated with nanodrop (Thermo Scientific, Waltham, Mass., USA), and Bradford assay (Pierce™ Coomassie Bradford Protein Assay Kit, Life Technologies), and visualized in an SDS-PAGE gel.

(48) SDS-PAGE Analysis

(49) Protein production and purification processes were verified by SDS-PAGE using the standard Laemmli method. For the P. pastoris clone samples, 100 μL of supernatant of each clone was concentrated with the Methanol-Chloroform method and the pellets were dried in a Speed Vac Concentrator (Savant Instruments Inc., Farmingdale, N.Y., USA); the samples were resuspended in 10 μL of miliQ water and 10 μL of loading buffer, denatured and used for electrophoresis analysis. The gels were stained with Coomassie brilliant blue R250 (Bio-Rad, Hercules, Calif.), and scanned with an Image Scanner III (GE Healthcare, Amersham, UK). The resulting image was analyzed with densitometry software on TotalLab (TotalLab, Biostat, Jahnsdorf, Germany). FIG. 4 shows Coomassie staining for total protein post purification from 2 different yeast strains expressing engineered hemagglutinin proteins showing high levels of expression. The engineered hemagglutinin proteins are the dark band at approximately 30 kDa. FIG. 5A shows Coomassie staining for total protein post purification from yeast strains expressing engineered hemagglutinin proteins taken at 12 hours post induction. FIG. 6A shows Coomassie staining for total protein post purification from a yeast strain before purification (lane 1) and after (lane 4); lane 2 depicts engineered hemagglutinin polypeptide from the flow through obtained from loading of the nickel column; and lane 3 depicts engineered hemagglutinin polypeptide obtained from the wash steps of the nickel column. Lane 4 shows a highly pure hemagglutinin polypeptide preparation.

(50) Western Blot

(51) The western blot analysis was performed according to standard protocols, the samples collected from the Erlenmeyer flasks were loaded into the Western Blot, with the same concentration as the samples loaded on the SDS-PAGE. The purity of both of the HA obtained from P. pastoris could be verified. The samples were loaded at a concentration of 1 g/Land run on an SDS-PAGE gel at 10% and then transferred to a nitrocellulose Hybond-ECL membrane (Amercham Biosciences, UK). The membrane was then blocked for an hour with a solution of PBS and skim milk at 3%. Then the membrane was washed 3 times with the washing buffer, PBS-Tween 20 (1:1000). The membrane was then immersed in a solution with an anti-His antibody at a dilution 1:100 in 1×PBS and incubated for 1 hour at 25° C. and 100 rpm. Three more washes were made, the secondary labeled with horseradish peroxidase (PIERCE®, Thermo Scientific, Waltham, Mass., USA) was added at 1:10,000 dilution in PBS. For immune staining, color was developed by adding Tetra methyl-bencinidyn (Thermo Scientific, Waltham, Mass., USA), finally the membrane was photographed with a Canon EOS 450D camera. FIG. 5B shows western blot for engineered hemagglutinin protein taken at 12 hours post induction. FIG. 6B shows western blot for engineered hemagglutinin protein before purification (lane 1) and after (lane 4); lane 2 depicts engineered hemagglutinin polypeptide from the flow through obtained from loading of the nickel column; and lane 3 depicts engineered hemagglutinin polypeptide obtained from the wash steps of the nickel column.

(52) While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention.

(53) TABLE-US-00001 SEQUENCES SEQ ID NO: 1 >A/Moscow/10/1999_(B_C_D_) STGRICDSPHQILDGENCTLIDALLGDPHCDGFQNKEWDLFVERSKAYSN CYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVAQNGTSSACKRRSIKS FFSRLNWLHQLENRYPALN VTMPNNDKFDKLYIWGVHHPSTDSVQTSVYVQASGRVTVSTKRSQQTVIP NIGSRPWVRGVSSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKS SIMRS SEQ ID NO: 2 >A/New_Caledonia/20/1999_(B_C_D_E_F_G) GIAPLQLGNCSVAGWILGNPECELLISKESWSYIVETPNPENGTCYPGYF ADYEELREQLSSVSSFERFEIFPKESSWPNHTVTGVSASCSHNGKSSFYR NLLWLTGKNGLYPNLSKSYVNNKEKEVLVLWGVHHPPNIGNQRALYHTEN AYVSVVSSHYSRRFTPEIAKRPKVRDQEGRINYYWTLLEPGDTIIFEANG NLIAPWYAFALSRGFGSGIITSNA SEQ ID NO: 3 >B/Sichuan/379/99(B) TRGKLCPTCLNCTDLDVALGRPMCVGITPSAKASILHEIKPVTSGCFPIM HDRTKIRQLPNLLRGYEKIRLSTQNVINAEKAPGGPYRLGTSGSCPNATS KSGFFATMAWAVPRDNNKTAT NPLTVEVPHICTKEEDQITVWGFHSDDKTQMKNLYGDSNPQKFTSSANGI TTHYVSQIGGFPDQTEDGGLPQSGRIVVDYMVQKPGKTGTIVYQRGILLP QKV SEQ ID NO: 4 >A/Panama/2007/1999(_C_D_) STGRICDSPHQILDGENCTLIDALLGDPHCDGFQNKEWDLFVERSKAYSN CYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVAQNGTSSACKRRSNKS FFSRLNWLHQLNYKYPALNVTMPNNEKFDKLYIWGVLHPSTDSDQISLYA QASGRVTVSTKRSQQTVIPNIGSRPWVRGVSSRISIYWTIVKPGDILLIN STGNLIAPRGYFKIRSGKSSIMRS SEQ ID NO: 5 >B/Hong_Kong/330/2001_(_C_D_) KTRGKLCPKCLNCTDLDVALGRPKCTGNIPSAKVSILHEVRPVTSGCFPI MHDRTKIRQLP NLLRGYERIRLSNHNVINAEKAPGGPYKIGTSGSCPNVTNGNGFFATMAW AVPKNENNKTATNSLTIEVPYICTEGEDQITVWGFHSDSETQMAKLYGDS KPQKFTSSANGVTTHYVSQIGGFPNQTEDGGLPQSGRIVVDYMVQKSGKT GTITYQRGILLPQ SEQ ID NO: 6 >A/Wyoming/03/2003_(E_) STGGICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSN CYPYDVPDYASLRSLVASSGTLEFNNESFNWAGVTQNGTSSACKRRSNKS FFSRLNWLTHLKYKYPALNVTMPNNEKFDKLYIWGVHHPVTDSEQISLYA QASGRITVSTKRSQQTVIPNIGYRPRVRDISSRISIYWTIVKPGDILLIN STGNLIAPRGYFKIRSGKSSIMRS SEQ ID NO: 7 >B/Shanghai/361/2002_(_E_F) TDLDVALGRPMCVGTTPSAKASILHEVRPVTSGCFPIMHDRTKIRQLPNL LRGYENIRLSTQNVIDAEKALGGPYRLGTSGSCPNATSKSGFFATMAWAV PKDNNKNATNPLTVEVPYICT EGEDQITVWGFHSDDKTQMKNLYGDSNPQKFTSSANGVTTHYVSQIGGFP DQTEDGGLPQSGRIVVDYMVQKPGKTGTIVYQRGVLLPQKVWCASGRSKV IKG SEQ ID NO: 8 >A/Wisconsin/67/2005_(_G_H) STGGICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSN CYPYDVPDYASLRSLVASSGTLEFNDESFNWTGVTQNGTSSSCKRRSNNS FFSRLNWLTHLKFKYPALN VTMPNNEKFDKLYIWGVHHPVTDNDQIFLYAQASGRITVSTKRSQQTVIP NIGSRPRIRNIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKS SIMRS SEQ ID NO: 9 >B/Malaysia/2506/2004_(_G_H) ETRGKLCPKCLNCTDLDVALGRPKCTGNIPSARVSILHEVRPVSGCFPIM HDRTKIRQLPNLLRGYEHIRLSTHNVINAENAPGGPYKIGTSGSCPNVTN GNGFFATMAWAVPKNDNNK TATNSLTIEVPYICTEGEDQITVWGFHSDNEXQMAKLYGDSKPQKFTSSA NGVTTHYVSQIGGFPNQTEDGGLPQSGRIVVDYMVQKSGKTGTITYQRGI LLPQ SEQ ID NO: 10 >A/Hiroshima/52/2005_(G) STGGICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSN CYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACKRRSNNS FFSRLNWLTQLKFKYPALK VTMPNNEKFDKLYIWGVHHPVTDNDQIFLYAQASGRITVSTKRSQQTVIP NIGSRPRVRNIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKS SIMRS SEQ ID NO: 11 >B/Ohio/1/2005_(G) LDVALGRPKCTGNIPSAEVSILHEVRPVTSGCFPIMHDRTKIRQLPNLLR GYEHIRLSTHNVINAEKAPGGPYKIGTSGSCPNVTNGNGFFATMAWAVPK NDNNKTATNSLTIEVPYICTE GEDQITIWGFHSDSETQMAKLYGDSKPQKFTSSANGVTTHYVSQIGGFPN QTEDGGLPQSGRIVVDYMVQKSGKTGTITYQRGILLPQKVWCASGRSKVI KGS SEQ ID NO: 12 >A/Solomon_Islands/3/2006_(H) GIAPLQLGNCSVAGWILGNPECELLISRESWSYIVEKPNPENGTCYPGHF ADYEELREQLSSVSSFERFEIFPKESSWPNHTTTGVSASCSHNGESSFYK NLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHHPPNIGDQRALYHTEN AYVSVVSSHYSRKFTPEIAKRPKVRDREGRINYYWTLLEPGDTIIFEANG NLIAPRYAFALSRGFGSGIINSNA SEQ ID NO: 13 >A/Brisbane/59/2007_(I_J_) GIAPLQLGNCSVAGWILGNPECELLISKESWSYIVEKPNPENGTCYPGHF ADYEELREQLSSVSSFERFEIFPKESSWPNHTVTGVSASCSHNGESSFYR NLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHHPPNIGNQKALYHTEN AYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTLLEPGDTIIFEANG NLIAPRYAFALSRGFGSGIINSNA SEQ ID NO: 14 >A/Brisbane/10/2007_(_I_J) STGEICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSN CYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACIRRSNNS FFSRLNWLTHLKFKYPALNVTMPNNEKFDKLYIWGVHHPGTDNDQIFLYA QASGRITVSTKRSQQTVIPNIGSRPRVRNIPSRISIYWTIVKPGDILLIN STGNLIAPRGYFKIRSGKSSIMRS SEQ ID NO: 15 >B/Florida/4/2006_(I) RTRGKLCPDCLNCTDLDVALGRPMCVGTTPSAKASILHEVKPVTSGCFPI MIHDRTKIRQLPNLLRGYENIRLSTQNVIDAEKAPGGPYRLGTSGSCPNA TSKSGFFATMAWAVPKDNNKN ATNPLTVEVPYICTEGEDQITVWGFHSDDKTQMKNLYGDSNPQKFTSSAN GVTTHYVSQIGSFPDQTEDGGLPQSGRIVVDYMMQKPGKTGTIVYQRGVL LPQK SEQ ID NO: 16 >B/Brisbane/60/2008_(_J_K_L_M_N_O_P_) ETRGKLCPKCLNCTDLDVALGRPKCTGKIPSARVSILHEVRPVTSGCFPI MHDRTKIRQLPNLLRGYEHIRLSTHNVINAENAPGGPYKIGTSGSCPNIT NGNGFFATMAWAVPKNDKNKT ATNPLTIEVPYICTEGEDQITVWGFHSDNETQMAKLYGDSKPQKFTSSAN GVTTHYVSQIGGFPNQTEDGGLPQSGRIVVDYMVQKSGKTGTITYQRGIL LPQ SEQ ID NO: 17 >A/California/7/2009 GVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDF INYEELREQLSSVSSFERFEIFPKTSSWPNEIDSNKGVTAACPHAGAKSF YKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQN ADAYVFVGTSKYSKKFKPEIAVRPKVRDQEGRMNYYWTLVEPGDKITFEA TGNLLVPRYAFAMERNAGSGIIISD SEQ ID NO: 18 >A/Perth/16/2009_(_K_L) STGEICDSPHQILDGKNCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSN CYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACIRRSKNS FFSRLNWLTHLNFKYPALNVTMPNNEQFDKLYIWGVLHPGTDKDQIFLYA QASGRITVSTKRSQQTVSPNIGSRPRVRNIPSRISIYWTIVKPGDILLIN STGNLIAPRGYFKIRSGKSSIMRS SEQ ID NO: 19 >A/Victoria/361/2011(M_N_O_) SIGEICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSN CYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACIRRSNNS FFSRLNWLTHLNFKYPALNVTMPNNEQFDKLYIWGVHHPGTDKDQIFLYA QSSGRITVSTKRSQQAVIPNIGSRPRIRNIPSRISIYWTIVKPGDILLIN STGNLIAPRGYFKIRSGKSSIMRS SEQ ID NO: 20 >B/Massachusetts/02/2012_(_N_O_) KTRGKLCPDCLNCTDLDVALGRPMCVGTTPSAKASILHEVRPVTSGCFPI MHDRTKIRQLANLLRGYENIRLSTQNVIDAEKAPGGPYRLGTSGSCPNAT SKSGFFATMAWAVPKDNNKNATNPLTVEVPYICAEGEDQITVWGFHSDDK TQMKNLYGDSNPQKFTSSANGVTTHYVSQIGGFPDQTEDGGLPQSGRIVV DYMMQKPGKTGTIVYQRGVLLPQK SEQ ID NO: 21 >HIS-tag HHHHHH SEQ ID NO: 22 >Signal peptide MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDV AVLPFSNSTNNGLLFINTTIASIAAKEEGVSLE