COMPOSITIONS AND METHODS FOR TREATING AND/OR PREVENTING GLYCOGEN STORAGE DISEASE TYPE III
20220202916 · 2022-06-30
Inventors
- Baodong Sun (Durham, NC)
- Priya S. Kishnani (Durham, NC)
- Jeong-A Lim (Durham, NC, US)
- Aravind Asokan (Durham, NC, US)
Cpc classification
A61K31/436
HUMAN NECESSITIES
A61K31/519
HUMAN NECESSITIES
A61K48/0058
HUMAN NECESSITIES
C12N2750/14143
CHEMISTRY; METALLURGY
A61K38/47
HUMAN NECESSITIES
A61K48/005
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
C12N2830/008
CHEMISTRY; METALLURGY
A61K38/39
HUMAN NECESSITIES
A61K48/0066
HUMAN NECESSITIES
International classification
A61K38/47
HUMAN NECESSITIES
A61K31/436
HUMAN NECESSITIES
A61K31/519
HUMAN NECESSITIES
A61K38/39
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
Abstract
Adult form glycogen storage disease type III (GSD III) is an orphan neuromuscular disorder caused by a deficiency of glycogen debranching enzyme. Long-term complications include progressive liver fibrosis, hepatic failure, and end-stage liver cirrhosis, and progressive muscle myopathy. Presently, there are no clinically approved therapies or cures for GSD III. Disclosed herein are compositions for and methods of treating and/or preventing GSD III disease progression.
Claims
1. An isolated nucleic acid molecule, comprising: a nucleic acid sequence encoding a microbial polypeptide capable of preventing glycogen accumulation and/or degrading accumulated glycogen, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell.
2. The isolated nucleic acid molecule of claim 1, wherein the encoded microbial polypeptide comprises a type I Pullulanase from Bacillus subtilis.
3. The isolated nucleic acid molecule of claim 1, wherein the nucleic acid sequence encoding a microbial polypeptide comprises the sequence set forth in SEQ ID NO:04 or a sequence having at least 50-69%, at least 70-89%, or at least 90-99% identity to the sequence set forth in SEQ ID NO:04.
4. An AAV vector comprising the isolated nucleic acid molecule of claim 1.
5. The vector of claim 4, wherein the AAV vector is an AAV9 vector.
6. The vector of claim 4, wherein the vector comprises a tissue-specific promoter operably linked to the isolated nucleic acid molecule.
7. The vector of claim 6, wherein the tissue-specific promoter is a liver-specific promoter.
8. The vector of claim 4, wherein the vector comprises an immunotolerant dual promoter operably linked to the isolated nucleic acid molecule.
9. The vector of claim 8, wherein the immunotolerant dual promoter comprises (i) a liver-specific promoter and a ubiquitous promoter or (ii) a liver-specific promoter and a muscle-specific promoter.
10. The vector of claim 8, wherein the immunotolerant dual promoter comprises the sequence set forth in SEQ ID NO:05 or a sequence having at least 50-69%, at least 70-89%, or at least 90-99% identity to the sequence set forth in SEQ ID NO:05.
11. A method of treating and/or preventing GSD III disease progression, the method comprising: administering to a subject in need thereof a therapeutically effective amount of the AAV vector of claim 4, wherein glycogen accumulation is prevented and/or accumulated glycogen is degraded in the subject.
12. The method of claim 11, wherein the vector is administered via intravenous, intraarterial, intramuscular, intraperitoneal, subcutaneous, intrathecal, intraventricular, or in utero administration.
13. The method of claim 11, wherein the subject is a human subject.
14. The method of claim 11, further comprising administering to the subject a therapeutically effective amount of an agent for reducing the expression level and/or activity level of glycogen synthase.
15. The method of claim 14, wherein the glycogen synthase comprises GSY1 and/or GSY2.
16. The method of claim 11, further comprising repeating the administering of the vector.
17. The method of claim 11, further comprising administering to the subject a therapeutically effective amount of one or more immune modulators.
18. The method of claim 17, wherein the one or more immune modulators comprise methotrexate, rituximab, intravenous gamma globulin, SVP-Rapamycin, bortezomib, or a combination thereof.
19. The method of claim 17, further comprising repeating the administering of the one or more immune modulators.
20. The method of claim 11, further comprising monitoring the subject for adverse effects.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0007]
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
BRIEF SUMMARY
[0021] Disclosed herein is an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell.
[0022] Disclosed herein is a vector comprising an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide and/or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell.
[0023] Disclosed herein is a vector comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, and wherein a liver-specific promoter is operably linked to the nucleic acid sequence.
[0024] Disclosed herein is a vector comprising a gene expression cassette comprising an isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide for preventing glycogen accumulation and/or degrading accumulated glycogen under the control of a dual promoter comprising a liver-specific promoter and a ubiquitous promoter.
[0025] Disclosed herein is a vector comprising a gene expression cassette comprising an isolated nucleic acid molecule, wherein the isolated nucleic acid sequence encodes either a microbial polypeptide or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, wherein the isolated nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, and wherein expression of the polypeptide is under the control of an immunotolerant dual promoter.
[0026] Disclosed herein is an AAV vector comprising an isolated nucleic acid molecule, wherein the isolated nucleic acid sequence encodes either a microbial polypeptide or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, and wherein the isolated nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell.
[0027] Disclosed herein is a pharmaceutical formulation comprising a vector comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, in a pharmaceutically acceptable carrier.
[0028] Disclosed herein is a method of treating and/or preventing GSD III disease progression comprising administering to a subject in need thereof a therapeutically effective amount of a vector comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, and preventing glycogen accumulation and/or degrading accumulated glycogen in the subject.
[0029] Disclosed herein is a method of and/or preventing GSD III comprising preventing glycogen accumulation and/or degrading accumulated glycogen in a subject in need thereof by administering to the subject a therapeutically effective amount of a vector comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell.
[0030] Disclosed herein is a method of and/or preventing GSD III comprising administering to a subject in need thereof a therapeutically effective amount of a vector comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, wherein glycogen accumulation is prevented and/or accumulated glycogen is degraded in the subject.
[0031] Disclosed herein is a method of preventing glycogen accumulation and/or degrading accumulated glycogen comprising administering to a subject having GSD III a therapeutically effective amount of a vector comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell.
[0032] Disclosed herein is a method of treating GSD III comprise administering to a subject in need thereof an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, and preventing glycogen accumulation and/or degrading accumulated a glycogen in the subject.
[0033] Disclosed herein is a method of treating and/or preventing GSD III disease progression comprising preventing glycogen accumulation and/or degrading accumulated glycogen in a subject in need thereof by administering to the subject an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell.
[0034] Disclosed herein is a method of treating and/or preventing GSD III disease progression comprising administering to a subject in need thereof an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, wherein glycogen accumulation is prevented and/or accumulated glycogen is degraded in the subject.
[0035] Disclosed herein is a method of preventing glycogen accumulation and/or degrading accumulated glycogen comprising administering to a subject having GSD III an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell.
DETAILED DESCRIPTION
[0036] The present disclosure describes formulations, compounded compositions, kits, capsules, containers, and/or methods thereof. It is to be understood that the inventive aspects of which are not limited to specific synthetic methods unless otherwise specified, or to particular reagents unless otherwise specified, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular aspects only and is not intended to be limiting. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, example methods and materials are now described.
[0037] All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention.
I. Definitions
[0038] Before the present compounds, compositions, articles, systems, devices, and/or methods are disclosed and described, it is to be understood that they are not limited to specific synthetic methods unless otherwise specified, or to particular reagents unless otherwise specified, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular aspects only and is not intended to be limiting. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, example methods and materials are now described.
[0039] This disclosure describes inventive concepts with reference to specific examples. However, the intent is to cover all modifications, equivalents, and alternatives of the inventive concepts that are consistent with this disclosure.
[0040] As used in the specification and the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise.
[0041] The phrase “consisting essentially of” limits the scope of a claim to the recited components in a composition or the recited steps in a method as well as those that do not materially affect the basic and novel characteristic or characteristics of the claimed composition or claimed method. The phrase “consisting of” excludes any component, step, or element that is not recited in the claim. The phrase “comprising” is synonymous with “including”, “containing”, or “characterized by”, and is inclusive or open-ended. “Comprising” does not exclude additional, unrecited components or steps.
[0042] As used herein, when referring to any numerical value, the term “about” means a value falling within a range that is±10% of the stated value.
[0043] Ranges can be expressed herein as from “about” one particular value, and/or to “about” another particular value. When such a range is expressed, a further aspect includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent “about,” it will be understood that the particular value forms a further aspect. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint and independently of the other endpoint. It is also understood that there are a number of values disclosed herein, and that each value is also herein disclosed as “about” that particular value in addition to the value itself. For example, if the value “10” is disclosed, then “about 10” is also disclosed. It is also understood that each unit between two particular units are also disclosed. For example, if 10 and 15 are disclosed, then 11, 12, 13, and 14 are also disclosed.
[0044] References in the specification and concluding claims to parts by weight of a particular element or component in a composition denotes the weight relationship between the element or component and any other elements or components in the composition or article for which a part by weight is expressed. Thus, in a compound containing 2 parts by weight component X and 5 parts by weight component Y, X and Y are present at a weight ratio of 2:5, and are present in such ratio regardless of whether additional components are contained in the compound.
[0045] As used herein, the terms “optional” or “optionally” means that the subsequently described event or circumstance can or cannot occur, and that the description includes instances where said event or circumstance occurs and instances where it does not. In an aspect, a disclosed method can optionally comprise one or more additional steps, such as, for example, repeating an administering step (e.g., the vector administering step or the immune modulator administering step) or altering an administering step.
[0046] As used herein, the term “subject” refers to the target of administration, e.g., a human being. The term “subject” also includes domesticated animals (e.g., cats, dogs, etc.), livestock (e.g., cattle, horses, pigs, sheep, goats, etc.), and laboratory animals (e.g., mouse, rabbit, rat, guinea pig, fruit fly, etc.). Thus, the subject of the herein disclosed methods can be a vertebrate, such as a mammal, a fish, a bird, a reptile, or an amphibian. Alternatively, the subject of the herein disclosed methods can be a human, non-human primate, horse, pig, rabbit, dog, sheep, goat, cow, cat, guinea pig, or rodent. The term does not denote a particular age or sex, and thus, adult and child subjects, as well as fetuses, whether male or female, are intended to be covered. In an aspect, a subject can be a human patient. In an aspect, a subject can have a glycogen storage disease, be suspected of having a glycogen storage disease, or be at risk of developing a glycogen storage disease. In an aspect, a glycogen storage disease can be GSD III. In an aspect, GSD III can be GSD IIIa or GSD IIIb.
[0047] As used herein, the term “diagnosed” means having been subjected to an examination by a person of skill, for example, a physician, and found to have a condition that can be diagnosed or treated by one or more of the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations, or a combination thereof, or by one or more of the disclosed methods. For example, “diagnosed with a glycogen storage disease” means having been subjected to an examination by a person of skill, for example, a physician, and found to have a condition that can be treated by one or more of the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations, or a combination thereof, or by one or more of the disclosed methods. For example, “suspected of having a glycogen storage disease” can mean having been subjected to an examination by a person of skill, for example, a physician, and found to have a condition that can likely be treated by one or more of by one or more of the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations, or a combination thereof, or by one or more of the disclosed methods. In an aspect, an examination can be physical, can involve various tests (e.g., blood tests, genotyping, biopsies, etc.) and assays (e.g., enzymatic assay), or a combination thereof.
[0048] A “patient” refers to a subject afflicted with a glycogen storage disease. In an aspect, a patient can refer to a subject that has been diagnosed with or is suspected of having a glycogen storage disease. In an aspect, a patient can refer to a subject that has been diagnosed with or is suspected of having a glycogen storage disease (GSD) and is seeking treatment or receiving treatment for a GSD (such as, for example, GSD IIIa or GSD IIIb).
[0049] As used herein, the phrase “identified to be in need of treatment for a disorder,” or the like, refers to selection of a subject based upon need for treatment of the disorder. For example, a subject can be identified as having a need for treatment of a disorder (e.g., GSD III) based upon an earlier diagnosis by a person of skill and thereafter subjected to treatment for the disorder (e.g., GSD III). In an aspect, the identification can be performed by a person different from the person making the diagnosis. In an aspect, the administration can be performed by one who performed the diagnosis.
[0050] As used herein, “inhibit,” “inhibiting”, and “inhibition” mean to diminish or decrease an activity, level, response, condition, severity, disease, or other biological parameter. This can include, but is not limited to, the complete ablation of the activity, level, response, condition, severity, disease, or other biological parameter. This can also include, for example, a 10% inhibition or reduction in the activity, level, response, condition, severity, disease, or other biological parameter as compared to the native or control level (e.g., a subject not having a GSD such as GSD III). Thus, in an aspect, the inhibition or reduction can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or any amount of reduction in between as compared to native or control levels. In an aspect, the inhibition or reduction can be 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, 80-90%, or 90-100% as compared to native or control levels. In an aspect, the inhibition or reduction can be 0-25%, 25-50%, 50-75%, or 75-100% as compared to native or control levels.
[0051] The words “treat” or “treating” or “treatment” include palliative treatment, that is, treatment designed for the relief of symptoms rather than the curing of the disease, pathological condition, or disorder; preventative treatment, that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder; and supportive treatment, that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, pathological condition, or disorder. In an aspect, the terms cover any treatment of a subject, including a mammal (e.g., a human), and includes: (i) preventing the undesired physiological change, disease, pathological condition, or disorder from occurring in a subject that can be predisposed to the disease but has not yet been diagnosed as having it; (ii) inhibiting the physiological change, disease, pathological condition, or disorder, i.e., arresting its development; or (iii) relieving the physiological change, disease, pathological condition, or disorder, i.e., causing regression of the disease. For example, in an aspect, treating a GSD (such as GSD III) can reduce the severity of an established GSD in a subject by 1%-100% as compared to a control (such as, for example, an individual not having a glycogen storage disease). In an aspect, treating can refer to a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% reduction in the severity of a GSD. For example, treating a GSD can reduce one or more symptoms of a GSD in a subject by 1%-100% as compared to a control (such as, for example, an individual not having a glycogen storage disease). In an aspect, treating can refer to 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100% reduction of one or more symptoms of an established GSD. It is understood that treatment does not necessarily refer to a cure or complete ablation or eradication of a GSD. However, in an aspect, treatment can refer to a cure or complete ablation or eradication of a GSD.
[0052] As used herein, the term “prevent” or “preventing” or “prevention” refers to precluding, averting, obviating, forestalling, stopping, or hindering something from happening, especially by advance action. It is understood that where reduce, inhibit, or prevent are used herein, unless specifically indicated otherwise, the use of the other two words is also expressly disclosed. In an aspect, preventing a GSD is intended. The words “prevent” and “preventing” and “prevention” also refer to prophylactic or preventative measures for protecting or precluding a subject (e.g., an individual) not having a given GSD or GSD-related complication from progressing to that complication.
[0053] As used herein, the terms “administering” and “administration” refer to any method of providing one or more of the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations, or a combination thereof to a subject. Such methods are well known to those skilled in the art and include, but are not limited to, the following: oral administration, transdermal administration, administration by inhalation, nasal administration, topical administration, intravaginal administration, in utero administration, ophthalmic administration, intraaural administration, otic administration, intracerebral administration, rectal administration, sublingual administration, buccal administration, and parenteral administration, including injectable such as intravenous administration, intrathecal administration, intra-arterial administration, intramuscular administration, and subcutaneous administration. Administration can be continuous or intermittent.
[0054] In an aspect, the skilled person can determine an efficacious dose, an efficacious schedule, and an efficacious route of administration for one or more of the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations, or a combination thereof so as to treat or prevent an GSD (such as GSD III). In an aspect, the skilled person can also alter, change, or modify an aspect of an administering step to improve efficacy of one or more of the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations, or a combination thereof.
[0055] As used herein, “modifying the method” can comprise modifying or changing one or more features or aspects of one or more steps of a disclosed method. For example, in an aspect, a method can be altered by changing the amount of one or more of the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations, or a combination thereof administered to a subject, or by changing the frequency of administration of one or more of the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations, or a combination thereof to a subject, or by changing the duration of time one or more of the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations, or a combination are administered to a subject.
[0056] As used herein, “concurrently” means (1) simultaneously in time, or (2) at different times during the course of a common treatment schedule.
[0057] The term “contacting” as used herein refers to bringing one or more of the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations, or a combination thereof together with a target area or intended target area in such a manner that the one or more of the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations, or a combination thereof exert an effect on the intended target or targeted area either directly or indirectly. A target area or intended target area can be one or more of a subject's organs (e.g., lungs, heart, liver, kidney, brain, etc.). In an aspect, a target area or intended target area can be any cell or any organ infected by a GSD (such as GSD III). In an aspect, a target area or intended target area can be the liver.
[0058] As used herein, “determining” can refer to measuring or ascertaining the presence and severity of a glycogen storage disease, such as, for example, GSD III. Methods and techniques used to determine the presence and/or severity of a GSD are typically known to the medical arts. For example, the art is familiar with the ways to identify and/or diagnose the presence, severity, or both of a GSD.
[0059] As used herein, “effective amount” and “amount effective” can refer to an amount that is sufficient to achieve the desired result such as, for example, the treatment and/or prevention of a glycogen storage disease (e.g., GSD III) or a suspected a glycogen storage disease (e.g., a GSD IX). As used herein, the terms “effective amount” and “amount effective” can refer to an amount that is sufficient to achieve the desired an effect on an undesired condition (e.g., a GSD). For example, a “therapeutically effective amount” refers to an amount that is sufficient to achieve the desired therapeutic result or to have an effect on undesired symptoms, but is generally insufficient to cause adverse side effects. In an aspect, “therapeutically effective amount” means an amount of a disclosed composition that (i) treats the particular disease, condition, or disorder (e.g., a GSD), (ii) attenuates, ameliorates, or eliminates one or more symptoms of the particular disease, condition, or disorder e.g., a glycogen storage disease), or (iii) delays the onset of one or more symptoms of the particular disease, condition, or disorder described herein (e.g., a GSD). The specific therapeutically effective dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; the disclosed isolated nucleic acid molecules, disclosed vectors, disclosed pharmaceutical formulations employed; the disclosed methods employed; the age, body weight, general health, sex and diet of the patient; the time of administration; the route of administration; the rate of excretion of the disclosed isolated nucleic acid molecules, disclosed vectors, or disclosed pharmaceutical formulations employed; the duration of the treatment; drugs used in combination or coincidental with the disclosed isolated nucleic acid molecules, disclosed vectors, or disclosed pharmaceutical formulations employed, and other like factors well known in the medical arts. For example, it is well within the skill of the art to start doses of the disclosed isolated nucleic acid molecules, disclosed vectors, or disclosed pharmaceutical formulations at levels lower than those required to achieve the desired therapeutic effect and to gradually increase the dosage until the desired effect is achieved. If desired, then the effective daily dose can be divided into multiple doses for purposes of administration. Consequently, a single dose of the disclosed isolated nucleic acid molecules, disclosed vectors, or disclosed pharmaceutical formulations can contain such amounts or submultiples thereof to make up the daily dose. The dosage can be adjusted by the individual physician in the event of any contraindications. Dosage can vary, and can be administered in one or more dose administrations daily, for one or several days. Guidance can be found in the literature for appropriate dosages for given classes of pharmaceutical products. In an aspect, a preparation can be administered in a “prophylactically effective amount”; that is, an amount effective for prevention of a disease or condition, such as, for example, a glycogen storage disease (e.g., GSD III). In an aspect, an effective amount of a disclosed isolated nucleic acid molecules, disclosed vectors, or disclosed pharmaceutical formulations can be administered to prevent an immune response.
[0060] As used herein, the term “pharmaceutically acceptable carrier” refers to sterile aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use. Examples of suitable aqueous and nonaqueous carriers, diluents, solvents, or vehicles include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol and the like), carboxymethylcellulose and suitable mixtures thereof, vegetable oils (such as olive oil) and injectable organic esters such as ethyl oleate. In an aspect, a pharmaceutical carrier employed can be a solid, liquid, or gas. In an aspect, examples of solid carriers can include lactose, terra alba, sucrose, talc, gelatin, agar, pectin, acacia, magnesium stearate, and stearic acid. In an aspect, examples of liquid carriers can include sugar syrup, peanut oil, olive oil, and water. In an aspect, examples of gaseous carriers can include carbon dioxide and nitrogen. In preparing a disclosed composition for oral dosage form, any convenient pharmaceutical media can be employed. For example, water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents and the like can be used to form oral liquid preparations such as suspensions, elixirs and solutions; while carriers such as starches, sugars, microcrystalline cellulose, diluents, granulating agents, lubricants, binders, disintegrating agents, and the like can be used to form oral solid preparations such as powders, capsules and tablets. Because of their ease of administration, tablets and capsules are the preferred oral dosage units whereby solid pharmaceutical carriers are employed. Optionally, tablets can be coated by standard aqueous or nonaqueous techniques. Proper fluidity can be maintained, for example, by the use of coating materials such as lecithin, by the maintenance of the required particle size in the case of dispersions and by the use of surfactants. These compositions can also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms can be ensured by the inclusion of various antibacterial and antifungal agents such as paraben, chlorobutanol, phenol, sorbic acid and the like. It can also be desirable to include isotonic agents such as sugars, sodium chloride and the like. Prolonged absorption of the injectable pharmaceutical form can be brought about by the inclusion of agents, such as aluminum monostearate and gelatin, which delay absorption. Injectable depot forms are made by forming microencapsule matrices of the drug in biodegradable polymers such as polylactide-polyglycolide, poly(orthoesters) and poly(anhydrides). Depending upon the ratio of drug to polymer and the nature of the particular polymer employed, the rate of drug release can be controlled. Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions that are compatible with body tissues. The injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable media just prior to use. Suitable inert carriers can include sugars such as lactose. Desirably, at least 95% by weight of the particles of the active ingredient have an effective particle size in the range of 0.01 to 10 micrometers.
[0061] As used herein, the term “excipient” refers to an inert substance which is commonly used as a diluent, vehicle, preservative, binder, or stabilizing agent, and includes, but is not limited to, proteins (e.g., serum albumin, etc.), amino acids (e.g., aspartic acid, glutamic acid, lysine, arginine, glycine, histidine, etc.), fatty acids and phospholipids (e.g., alkyl sulfonates, caprylate, etc.), surfactants (e.g., SDS, polysorbate, nonionic surfactant, etc.), saccharides (e.g., sucrose, maltose, trehalose, etc.) and polyols (e.g., mannitol, sorbitol, etc.). See, also, for reference, Remington's Pharmaceutical Sciences, (1990) Mack Publishing Co., Easton, Pa., which is hereby incorporated by reference in its entirety.
[0062] In an aspect, “CpG-free” can mean completely free of CpGs or partially free of CpGs. In an aspect, CpG-free can mean CpG-depleted. In an aspect, CpG-depleted can mean completely depleted of CpGs or partially depleted of CpGs. In an aspect, CpG-free can mean CpG-optimized.
[0063] As used herein, “RNA therapeutics” can refer to the use of oligonucleotides to target RNA. RNA therapeutics can offer the promise of uniquely targeting the precise nucleic acids involved in a particular disease with greater specificity, improved potency, and decreased toxicity. This could be particularly powerful for genetic diseases where it is most advantageous to aim for the RNA as opposed to the protein. RNA therapeutics can comprise antisense oligonucleotides (ASOs) that inhibit mRNA translation, oligonucleotides that function via RNA interference (RNAi) pathway, RNA molecules that behave like enzymes (ribozymes), RNA oligonucleotides that bind to proteins and other cellular molecules, and ASOs that bind to mRNA and form a structure that is recognized by RNase H resulting in cleavage of the mRNA target. In an aspect, RNA therapeutics can comprise RNAi and ASOs that inhibit mRNA translation of liver or muscle glycogen synthase.
[0064] As used herein, “promoter” or “promoters” are known to the art. Depending on the level and tissue-specific expression desired, a variety of promoter elements can be used. A promoter can be tissue-specific or ubiquitous and can be constitutive or inducible, depending on the pattern of the gene expression desired. A promoter can be native or foreign and can be a natural or a synthetic sequence. By foreign, it is intended that the transcriptional initiation region is not found in the wild-type host into which the transcriptional initiation region is introduced.
[0065] “Tissue-specific promoters” are known to the art and include, but are not limited to, neuron-specific promoters, muscle-specific promoters, liver-specific promoters, skeletal muscle-specific promoters, and heart-specific promoters.
[0066] “Neuron-specific promoters” are known to the art and include, but are not limited to, the synapsin I (SYN) promoter, the calcium/calmodulin-dependent protein kinase II promoter, the tubulin alpha I promoter, the neuron-specific enolase promoter, and the platelet-derived growth factor beta chain promoter.
[0067] “Liver-specific promoters” are known to the art and include, but are not limited to, the α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter, the human albumin (hALB) promoter, the thyroid hormone-binding globulin promoter, the thyroxin binding globulin promoter, the α-1-anti-trypsin promoter, the bovine albumin (bAlb) promoter, the murine albumin (mAlb) promoter, the human α1-antitrypsin (hAAT) promoter, the ApoEhAAT promoter composed of the ApoE enhancer and the hAAT promoter, the transthyretin (TTR) promoter, the liver fatty acid binding protein promoter, the hepatitis B virus (HBV) promoter, the DC172 promoter consisting of the hAAT promoter and the al-microglobulin enhancer, the DC190 promoter containing the human albumin promoter and the prothrombin enhancer, and other natural and synthetic liver-specific promoters.
[0068] In an aspect, a liver specific promoter can comprise about 845-bp and comprise the thyroid hormone-binding globulin promoter sequences (2382 to 13), two copies of α1-microglobulinybikunin enhancer sequences (22,804 through 22,704), and a 71-bp leader sequence as described by Ill C R, et al. (1997). In an aspect, a disclosed liver-specific promoter can comprise the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%-60%, at least 60%-80%, at least 80%-90%, or at least 90%-100% identity to the sequence set forth in SEQ ID NO:15.
[0069] “Muscle-specific promoters” are known to the art and include, but are not limited to, the MHCK7 promoter, the muscle creatine kinase (MCK) promoter/enhancer, the slow isoform of troponin I (TnIS) promoter, the MYODI promoter, the MYLK2 promoter, the SPc5-12 promoter, the desmin (Des) promoter, the unc45b promoter, and other natural and synthetic muscle-specific promoters.
[0070] “Skeletal muscle-specific promoters” are known to the art and include, but are not limited to, the HSA promoter, the human α-skeletal actin promoter.
[0071] “Heart-specific promoters” are known to the art and include, but art not limited to, the MYH6 promoter, the TNNI3 promoter, the cardiac troponin C (cTnC) promoter, the alpha-myosin heavy chain (α-MHC) promoter, myosin light chain 2 (MLC-2), and the MYBPC3 promoter.
[0072] As used herein, a “ubiquitous/constitutive promoter” refer to a promoter that allows for continual transcription of its associated gene. A ubiquitous/constitutive promoter is always active and can be used to express genes in a wide range of cells and tissues, including, but not limited to, the liver, kidney, skeletal muscle, cardiac muscle, smooth muscle, diaphragm muscle, brain, spinal cord, endothelial cells, intestinal cells, pulmonary cells (e.g., smooth muscle or epithelium), peritoneal epithelial cells, and fibroblasts. Ubiquitous/constitutive promoters include, but are not limited to, a CMV major immediate-early enhancer/chicken beta-actin promoter, a cytomegalovirus (CMV) major immediate-early promoter, an Elongation Factor 1-α (EF1-α) promoter, a simian vacuolating virus 40 (SV40) promoter, an AmpR promoter, a PγK promoter, a human ubiquitin C gene (Ubc) promoter, a MFG promoter, a human beta actin promoter, a CAG promoter, a EGR1 promoter, a FerH promoter, a FerL promoter, a GRP78 promoter, a GRP94 promoter, a HSP70 promoter, a β-kin promoter, a murine phosphoglycerate kinase (mPGK) or human PGK (hPGK) promoter, a ROSA promoter, human Ubiquitin B promoter, a Rous sarcoma virus promoter, or any other natural or synthetic ubiquitous/constitutive promoters.
[0073] As used herein, an “inducible promoter” refers to a promoter that can be regulated by positive or negative control. Factors that can regulate an inducible promoter include, but are not limited to, chemical agents (e.g., the metallothionein promoter or a hormone inducible promoter), temperature, and light.
[0074] As used herein, the term “serotype” is a distinction used to refer to an AAV having a capsid that is serologically distinct from other AAV serotypes. Serologic distinctiveness can be determined on the basis of the lack of cross-reactivity between antibodies to one AAV as compared to another AAV. Such cross-reactivity differences are usually due to differences in capsid protein sequences/antigenic determinants (e.g., due to VP1, VP2, and/or VP3 sequence differences of AAV serotypes).
[0075] As used herein, “tropism” refers to the specificity of an AAV capsid protein present in an AAV viral particle, for infecting a particular type of cell or tissue. The tropism of an AAV capsid for a particular type of cell or tissue may be determined by measuring the ability of AAV vector particles comprising the hybrid AAV capsid protein to infect or to transduce a particular type of cell or tissue, using standard assays that are well-known in the art such as those disclosed in the examples of the present application. As used herein, the term “liver tropism” or “hepatic tropism” refers to the tropism for liver or hepatic tissue and cells, including hepatocytes.
[0076] “Sequence identity” and “sequence similarity” can be determined by alignment of two peptide or two nucleotide sequences using global or local alignment algorithms. Sequences may then be referred to as “substantially identical” or “essentially similar” when they are optimally aligned. For example, sequence similarity or identity can be determined by searching against databases such as FASTA, BLAST, etc., but hits should be retrieved and aligned pairwise to compare sequence identity. Two proteins or two protein domains, or two nucleic acid sequences can have “substantial sequence identity” if the percentage sequence identity is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or more, preferably 90%, 95%, 98%, 99% or more. Such sequences are also referred to as “variants” herein, e.g., other variants of microbial and human glycogen debranching enzymes. It should be understood that sequence with substantial sequence identity do not necessarily have the same length and may differ in length. For example, sequences that have the same nucleotide sequence but of which one has additional nucleotides on the 3′-and/or 5′-side are 100% identical.
[0077] As used herein, “codon optimization” can refer to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing one or more codons or more of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence. Various species exhibit particular bias for certain codons of a particular amino acid. As contemplated herein, genes can be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the “Codon Usage Database.” Many methods and software tools for codon optimization have been reported previously. (See, for example, genomes.urv.es/OPTIMIZER/).
[0078] As used herein, “immune tolerance,” “immunological tolerance,” and “immunotolerance” refers to a state of unresponsiveness or blunted response of the immune system to substances (e.g., a disclosed isolated nucleic acid molecule, a disclosed vector, a disclosed transgene product, a disclosed pharmaceutical formulation, a disclosed therapeutic agent, etc.) that have the capacity to elicit an immune response in a subject. Immune tolerance is induced by prior exposure to a specific antigen. Immune tolerance can be determined in a subject by measuring antibodies against a particular antigen or by liver-restricted transgene expression with an AAV vector. Low or absent antibody titers over time is an indicator of immune tolerance. For example, in some embodiments, immune tolerance can be established by having IgG antibody titers of less than or equal to about 12,000, 11,500, 11,000, 10,500, 10,000, 9,500, 9,000, 8,500, 8,000, 7,500, 7,000, 6,500, or 6,000 within following gene therapy (such as, for example, the administration of the transgene encoding a truncated human glycogen debranching enzyme or a microbial Pullulanase).
[0079] As used herein, “immune-modulating” refers to the ability of a disclosed isolated nucleic acid molecules, a disclosed vector, a disclosed pharmaceutical formulation, or a disclosed agent to alter (modulate) one or more aspects of the immune system. The immune system functions to protect the organism from infection and from foreign antigens by cellular and humoral mechanisms involving lymphocytes, macrophages, and other antigen-presenting cells that regulate each other by means of multiple cell-cell interactions and by elaborating soluble factors, including lymphokines and antibodies, that have autocrine, paracrine, and endocrine effects on immune cells.
[0080] As known to the art, antibodies (Abs) can mitigate AAV infection through multiple mechanisms by binding to AAV capsids and blocking critical steps in transduction such as cell surface attachment and uptake, endosomal escape, productive trafficking to the nucleus, or uncoating as well as promoting AAV opsonization by phagocytic cells, thereby mediating their rapid clearance from the circulation. For example, in humans, serological studies reveal a high prevalence of NAbs in the worldwide population, with about 67% of people having antibodies against AAV1, 72% against AAV2, and approximately 40% against AAV serotypes 5 through 9. Vector immunogenicity represents a major challenge in re-administration of AAV vectors.
[0081] As used herein, “immune modulator” refers to an agent that is capable of adjusting a given immune response to a desired level, as in immunopotentiation, immunosuppression, or induction of immunologic tolerance. Examples of immune modulators include but are not limited to, betamethasone dipropionate, betamethasone valerate, fluocinolone acetonide, triamcinolone acetonide, prednisone, methylprednisolone, prednisolone indomethacin, sulindac, ibuprofen, aspirin, naproxen, tolmetin, azathioprine, cyclosporine, cyclophosphamide, deoxyspergualin, bredinin, didemnin B, methotrexate, rituximab (anti-CD20 monoclonal antibody), intravenous gamma globulin (IVIG), synthetic vaccine particles containing rapamycin (SVP-Rapamycin or ImmTOR) bortezomib, thalidomide, and sirolimus. In an aspect, a disclosed immune modulator can be bortezomib or SVP-Rapamycin. In an aspect, an immune modulator can be administered by any suitable route of administration including, but not limited to, intravenously, subcutaneously, transdermally, intradermally, intramuscularly, orally, transcutaneously, intraperitoneally (IP), or intravaginally.
[0082] As used herein, the term “immunotolerant” refers to unresponsiveness to an antigen (e.g., a vector, a therapeutic protein, a bacterial glycogen debranching enzyme, etc.). An immunotolerant promoter can reduce, ameliorate, or prevent transgene-induced immune responses that can be associated with gene therapy. Assays known in the art to measure immune responses, such as immunohistochemical detection of cytotoxic T cell responses, can be used to determine whether one or more promoters can confer immunotolerant properties.
[0083] As used herein, the term “package insert” is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, contraindications and/or warnings concerning the use of such therapeutic products.
[0084] As used herein, the term “in combination” in the context of the administration of other therapies (e.g., other agents) includes the use of more than one therapy (e.g., drug therapy). Administration “in combination with” one or more further therapeutic agents includes simultaneous (e.g., concurrent) and consecutive administration in any order. The use of the term “in combination” does not restrict the order in which therapies are administered to a subject. By way of non-limiting example, a first therapy (e.g., a disclosed isolated nucleic acid molecule, a disclosed vector, a disclosed pharmaceutical formulation, or a combination thereof) may be administered before (e.g., 1 minute, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, or 12 weeks), concurrently, or after (e.g., 1 minute, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, or 12 weeks or longer) the administration of a second therapy (e.g., agent) to a subject having or diagnosed with a GSD.
[0085] Disclosed are the components to be used to prepare the disclosed isolated nucleic acid molecules, disclosed vectors, or disclosed pharmaceutical formulations as well as the disclosed isolated nucleic acid molecules, disclosed vectors, or disclosed pharmaceutical formulations used within the methods disclosed herein. These and other materials are disclosed herein, and it is understood that when combinations, subsets, interactions, groups, etc. of these materials are disclosed that while specific reference of each various individual and collective combinations and permutation of these compounds cannot be explicitly disclosed, each is specifically contemplated and described herein. For example, if a particular compound is disclosed and discussed and a number of modifications that can be made to a number of molecules including the compounds are discussed, specifically contemplated is each and every combination and permutation of the compound and the modifications that are possible unless specifically indicated to the contrary. Thus, if a class of molecules A, B, and C are disclosed as well as a class of molecules D, E, and F and an example of a combination molecule, A-D is disclosed, then even if each is not individually recited each is individually and collectively contemplated meaning combinations, A-E, A-F, B-D, B-E, B-F, C-D, C-E, and C-F are considered disclosed. Likewise, any subset or combination of these is also disclosed. Thus, for example, the sub-group of A-E, B-F, and C-E would be considered disclosed. This concept applies to all aspects of this application including, but not limited to, steps in methods of making and using the compositions of the invention. Thus, if there are a variety of additional steps that can be performed it is understood that each of these additional steps can be performed with any specific embodiment or combination of embodiments of the methods of the invention.
II. Compositions for Treating and/or Preventing GSD III Disease Progression
(a) Nucleic Acid Molecules
[0086] Disclosed herein is an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell. In an aspect, a disclosed nucleic acid sequence can have a coding sequence that is less than about 4.5 kilobases.
[0087] Disclosed herein is an isolated nucleic acid molecule comprising the sequence set forth in any one of SEQ ID NO:16-SEQ ID NO:21.
[0088] In an aspect, a disclosed encoded polypeptide can cleave α glycosidic bonds in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond at the branching point in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond and the α(1.fwdarw.4) bond in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can be a truncated human glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a bacterial glycogen debranching enzyme or a non-bacterial glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a type I Pullulanase from Bacillus subtilis.
[0089] In an aspect, a disclosed encoded microbial polypeptide can comprise the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed encoded microbial polypeptide can comprise a sequence having at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed human glycogen debranching enzyme can comprise the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed truncated human glycogen debranching enzyme can comprise a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed nucleic acid sequence can comprise the sequence set forth in SEQ ID NO:04. In an aspect, a disclosed nucleic acid sequence can comprise a sequence having at least 50-69%, at least 70-89%, or at least 90-99% identity to the sequence set forth in SEQ ID NO:04.
Nucleotide Sequences
[0090] In an aspect, a disclosed original polynucleotide open reading frame (ORF) sequence of Pullulanase derived from B. subtilis strain 168 can have the following sequence or a fragment thereof:
TABLE-US-00001 (SEQ ID NO: 03) ATGGTCAGCATCCGCCGCAGCTTCGAAGCGTATGTCGATGACATGAATAT CATTACTGTTCTGATTCCTGCTGAACAAAAGGAAATCATGACACCGCCGT TTCGGCTTGAGACAGAAATAACAGATTTTCCTCTGGCTGTCAGGGAGGAA TACTCCCTTGAAGCAAAATACAAGTACGTCTGCGTATCCGACCATCCTGT GACATTTGGAAAAATCCATTGCGTCAGAGCATCCAGCGGCCACAAAACGG ATCTCCAAATTGGCGCGGTCATCCGGACGGCAGCGTTTGATGACGAATTT TATTATGACGGAGAGCTGGGCGCCGTTTATACCGCGGATCATACCGTATT TAAAGTATGGGCGCCTGCTGCAACCTCAGCTGCTGTCAAGCTTTCACACC CCAATAAAAGCGGGCGCACATTCCAAATGACTCGCTTGGAAAAAGGCGTC TATGCCGTTACGGTCACAGGTGACCTTCACGGATATGAGTATTTGTTTTG CATCTGCAACAATTCAGAATGGATGGAAACAGTTGACCAGTATGCCAAGG CTGTGACTGTAAATGGAGAGAAGGGCGTCGTCTTGCGCCCGGATCAAATG AAATGGACTGCTCCTCTTAAACCATTCTCACACCCTGTGGATGCCGTCAT CTATGAGACGCATCTTCGCGACTTCTCCATCCATGAAAACAGCGGCATGA TAAACAAGGGAAAATACTTAGCGCTGACGGAAACTGATACACAAACCGCA AATGGCAGTTCTTCGGGATTAGCGTATGTAAAAGAGCTTGGTGTGACACA TGTGGAGCTTCTGCCGGTGAATGATTTTGCCGGAGTTGATGAAGAGAAGC CGCTTGATGCATACAATTGGGGATATAACCCGCTTCATTTCTTTGCCCCG GAGGGAAGCTATGCCTCAAATCCTCATGATCCTCAAACGAGAAAAACAGA GCTGAAACAAATGATCAATACCCTGCATCAGCACGGTCTGCGAGTCATTC TGGATGTTGTTTTTAACCATGTGTATAAGAGGGAGAATTCCCCCTTTGAA AAGACAGTGCCCGGTTATTTTTTCCGGCACGACGAATGTGGGATGCCATC AAACGGCACCGGCGTTGGCAATGATATTGCATCAGAAAGAAGGATGGCAA GAAAATTCATTGCGGATTGCGTGGTCTATTGGCTTGAAGAATACAATGTT GACGGCTTCCGCTTTGATCTCCTCGGGATTTTAGATATTGACACCGTGCT TTATATGAAAGAGAAAGCAACTAAGGCAAAGCCCGGAATCCTGCTTTTTG GAGAAGGGTGGGACCTGGCTACACCGCTGCCGCATGAACAGAAAGCTGCT TTGGCGAACGCGCCAAGAATGCCGGGCATCGGCTTTTTTAATGATATGTT TCGTGACGCTGTAAAAGGGAACACCTTTCACCTTAAGGCAACAGGGTTTG CGCTCGGCAACGGTGAATCAGCACAAGCTGTGATGCATGGAATTGCCGGG TCTTCCGGATGGAAGGCATTAGCACCGATTGTTCCGGAACCAAGCCAGTC CATCAATTATGTCGAATCACACGACAATCACACCTTTTGGGATAAAATGA GCTTTGCGCTTCCTCAAGAAAATGACAGCCGAAAGCGAAGCAGGCAAAGG CTTGCAGCCGCGATTATTTTGCTTGCCCAAGGGGTGCCGTTTATTCACAG CGGCCAGGAATTTTTCCGGACGAAGCAGGGAGTGGAAAACAGCTATCAAT CCAGTGACAGCATCAACCAGCTCGACTGGGATCGCCGTGAAACATTCAAA GAAGATGTTCACTATATCCGCAGGCTGATCTCGCTGAGAAAAGCGCATCC TGCATTCCGTCTTAGGTCCGCTGCAGACATCCAGCGCCATCTTGAATGCT TGACGCTAAAAGAACACCTTATCGCATACAGGCTTTATGATCTTGACGAG GTTGACGAATGGAAAGATATCATTGTTATCCATCACGCGAGTCCAGACTC CGTCGAGTGGAGGCTGCCAAACGACATACCTTATCGGCTTTTATGTGATC CATCAGGATTTCAGGAAGACCCAACAGAAATCAAGAAAACGGTTGCAGTA AACGGCATCGGAACGGTTATCTTATATTTAGCATCAGATCTTAAGAGTTT TGCTTGA.
[0091] In an aspect, a disclosed CpG-free and codon-optimized polynucleotide ORF sequence for expressing Pullulanase derived from Bacillus subtilis strain 168 in human cells can have the following sequence or a fragment thereof:
TABLE-US-00002 (SEQ ID NO: 04) ATGGTGAGCATCAGAAGATCCTTTGAGGCCTATGTGGATGATATGAACAT CATCACAGTGCTGATCCCAGCTGAGCAGAAGGAGATCATGACACCCCCTT TCAGACTGGAGACAGAGATCACAGACTTTCCCCTGGCTGTGAGAGAGGAG TATAGCCTGGAGGCCAAGTACAAGTATGTGTGTGTGTCTGACCATCCTGT GACCTTTGGCAAGATCCACTGTGTGAGAGCAAGCTCTGGACACAAGACAG ACCTGCAGATTGGAGCTGTGATCAGGACAGCAGCCTTTGATGATGAGTTT TACTATGATGGAGAGCTGGGAGCTGTGTACACAGCAGATCACACAGTGTT CAAGGTCTGGGCACCAGCAGCCACATCTGCTGCAGTGAAGCTGAGCCACC CCAACAAGTCTGGCAGGACCTTTCAGATGACAAGACTGGAGAAGGGAGTG TATGCTGTGACAGTGACAGGAGATCTGCATGGCTATGAGTATCTGTTCTG CATCTGTAACAATTCTGAGTGGATGGAGACAGTGGATCAGTATGCCAAGG CTGTGACAGTGAATGGAGAGAAGGGAGTGGTGCTGAGGCCAGACCAGATG AAGTGGACAGCACCCCTGAAGCCTTTCAGCCACCCTGTGGATGCTGTGAT CTATGAGACACACCTGAGAGATTTTTCTATCCATGAGAACTCTGGCATGA TCAATAAGGGCAAGTACCTGGCCCTGACAGAGACAGACACCCAGACAGCC AATGGCTCTAGCTCTGGCCTGGCCTATGTGAAGGAGCTGGGAGTGACCCA TGTGGAGCTGCTGCCTGTGAATGACTTTGCTGGAGTGGATGAGGAGAAGC CACTGGATGCCTACAACTGGGGCTATAATCCACTGCACTTCTTTGCCCCT GAGGGCTCTTATGCCAGCAACCCACATGACCCCCAGACCAGGAAGACAGA GCTGAAGCAGATGATCAATACACTGCACCAGCATGGCCTGAGAGTGATCC TGGATGTGGTGTTCAACCATGTGTACAAGAGAGAGAATAGCCCTTTTGAG AAGACAGTGCCAGGCTATTTCTTTAGACATGATGAGTGTGGCATGCCATC TAATGGCACAGGAGTGGGCAATGATATTGCCTCTGAGAGGAGAATGGCCA GAAAGTTCATTGCTGACTGTGTGGTGTACTGGCTGGAGGAGTATAATGTG GATGGCTTCAGATTTGATCTGCTGGGCATCCTGGACATTGATACAGTGCT GTACATGAAGGAGAAGGCCACAAAGGCCAAGCCAGGCATCCTGCTGTTTG GAGAGGGATGGGACCTGGCAACCCCACTGCCACATGAGCAGAAGGCTGCC CTGGCAAATGCACCTAGGATGCCAGGCATTGGCTTCTTCAATGACATGTT TAGAGATGCTGTGAAGGGCAATACCTTCCACCTGAAGGCCACAGGCTTTG CACTGGGAAATGGAGAGTCTGCCCAGGCTGTGATGCATGGAATTGCAGGA TCTTCTGGATGGAAGGCCCTGGCACCAATTGTGCCTGAGCCAAGCCAGTC CATCAACTATGTGGAGTCCCATGACAATCACACCTTCTGGGATAAGATGT CTTTTGCCCTGCCTCAGGAGAATGATTCTAGGAAGAGAAGCAGGCAGAGA CTGGCAGCAGCAATCATCCTGCTGGCCCAGGGAGTGCCATTCATCCACTC TGGCCAGGAGTTCTTTAGAACCAAGCAGGGAGTGGAGAACTCCTACCAGT CCTCTGATTCTATCAATCAGCTGGACTGGGATAGGAGAGAGACATTCAAG GAGGATGTGCACTATATCAGGAGACTGATCAGCCTGAGAAAGGCACACCC AGCCTTTAGACTGAGATCTGCTGCAGACATCCAGAGGCACCTGGAGTGCC TGACCCTGAAGGAGCACCTGATTGCCTACAGACTGTATGACCTGGATGAG GTGGATGAGTGGAAGGATATCATTGTGATCCACCATGCCTCCCCTGACTC TGTGGAGTGGAGACTGCCCAATGATATCCCTTACAGACTGCTGTGTGACC CCTCTGGCTTCCAGGAGGATCCTACAGAGATCAAGAAGACAGTGGCTGTG AATGGCATTGGCACAGTGATCCTGTATCTGGCCTCTGACCTGAAGTCTTT TGCCTGA.
[0092] In an aspect, a disclosed LSP promoter can have the following sequence or a fragment thereof:
TABLE-US-00003 (SEQ ID NO: 15) GAGTTAATTTTTAAAAAGCAGTCAAAAGTCCAAGTGGCCCTTGCGAGCAT TTACTCTCTCTGTTTGCTCTGGTTAATAATCTCAGGAGCACAAAATTCCT TACTAGTCCTAGAAGTTAATTTTTAAAAAGCAGTCAAAAGTCCAAGTCCA AGTGGCCCTTGCGAGCATTTACTCTCTCTGTTTGCTCTGGTTAATAATCT CAGGAGCACAAACATTCCTTACTAGTTCTAGAGCGGCCGCCAGTGTGCTG GAATTCGGCTTTTTTAGGGCTGGAAGCTACCTTTGACATCATTTCCTCTG CGAATGCATGTATAATTTCTACAGAACCTATTAGAAAGGATCACCCAGCC TCTGCTTTTGTACAACTTTCCCTTAAAAAATGCCAATTCCACTGCTGTTT GGCCCAATAGTGAGAACTTTTTCCTGCTGCCTCTTGGTGCTTTTGCCTAT GGCCCCTATTCTGCCTGCTGAAGACACTCTTGCCAGCATGGACTTAAACC CCTCCAGCTCTGACAATCCTCTTTCTCTTTTGTTTTACATGAAGGGTCTG GCAGCCAAAGCAATCACTCAAAGGTTCAAACCTTATCATTTTTTGCTTTG TTCCTCTTGGCCTTGGTTTTGTACATCAGCTTTGAAAATACCATCCCAGG GTTAATGCTGGGGTTAATTTATAACTAAGAGTGCTCTAGTTTTGCAATAC AGGACATGCTATAAAAATGGAAAGATGTTGCTTTCTGAGAGATCAGCTTA CATGT.
[0093] In an aspect, a disclosed LSP-CB dual promoter can have the following sequence or a fragment thereof:
TABLE-US-00004 (SEQ ID NO: 05) GAGTTAATTTTTAAAAAGCAGTCAAAAGTCCAAGTGGCCCTTGCGAGCAT TTACTCTCTCTGTTTGCTCTGGTTAATAATCTCAGGAGCACAAAATTCCT TACTAGTCCTAGAAGTTAATTTTTAAAAAGCAGTCAAAAGTCCAAGTCCA AGTGGCCCTTGCGAGCATTTACTCTCTCTGTTTGCTCTGGTTAATAATCT CAGGAGCACAAACATTCCTTACTAGTTCTAGAGCGGCCGCCAGTGTGCTG GAATTCGGCTTTTTTAGGGCTGGAAGCTACCTTTGACATCATCTCCTCTG CGAATGCATGTATAATTTCTACAGAACCTATTAGAAAGGATCACCCAGCC TCTGCTTTTGTACAACTTTCCCTTAAAAAACTGCCAATCCCACTGCTGTT TGGCCCAATAGTGAGAACTTTTTCTGCTGCCTCTTGGTGCTTTTGCCTAT GGCCCCTATTCTGCTGCTGAAGACACTCTTGCCAGCATGGACTTAAACCC CTCCAGCTCTGACAATCCTCTTTCTCTTTTGTTTTACATGAAGGGTCTGG CAGCCAAAGCAATCACTCAAAGTTCAAACCTTATCATTTTTTGCTTTGTT CCTCTTGGCCTTGGTTTTGTACATCAGCTTTGAAAATACCATCCCAGGGT TAATGCTGGGGTTAATTTATAACTGAGAGTGCTCTAGTTTTGCAATACAG GACATGCTATAAAAATGGCTTAAGGTTCCGCGTTACATAACTTACGGTAA ATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATA ATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCA ATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGT ATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCC GCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCA GTACATCTACGTATTAGTCATCGCTATTACCATGCATGGTCGAGGTGAGC CCCACGTTCTGCTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAAT TTTGTATTTATTTATTTTTTAATTATTTTGTGCAGCGAGGGGCGGGGCGG GGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCCGAA AGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGA AGCGCGCGGCGGGCG.
[0094] In an aspect, a disclosed LSP-mCMV/hEF1α.sup.CpG-free dual promoter can have the following sequence or a fragment thereof:
TABLE-US-00005 (SEQ ID NO: 6) GAGTTAATTTTTAAAAAGCAGTCAAAAGTCCAAGTGGCCCTTGCGAGCAT TTACTCTCTCTGTTTGCTCTGGTTAATAATCTCAGGAGCACAAAATTCCT TACTAGTCCTAGAAGTTAATTTTTAAAAAGCAGTCAAAAGTCCAAGTCCA AGTGGCCCTTGCGAGCATTTACTCTCTCTGTTTGCTCTGGTTAATAATCT CAGGAGCACAAACATTCCTTACTAGTTCTAGAGCGGCCGCCAGTGTGCTG GAATTCGGCTTTTTTAGGGCTGGAAGCTACCTTTGACATCATCTCCTCTG CGAATGCATGTATAATTTCTACAGAACCTATTAGAAAGGATCACCCAGCC TCTGCTTTTGTACAACTTTCCCTTAAAAAACTGCCAATCCCACTGCTGTT TGGCCCAATAGTGAGAACTTTTTTCTGCTGCCTCTTGGTGCTTTTGCCTA TGGCCCCTATTCTGCTGCTGAAGACACTCTTGCCAGCATGGACTTAAACC CCTCCAGCTCTGACAATCCTCTTTCTCTTTTGTTTTACATGAAGGGTCTG GCAGCCAAAGCAATCACTCAAAGTTCAAACCTTATCATTTTTTGCTTTGT TCCTCTTGGCCTTGGTTTTGTACATCAGCTTTGAAAATACCATCCCAGGG TTAATGCTGGGGTTAATTTATAACTGAGAGTGCTCTAGTTTTGCAATACA GGACATGCTATAAAAATGGCTTAAGGAGTCAATGGGAAAAACCCATTGGA GCCAAGTACACTGACTCAATAGGGACTTTCCATTGGGTTTTGCCCAGTAC ATAAGGTCAATAGGGGGTGAGTCAACAGGAAAGTCCCATTGGAGCCAAGT ACATTGAGTCAATAGGGACTTTCCAATGGGTTTTGCCCAGTACATAAGGT CAATGGGAGGTAAGCCAATGGGTTTTTCCCATTACTGACATGTATACTGA GTCATTAGGGACTTTCCAATGGGTTTTGCCCAGTACATAAGGTCAATAGG GGTGAATCAACAGGAAAGTCCCATTGGAGCCAAGTACACTGAGTCAATAG GGACTTTCCATTGGGTTTTGCCCAGTACAAAAGGTCAATAGGGGGTGAGT CAATGGGTTTTTCCCATTATTGGCACATACATAAGGTCAATAGGGGTGAC TAGTGGAGAAGAGCATGCTTGAGGGCTGAGTGCCCCTCAGTGGGCAGAGA GCACATGGCCCACAGTCCCTGAGAAGTTGGGGGGAGGGGTGGGCAATTGA ACTGGTGCCTAGAGAAGGTGGGGCTTGGGTAAACTGGGAAAGTGATGTGG TGTACTGGCTCCACCTTTTTCCCCAGGGTGGGGGAGAACCATATATAAGT GCAGTAGTCTCTGTGAACATTC.
Polypeptide Sequences
[0095] In an aspect, a disclosed Pullulanase [Bacillus subtilis subsp. subtilis str. 168] can have the sequence set forth in NCBI Reference Sequence No. NP_390871.2. In an aspect, a disclosed Pullulanase can have the following sequence or a fragment thereof:
TABLE-US-00006 (SEQ ID NO: 01) MVSIRRSFEAYVDDMNIITVLIPAEQKEIIVITPPFRLETEITDFPLAVR EEYSLEAKYKYVCVSDHPVTFGKIHCVRASSGHKTDLQIGAVIRTAAFDD EFYYDGELGAVYTADHTVFKVWAPAATSAAVKLSHPNKSGRTFQMTRLEK GVYAVTVTGDLHGYEYLFCICNNSEWMETVDQYAKAVTVNGEKGVVLRPD QMKWTAPLKPFSHPVDAVIYETHLRDFSIHENSGMINKGKYLALTETDTQ TANGSSSGLAYVKELGVTHVELLPVNDFAGVDEEKPLDAYNWGYNPLHFF APEGSYASNPHDPQTRKTELKQMINTLHQHGLRVILDVVFNHVYKRENSP FEKTVPGYFFRHDECGMPSNGTGVGNDIASERRMARKFIADCVVYWLEEY NVDGFRFDLLGILDIDTVLYMKEKATKAKPGILLFGEGWDLATPLPHEQK AALANAPRMPGIGFFNDMFRDAVKGNTFHLKATGFALGNGESAQAVMHGI AGSSGWKALAPIVPEPSQSINYVESHDNHTFWDKMSFALPQENDSRKRSR QRLAAAIILLAQGVPFIHSGQEFFRTKQGVENSYQSSDSINQLDWDRRET FKEDVHYIRRLISLRKAHPAFRLRSAADIQRHLECLTLKEHLIAYRLYDL DEVDEWKDIIVIHHASPDSVEWRLPNDIPYRLLCDPSGFQEDPTEIKKTV AVNGIGTVILYLASDLKSFA.
[0096] In an aspect, a disclosed human glycogen debranching enzyme isoform 1 can have the sequence set forth in NCBI Reference Sequence No. NP_000635.2. In an aspect, a disclosed human glycogen debranching enzyme isoform 1 can have the following sequence or a fragment thereof:
TABLE-US-00007 (SEQ ID NO: 02) MGHSKQIRILLLNEMEKLEKTLFRLEQGYELQFRLGPTLQGKAVTVYTNY PFPGETFNREKFRSLDWENPTEREDDSDKYCKLNLQQSGSFQYYFLQGNE KSGGGYIVVDPILRVGADNHVLPLDCVTLQTFLAKCLGPFDEWESRLRVA KESGYNMIHFTPLQTLGLSRSCYSLANQLELNPDFSRPNRKYTWNDVGQL VEKLKKEWNVICITDVVYNHTAANSKWIQEHPECAYNLVNSPHLKPAWVL DRALWRFSCDVAEGKYKEKGIPALIENDHHMNSIRKIIWEDIFPKLKLWE FFQVDVNKAVEQFRRLLTQENRRVTKSDPNQHLTIIQDPEYRRFGCTVDM NIALTTFIPHDKGPAAIEECCNWFHKRMEELNSEKHRLINYHQEQAVNCL LGNVFYERLAGHGPKLGPVTRKHPLVTRYFTFPFEEIDFSMEESMIHLPN KACFLMAHNGWVMGDDPLRNFAEPGSEVYLRRELICWGDSVKLRYGNKPE DCPYLWAHMKKYTEITATYFQGVRLDNCHSTPLHVAEYWILDAARNLQPN LYVVAELFTGSEDLDNVFVTRLGISSLIREAMSAYNSHEEGRLVYRYGGE PVGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHRSAYDALPSTTIVSM ACCASGSTRGYDELVPHQISVVSEERFYTKWNPEALPSNTGEVNFQSGII AARCAISKLHQELGAKGFIQVYVDQVDEDIVAVTRHSPSIHQSVVAVSRT AFRNPKTSFYSKEVPQMCIPGKIEEVVLEARTIERNTKPYRKDENSINGT PDITVEIREHIQLNESKIVKQAGVATKGPNEYIQEIEFENLSPGSVIIFR VSLDPHAQVAVGILRNHLTQFSPHFKSGSLAVDNADPILKIPFASLASRL TLAELNQILYRCESEEKEDGGGCYDIPNWSALKYAGLQGLMSVLAEIRPK NDLGHPFCNNLRSGDWMIDYVSNRLISRSGTIAEVGKWLQAMFFYLKQIP RYLIPCYFDAILIGAYTTLLDTAWKQMSSFVQNGSTFVKHLSLGSVQLCG VGKFPSLPILSPALMDVPYRLNEITKEKEQCCVSLAAGLPHFSSGIFRCW GRDTFIALRGILLITGRYVEARNIILAFAGTLRHGLIPNLLGEGIYARYN CRDAVWWWLQCIQDYCKMVPNGLDILKCPVSRMYPTDDSAPLPAGTLDQP LFEVIQEAMQKHMQGIQFRERNAGPQIDRNMKDEGFNITAGVDEETGFVY GGNRFNCGTWMDKMGESDRARNRGIPATPRDGSAVEIVGLSKSAVRWLLE LSKKNIFPYHEVTVKRHGKAIKVSYDEWNRKIQDNFEKLFHVSEDPSDLN EKHPNLVHKRGIYKDSYGASSPWCDYQLRPNFTIAMVVAPELFTTEKAWK ALEIAEKKLLGPLGMKTLDPDDMVYCGIYDNALDNDNYNLAKGFNYHQGP EWLWPIGYFLRAKLYFSRLMGPETTAKTIVLVKNVLSRHYVHLERSPWKG LPELTNENAQYCPFSCETQAWSIATILETLYDL.
(b) Vectors
[0097] Disclosed herein is a vector comprising an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell. In an aspect, a disclosed nucleic acid sequence can have a coding sequence that is less than about 4.5 kilobases.
[0098] In an aspect, a disclosed encoded polypeptide can cleave α glycosidic bonds in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond at the branching point in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond and the α(1.fwdarw.4) bond in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can be a truncated human glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a bacterial glycogen debranching enzyme or a non-bacterial glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a type I Pullulanase from Bacillus subtilis. In an aspect, a disclosed encoded microbial polypeptide can comprise the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed encoded microbial polypeptide can comprise a sequence having at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed human glycogen debranching enzyme can comprise the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed truncated human glycogen debranching enzyme can comprise a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed nucleic acid sequence can comprise the sequence set forth in SEQ ID NO:04. In an aspect, a disclosed nucleic acid sequence can comprise a sequence having at least 50-69%, at least 70-89%, or at least 90-99% identity to the sequence set forth in SEQ ID NO:04.
[0099] In an aspect, a disclosed vector can be a viral vector or a non-viral vector. In an aspect, a disclosed non-viral vector can be a polymer-based vector, a peptide based vector, a lipid nanoparticle, a solid lipid nanoparticle, or a cationic lipid based vector. In an aspect, a disclosed viral vector can be an adenovirus vector, an AAV, a herpes simplex virus vector, a retrovirus vector, a lentivirus vector, and alphavirus vector, a flavivirus vector, a rhabdovirus vector, a measles virus vector, a Newcastle disease viral vector, a poxvirus vector, or a picornavirus vector. In an aspect, a disclosed viral vector can be an AAV vector. AAV vectors include, but are not limited to, AAV1, AAV2, AAV3 (including 3a and 3b), AAV4, AAVS, AAV6, AAV7, AAV8, AAVrh8, AAV.hum8, AAV9, AAV10, AAVrh10, AAV11, AAV12, AAV13, AAVrh39, AAVrh43, AAVcy.7 as well as bovine AAV, caprine AAV, canine AAV, equine AAV, ovine AAV, avian AAV, primate AAV, non-primate AAV, and any other virus classified by the International Committee on Taxonomy of Viruses (ICTV) as an AAV. In an aspect, AAV capsids can be chimeras either created by capsid evolution or by rational capsid engineering from the naturally isolated AAV variants to capture desirable serotype features such as enhanced or specific tissue tropism and host immune response escape, including but not limited to AAV-DJ, AAV-HAE1, AAV-HAE2, AAVM41, AAV-1829, AAV2 Y/F, AAV2 T/V, AAV2i8, AAV2.5, AAV9.45, AAV9.61, AAV-B1, AAV-AS, AAV9.45A-String (e.g., AAV9.45-AS), AAV9.45Angiopep, AAV9.47-Angiopep, and AAV9.47-AS., AAV-PHP.B, AAV-PHP.eB, AAV-PHP.S, AAV-F, AAVcc.47, and AAVcc.81. In an aspect, an AAV vector can be AAV9, AAVcc.47, or AAVcc.81. In an aspect, a disclosed AAV vector can be AAV-Rh74 or a related variant (e.g., capsid variants such as RHM4-1).
[0100] In an aspect, a disclosed vector can comprise a ubiquitous promoter operably linked to the isolated nucleic acid molecule, wherein the ubiquitous promoter drives the expression of the polypeptide. In an aspect, a disclosed ubiquitous promoter can be a CMV enhancer/chicken β-actin promoter (CB promoter) or a CpG-free murine CMV enhancer/human elongation factor-1 alpha promoter (mCMV/hEF1α promoter). In an aspect, a disclosed vector can comprise a tissue-specific promoter operably linked to the isolated nucleic acid molecule. In an aspect, a disclosed tissue-specific promoter can be a liver-specific promoter, a muscle-specific promoter, a neuron-specific promoter, or a combination of two or more disclosed promoters. In an aspect, a liver-specific promoter can be a α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter. In an aspect, a liver-specific promoter can comprise about 845-bp and comprise the thyroid hormone-binding globulin promoter sequences (2382 to 13), two copies of α1-microglobulinybikunin enhancer sequences (22,804 through 22,704), and a 71-bp leader sequence as described by Ill CR, et al. (1997). In an aspect, a disclosed liver-specific promoter can comprise the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%-60%, at least 60%-80%, at least 80%-90%, or at least 90%-100% identity to the sequence set forth in SEQ ID NO:15.
[0101] In an aspect, a disclosed vector can comprise an immunotolerant dual promoter comprising a liver-specific promoter and a ubiquitous promoter. In an aspect, a disclosed immunotolerant dual promoter can comprise a α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter and a CB promoter. In an aspect, a disclosed immunotolerant dual promoter can comprise a α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter and a CpG-free mCMV/hEF1α promoter. In an aspect, a disclosed immunotolerant dual promoter can comprise the sequence set forth in SEQ ID NO:05 or SEQ ID NO:06. In an aspect, a disclosed immunotolerant dual promoter can comprise a sequence having at least 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO:05 or SEQ ID NO:06.
[0102] In an aspect, a disclosed vector can comprise an isolated nucleic acid molecule comprising the one or more promoters, the CpG-depleted and codon-optimized nucleic acid sequence encoding the polypeptide, and a polyadenylation sequence.
[0103] Disclosed herein is a vector comprising an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, wherein the nucleic acid sequence is CG-depleted and codon-optimized for expression in a human or a mammalian cell, wherein a liver-specific promoter is operably linked to the nucleic acid sequence.
[0104] In an aspect, a disclosed nucleic acid sequence can have a coding sequence that is less than about 4.5 kilobases.
[0105] In an aspect, a disclosed encoded polypeptide can cleave α glycosidic bonds in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond at the branching point in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond and at the α(1.fwdarw.4) bond in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can be a truncated human glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a bacterial glycogen debranching enzyme or a non-bacterial glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a type I Pullulanase from Bacillus subtilis. In an aspect, a disclosed encoded microbial polypeptide can comprise the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed encoded microbial polypeptide can comprise a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed human glycogen debranching enzyme can comprise the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed truncated human glycogen debranching enzyme can comprise a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed nucleic acid sequence can comprise the sequence set forth in SEQ ID NO:04. In an aspect, a disclosed nucleic acid sequence can comprise a sequence having at least 50-69%, at least 70-89%, or at least 90-99% identity to the sequence set forth in SEQ ID NO:04.
[0106] In an aspect, a disclosed vector can be an AAV vector. AAV vectors include, but are not limited to, AAV1, AAV2, AAV3 (including 3a and 3b), AAV4, AAV5, AAV6, AAV7, AAV8, AAVrh8, AAV9, AAV10, AAVrh10, AAV11, AAV12, AAV13, AAVrh39, AAVrh43, AAVcy.7 as well as bovine AAV, caprine AAV, canine AAV, equine AAV, ovine AAV, avian AAV, primate AAV, non-primate AAV, and any other virus classified by the International Committee on Taxonomy of Viruses (ICTV) as an AAV. In an aspect, AAV capsids can be chimeras either created by capsid evolution or by rational capsid engineering from the naturally isolated AAV variants to capture desirable serotype features such as enhanced or specific tissue tropism and host immune response escape, including but not limited to AAV-DJ, AAV-HAE1, AAV-HAE2, AAVM41, AAV-1829, AAV2 Y/F, AAV2 T/V, AAV2i8, AAV2.5, AAV9.45, AAV9.61, AAV-B1, AAV-AS, AAV9.45A-String (e.g., AAV9.45-AS), AAV9.45Angiopep, AAV9.47-Angiopep, and AAV9.47-AS, AAV-PHP.B, AAV-PHP.eB, AAV-PHP.S, AAV-F, AAVcc.47, and AAVcc.81. In an aspect, an AAV vector can be AAV9, AAVcc.47, or AAVcc.81. In an aspect, a disclosed AAV vector can be AAV-Rh74 or a related variant (e.g., capsid variants such as RHM4-1).
[0107] In an aspect, a disclosed liver-specific promoter can be a α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter. In an aspect, a liver-specific promoter can comprise about 845-bp and comprise the thyroid hormone-binding globulin promoter sequences (2382 to 13), two copies of α1-microglobulinybikunin enhancer sequences (22,804 through 22,704), and a 71-bp leader sequence. In an aspect, a disclosed liver-specific promoter can be the LSP described by Ill C R, et al. (1997). In an aspect, a disclosed liver-specific promoter can comprise the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%-60%, at least 60%-80%, at least 80%-90%, or at least 90%-100% identity to the sequence set forth in SEQ ID NO:15.
[0108] In an aspect, a disclosed vector can comprise an isolated nucleic acid molecule comprising the one or more promoters, the CpG-depleted and codon-optimized nucleic acid sequence encoding the polypeptide, and a polyadenylation sequence.
[0109] Disclosed herein is an AAV vector comprising an isolated nucleic acid molecule, wherein the isolated nucleic acid sequence encodes either a microbial polypeptide or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, and wherein the isolated nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell. AAV vectors include, but are not limited to, AAV1, AAV2, AAV3 (including 3a and 3b), AAV4, AAV5, AAV6, AAV7, AAV8, AAVrh8, AAV.hum8, AAV9, AAV10, AAVrh10, AAV11, AAV12, AAV13, AAVrh39, AAVrh43, AAVcy.7 as well as bovine AAV, caprine AAV, canine AAV, equine AAV, ovine AAV, avian AAV, primate AAV, non-primate AAV, and any other virus classified by the International Committee on Taxonomy of Viruses (ICTV) as an AAV. In an aspect, AAV capsids can be chimeras either created by capsid evolution or by rational capsid engineering from the naturally isolated AAV variants to capture desirable serotype features such as enhanced or specific tissue tropism and host immune response escape, including but not limited to AAV-DJ, AAV-HAE1, AAV-HAE2, AAVM41, AAV-1829, AAV2 Y/F, AAV2 T/V, AAV2i8, AAV2.5, AAV9.45, AAV9.61, AAV-B1, AAV-AS, AAV9.45A-String (e.g., AAV9.45-AS), AAV9.45Angiopep, AAV9.47-Angiopep, and AAV9.47-AS., AAV-PHP.B, AAV-PHP.eB, AAV-PHP.S, AAV-F, AAVcc.47, and AAVcc.81. In an aspect, an AAV vector can be AAV9, AAVcc.47, or AAVcc.81. In an aspect, a disclosed AAV vector can be AAV-Rh74 or a related variant (e.g., capsid variants such as RHM4-1).
[0110] In an aspect, a disclosed nucleic acid sequence can have a coding sequence that is less than about 4.5 kilobases.
[0111] In an aspect, a disclosed encoded polypeptide can cleave α glycosidic bonds in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond at the branching point in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond and at the α(1.fwdarw.4) bond in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can be a truncated human glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a bacterial glycogen debranching enzyme or a non-bacterial glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a type I Pullulanase from Bacillus subtilis. In an aspect, a disclosed encoded microbial polypeptide can comprise the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed encoded microbial polypeptide can comprise a sequence having at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed human glycogen debranching enzyme can comprise the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed truncated human glycogen debranching enzyme can comprise a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed nucleic acid sequence can comprise the sequence set forth in SEQ ID NO:04. In an aspect, a disclosed nucleic acid sequence can comprise a sequence having at least 50-69%, at least 70-89%, or at least 90-99% identity to the sequence set forth in SEQ ID NO:04.
[0112] In an aspect, a disclosed vector can comprise a ubiquitous promoter operably linked to the isolated nucleic acid molecule, wherein the ubiquitous promoter drives the expression of the polypeptide. In an aspect, a disclosed ubiquitous promoter can be a CB promoter or a CpG-free mCMV/hEF1α promoter. In an aspect, a disclosed vector can comprise a tissue-specific promoter operably linked to the isolated nucleic acid molecule. In an aspect, a disclosed tissue-specific promoter can be a liver-specific promoter, a muscle-specific promoter, a neuron-specific promoter, or a combination of two or more disclosed promoters. In an aspect, a liver-specific promoter can be a α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter. In an aspect, a liver-specific promoter can comprise about 845-bp and comprise the thyroid hormone-binding globulin promoter sequences (2382 to 13), two copies of α1-microglobulinybikunin enhancer sequences (22,804 through 22,704), and a 71-bp leader sequence as described by Ill C R, et al. (1997). In an aspect, a disclosed liver-specific promoter can comprise the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%-60%, at least 60%-80%, at least 80%-90%, or at least 90%-100% identity to the sequence set forth in SEQ ID NO:15.
[0113] In an aspect, a disclosed vector can comprise an immunotolerant dual promoter comprising a liver-specific promoter and a ubiquitous promoter. In an aspect, a disclosed immunotolerant dual promoter can comprise a α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter and a CB promoter. In an aspect, a disclosed immunotolerant dual promoter can comprise a α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter and a CpG-free mCMV/hEF1α promoter. In an aspect, a disclosed immunotolerant dual promoter can comprise the sequence set forth in SEQ ID NO:05 or SEQ ID NO:06. In an aspect, a disclosed immunotolerant dual promoter can comprise a sequence having at least 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO:05 or SEQ ID NO:06.
[0114] In an aspect, a disclosed vector can comprise an isolated nucleic acid molecule comprising the one or more promoters, the CpG-depleted and codon-optimized nucleic acid sequence encoding the polypeptide, and a polyadenylation sequence.
[0115] Disclosed herein is a vector comprising a gene expression cassette comprising an isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide for preventing glycogen accumulation and/or degrading accumulated glycogen under the control of a dual promoter comprising a liver-specific promoter and a ubiquitous promoter. In an aspect, a disclosed nucleic acid sequence can be CpG-depleted and codon-optimized for expression in a human or a mammalian cell. In an aspect, a disclosed nucleic acid sequence can have a nucleotide sequence having about 4.5 kb or less.
[0116] In an aspect, a disclosed encoded polypeptide can cleave α glycosidic bonds in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond at the branching point in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond and at the α(1.fwdarw.4) bond in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can be a truncated human glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a bacterial glycogen debranching enzyme or a non-bacterial glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a type I Pullulanase from Bacillus subtilis. In an aspect, a disclosed encoded microbial polypeptide can comprise the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed encoded microbial polypeptide can comprise a sequence having at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed human glycogen debranching enzyme can comprise the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed truncated human glycogen debranching enzyme can comprise a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed nucleic acid sequence can comprise the sequence set forth in SEQ ID NO:04. In an aspect, a disclosed nucleic acid sequence can comprise a sequence having at least 50-69%, at least 70-89%, or at least 90-99% identity to the sequence set forth in SEQ ID NO:04.
[0117] In an aspect, a disclosed ubiquitous promoter can be operably linked to the isolated nucleic acid molecule. In an aspect, a disclosed ubiquitous promoter can be a CB promoter or a CpG-free mCMV/hEF1α promoter. In an aspect, a disclosed tissue-specific promoter can be operably linked to the isolated nucleic acid molecule. In an aspect, a disclosed tissue-specific promoter can be a liver-specific promoter, a muscle-specific promoter, a neuron-specific promoter, or a combination of two or more disclosed promoters. In an aspect, a liver-specific promoter can be a α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter. In an aspect, a liver-specific promoter can comprise about 845-bp and comprise the thyroid hormone-binding globulin promoter sequences (2382 to 13), two copies of α1-microglobulinybikunin enhancer sequences (22,804 through 22,704), and a 71-bp leader sequence as described by Ill C R, et al. (1997). In an aspect, a disclosed liver-specific promoter can comprise the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%-60%, at least 60%-80%, at least 80%-90%, or at least 90%-100% identity to the sequence set forth in SEQ ID NO:15.
[0118] In an aspect, a disclosed immunotolerant dual promoter can comprise the sequence set forth in SEQ ID NO:05 or SEQ ID NO:06. In an aspect, a disclosed immunotolerant dual promoter can comprise a sequence having at least 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO:05 or SEQ ID NO:06. In an aspect, a disclosed vector can comprise an isolated nucleic acid molecule comprising the one or more promoters, the CpG-depleted and codon-optimized nucleic acid sequence encoding the polypeptide, and a polyadenylation sequence.
[0119] In an aspect, a disclosed vector can be a viral vector or a non-viral vector. In an aspect, a disclosed non-viral vector can be a polymer-based vector, a peptide based vector, a lipid nanoparticle, a solid lipid nanoparticle, or a cationic lipid based vector. In an aspect, a disclosed viral vector can be an adenovirus vector, an adeno-associated virus vector, a herpes simplex virus vector, a retrovirus vector, a lentivirus vector, and alphavirus vector, a flavivirus vector, a rhabdovirus vector, a measles virus vector, a Newcastle disease viral vector, a poxvirus vector, or a picornavirus vector. In an aspect, a disclosed viral vector can be an AAV vector. AAV vectors include, but are not limited to, AAV1, AAV2, AAV3 (including 3a and 3b), AAV4, AAV5, AAV6, AAV7, AAV8, AAVrh8, AAV.hum8, AAV9, AAV10, AAVrh10, AAV11, AAV12, AAV13, AAVrh39, AAVrh43, AAVcy.7 as well as bovine AAV, caprine AAV, canine AAV, equine AAV, ovine AAV, avian AAV, primate AAV, non-primate AAV, and any other virus classified by the International Committee on Taxonomy of Viruses (ICTV) as an AAV. In an aspect, AAV capsids can be chimeras either created by capsid evolution or by rational capsid engineering from the naturally isolated AAV variants to capture desirable serotype features such as enhanced or specific tissue tropism and host immune response escape, including but not limited to AAV-DJ, AAV-HAE1, AAV-HAE2, AAVM41, AAV-1829, AAV2 Y/F, AAV2 T/V, AAV2i8, AAV2.5, AAV9.45, AAV9.61, AAV-B1, AAV-AS, AAV9.45A-String (e.g., AAV9.45-AS), AAV9.45Angiopep, AAV9.47-Angiopep, and AAV9.47-AS, AAV-PHP.B, AAV-PHP.eB, AAV-PHP.S, AAV-F, AAVcc.47, and AAVcc.81. In an aspect, an AAV vector can be AAV9, AAVcc.47, or AAVcc.81. In an aspect, a disclosed AAV vector can be AAV-Rh74 or a related variant (e.g., capsid variants such as RHM4-1).
[0120] Disclosed herein is a vector comprising a gene expression cassette comprising an isolated nucleic acid molecule, wherein the isolated nucleic acid sequence encodes either a microbial polypeptide or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, wherein the isolated nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, and wherein expression of the polypeptide is under the control of an immunotolerant dual promoter. In an aspect, a disclosed nucleic acid sequence can have a nucleotide sequence having about 4.5 kb or less. In an aspect, a disclosed encoded polypeptide can cleave α glycosidic bonds in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond at the branching point in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond and the α(1.fwdarw.4) bond in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can be a truncated human glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a bacterial glycogen debranching enzyme or a non-bacterial glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a type I Pullulanase from Bacillus subtilis. In an aspect, a disclosed encoded microbial polypeptide can comprise the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed encoded microbial polypeptide can comprise a sequence having at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed human glycogen debranching enzyme can comprise the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed truncated human glycogen debranching enzyme can comprise a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed nucleic acid sequence can comprise the sequence set forth in SEQ ID NO:04. In an aspect, a disclosed nucleic acid sequence can comprise a sequence having at least 50-69%, at least 70-89%, or at least 90-99% identity to the sequence set forth in SEQ ID NO:04.
[0121] In an aspect, a disclosed vector can comprise an isolated nucleic acid molecule comprising the one or more promoters, the CpG-depleted and codon-optimized nucleic acid sequence encoding the polypeptide, and a polyadenylation sequence.
[0122] In an aspect, a disclosed vector can be a viral vector or a non-viral vector. In an aspect, a disclosed non-viral vector can be a polymer-based vector, a peptide based vector, a lipid nanoparticle, a solid lipid nanoparticle, or a cationic lipid based vector. In an aspect, a disclosed viral vector can be an adenovirus vector, an adeno-associated virus vector, a herpes simplex virus vector, a retrovirus vector, a lentivirus vector, and alphavirus vector, a flavivirus vector, a rhabdovirus vector, a measles virus vector, a Newcastle disease viral vector, a poxvirus vector, or a picornavirus vector. In an aspect, a disclosed viral vector can be an AAV vector. AAV vectors include, but are not limited to, AAV1, AAV2, AAV3 (including 3a and 3b), AAV4, AAVS, AAV6, AAV7, AAV8, AAVrh8, AAV.hum8, AAV9, AAV10, AAVrh10, AAV11, AAV12, AAV13, AAVrh39, AAVrh43, AAVcy.7 as well as bovine AAV, caprine AAV, canine AAV, equine AAV, ovine AAV, avian AAV, primate AAV, non-primate AAV, and any other virus classified by the International Committee on Taxonomy of Viruses (ICTV) as an AAV. In an aspect, AAV capsids can be chimeras either created by capsid evolution or by rational capsid engineering from the naturally isolated AAV variants to capture desirable serotype features such as enhanced or specific tissue tropism and host immune response escape, including but not limited to AAV-DJ, AAV-HAE1, AAV-HAE2, AAVM41, AAV-1829, AAV2 Y/F, AAV2 T/V, AAV2i8, AAV2.5, AAV9.45, AAV9.61, AAV-B1, AAV-AS, AAV9.45A-String (e.g., AAV9.45-AS), AAV9.45Angiopep, AAV9.47-Angiopep, and AAV9.47-AS, AAV-PHP.B, AAV-PHP.eB, AAV-PHP.S, AAV-F, AAVcc.47, and AAVcc.81. In an aspect, an AAV vector can be AAV9, AAVcc.47, or AAVcc.81. In an aspect, a disclosed AAV vector can be AAV-Rh74 or a related variant (e.g., capsid variants such as RHM4-1).
(c) Formulations
[0123] Disclosed herein is a pharmaceutical formulation comprising a vector comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme for preventing glycogen accumulation and/or degrading accumulated glycogen, wherein the nucleic acid sequence is codon-optimized for expression in a human or a mammalian cell, in a pharmaceutically acceptable carrier.
[0124] In an aspect, a disclosed formulation can comprise (i) one or more active agents, (ii) biologically active agents, (iii) one or more pharmaceutically active agents, (iv) one or more immune-based therapeutic agents, (v) one or more clinically approved agents, or (vi) a combination thereof. In an aspect, a disclosed composition can comprise one or more proteasome inhibitors. In an aspect, a disclosed composition can comprise one or more immunosuppressives or immunosuppressive agents. In an aspect, an immunosuppressive agent can be anti-thymocyte globulin (ATG), cyclosporine (CSP), mycophenolate mofetil (MMF), or a combination thereof. In an aspect, a disclosed formulation can comprise an anaplerotic agent (such as, for example, C7 compounds like triheptanoin).
[0125] In an aspect, a disclosed formulation can comprise a RNA therapeutic. A RNA therapeutic can comprise RNA-mediated interference (RNAi) and/or antisense oligonucleotides (ASO). In an aspect, a disclosed RNA therapeutic can be directed at GSY1, GSY2, or both.
(d) Knock-Out Mice
[0126] Disclosed herein is a knock-out mouse for use in characterizing liver-specific pathology of GSD III, wherein the mouse contains a targeted disruption of exons 6-10 of the Agl allele, wherein the disruption results in decreased glycogen debranching enzyme activity that prevents adequate degradation of glycogen, thereby causing glycogen accumulation in the liver, heart, skeletal muscle, and other tissues or a combination thereof in the mouse.
[0127] In an aspect, wherein a liver cell, heart cell, a skeletal muscle cell, a smooth muscle cell, a brain cell, a cell from the central nervous system, a nerve cell, any other cell, or a combination thereof in a disclosed knock-out mouse can experience increased glycogen content. In an aspect, a disclosed knock-out mouse can exhibit an increased level of ALT, AST, and/or CK, elevated disease urinary Glc4 (glucose tetrasaccharide), impaired muscle functions, or a combination thereof.
[0128] Disclosed herein is a cell isolated from a knock-out mouse for use in characterizing liver-specific pathology, heart-specific pathology, skeletal muscle-specific pathology, or a combination thereof in a GSD IIIa mouse, wherein the mouse contains a targeted disruption of exons 6-10 of the Agl allele, wherein the disruption results in decreased glycogen debranching enzyme activity that prevents adequate degradation of glycogen, thereby causing glycogen accumulation in the liver, heart, skeletal muscle, and other tissues or a combination thereof in the mouse. In an aspect, a disclosed cell can be from the liver, heart, or skeletal or other tissues where glycogen has accumulated of a disclosed knock-out mouse.
(e) Plasmids
[0129] Disclosed herein is a plasmid comprising a nucleic acid sequence encoding a CMV enhancer/chicken β-actin (CB) promoter and Pullulanase. In an aspect, a disclosed plasmid comprising a nucleic acid sequence encoding a CB promoter and Pullulanase can comprise the sequence set forth in SEQ ID NO:16 or a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:16 or a sequence having at least 40-59%, at least 50-69%, or at least 80-99% identity to the sequence set forth in SEQ ID NO:16.
[0130] Disclosed herein is a plasmid comprising a nucleic acid sequence encoding a CMV enhancer/chicken β-actin (CB) promoter and Pullulanase.sup.CpG-free. In an aspect, a disclosed plasmid comprising a nucleic acid sequence encoding a CB promoter and Pullulanase.sup.CpG-free can comprise the sequence set forth in SEQ ID NO:17 or a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:17 or a sequence having at least 40-59%, at least 50-69%, or at least 80-99% identity to the sequence set forth in SEQ ID NO:17.
[0131] Disclosed herein is a plasmid comprising a nucleic acid sequence encoding a tandem LSP-CB fusion promoter (Dual) and Pullulanase. In an aspect, a disclosed plasmid comprising a nucleic acid sequence encoding a tandem LSP-CB fusion promoter and Pullulanase can comprise the sequence set forth in SEQ ID NO:18 or a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:18 or a sequence having at least 40-59%, at least 50-69%, or at least 80-99% identity to the sequence set forth in SEQ ID NO:18.
[0132] Disclosed herein is a plasmid comprising a nucleic acid sequence encoding a tandem LSP-CB fusion promoter (Dual) and Pullulanase.sup.CpG-free. In an aspect, a disclosed plasmid comprising a nucleic acid sequence encoding a tandem LSP-CB fusion promoter and Pullulanase.sup.CpG-free can comprise the sequence set forth in SEQ ID NO:19 or a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:19 or a sequence having at least 40-59%, at least 50-69%, or at least 80-99% identity to the sequence set forth in SEQ ID NO:19.
[0133] Disclosed herein is a plasmid comprising a nucleic acid sequence encoding a LSP promoter and Pullulanase. In an aspect, a disclosed plasmid comprising a nucleic acid sequence encoding a LSP promoter and Pullulanase can comprise the sequence set forth in SEQ ID NO:20 or a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:20 or a sequence having at least 40-59%, at least 50-69%, or at least 80-99% identity to the sequence set forth in SEQ ID NO:20.
[0134] Disclosed herein is a plasmid comprising a nucleic acid sequence encoding a LSP promoter and Pullulanase.sup.CpG-free. In an aspect, a disclosed plasmid comprising a nucleic acid sequence encoding a LSP promoter and Pullulanase.sup.CpG-free can comprise the sequence set forth in SEQ ID NO:20 or a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:21 or a sequence having at least 40-59%, at least 50-69%, or at least 80-99% identity to the sequence set forth in SEQ ID NO:21.
(f) Cells
[0135] Disclosed herein are cells comprising a disclosed isolated nucleic acid molecule, a disclosed vector, and/or a disclosed plasmid. Cells are known to the art. In an aspect, a disclosed cell can comprise the plasmid set forth in any one of SEQ ID NO:16-SEQ ID NO:21.
III. Methods for Treating and/or Preventing GSD III Disease Progression
[0136] Disclosed herein is a method of treating and/or preventing GSD III disease progression comprising administering to a subject in need thereof a therapeutically effective amount of a vector comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, and preventing glycogen accumulation and/or degrading accumulated glycogen in the subject. Disclosed herein is a method of treating and/or preventing GSD III disease progression comprising preventing glycogen accumulation and/or degrading accumulated glycogen in a subject in need thereof by administering to the subject a therapeutically effective amount of a vector comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell. Disclosed herein is a method of treating and/or preventing GSD III disease progression comprising administering to a subject in need thereof a therapeutically effective amount of a vector comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, wherein glycogen accumulation is prevented and/or accumulated glycogen is degraded in the subject. Disclosed herein is a method of preventing glycogen accumulation and/or degrading accumulated glycogen comprising administering to a subject having GSD III a therapeutically effective amount of a vector comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell.
[0137] In an aspect, a disclosed encoded polypeptide can cleave α glycosidic bonds in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond at the branching point in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond and the α(1.fwdarw.4) bond in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can be a truncated human glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a bacterial glycogen debranching enzyme or a non-bacterial glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a type I Pullulanase from Bacillus subtilis. In an aspect, a disclosed encoded microbial polypeptide can comprise the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed encoded microbial polypeptide can comprise a sequence having at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed human glycogen debranching enzyme can comprise the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed truncated human glycogen debranching enzyme can comprise a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed nucleic acid sequence can comprise the sequence set forth in SEQ ID NO:04. In an aspect, a disclosed nucleic acid sequence can comprise a sequence having at least 50-69%, at least 70-89%, or at least 90-99% identity to the sequence set forth in SEQ ID NO:04.
[0138] In an aspect, a disclosed nucleic acid sequence can have a coding sequence that is less than about 4.5 kilobases.
[0139] In an aspect, a disclosed vector can be administered via intravenous, intraarterial, intramuscular, intraperitoneal, subcutaneous, intrathecal, intraventricular, or in utero administration. In an aspect, a subject can be a human subject. In an aspect, a disclosed vector can be delivered to the subject's liver, heart, skeletal muscle, smooth muscle, CNS, PNS or a combination thereof.
[0140] In an aspect, a disclosed method can comprise reducing the expression level, activity level, or both of glycogen synthase. In an aspect, a glycogen synthase can be GYS1 (muscle glycogen synthase) or GYS2 (liver glycogen synthase) or both. In an aspect, a disclosed method of reducing the expression level, activity level, or both of glycogen synthase can comprise administering an RNA therapeutic. RNA therapeutics are known to the art and include double stranded RNA-mediated interference (RNAi) and antisense oligonucleotides (ASO). Thus, in an aspect, a disclosed method can comprise administering RNAi or administering ASO or both. In an aspect, a disclosed method can comprise administering RNAi or administering ASO or both directed at GSY1, GSY2, or both.
[0141] In an aspect, a disclosed method can further comprise administering to the subject a therapeutically effective amount of a therapeutic agent. In an aspect, a disclosed method can comprise reducing glycogen levels by administering a glycogen synthase inhibitor (e.g., RNAi, ASO, etc.) to the subject, or modifying the subject's diet, for example, by using cornstarch or another slow release starch to prevent hypoglycemia, or modifying the subject's diet, for example, by consuming a high amount of protein, fat, or other anaplerotic agents (such as, for example, C7 compounds like triheptanoin), exercise or a combination thereof.
[0142] In an aspect, a disclosed method can comprise treating a subject that has developed or is likely to develop neutralizing antibodies (ABs) to the vector, capsid, and/or transgene. In an aspect, treating a subject that has developed or is likely to develop neutralizing antibodies can comprise plasmapheresis and immunosuppression. In an aspect, a disclosed method can comprise using immunosuppression to decrease the T cell, B cell and/or plasma cell population, decrease the innate immune response, inflammatory response and antibody levels in general. In an aspect, a disclosed method can comprise administering an IgG-degrading agent that depletes pre-existing neutralizing antibodies. In an aspect, a disclosed method can comprise administering to the subject IdeS or IdeZ, rapamycin, and/or SVP-Rapamycin. In an aspect, a disclosed IgG-degrading agent is bacteria-derived IdeS or IdeZ.
[0143] Disclosed herein is a method of treating and/or preventing GSD III disease progression comprise administering to a subject in need thereof an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, and preventing glycogen accumulation and/or degrading accumulated glycogen /limit dextrin in the subject. Disclosed herein is a method of treating and/or preventing GSD III disease progression, comprising: preventing glycogen accumulation and/or degrading accumulated glycogen in a subject in need thereof by administering to the subject an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell. Disclosed herein is a method of treating and/or preventing GSD III disease progression, comprising: administering to a subject in need thereof an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell, wherein glycogen accumulation is prevented and/or accumulated glycogen is degraded in the subject. Disclosed herein is a method of preventing glycogen accumulation and/or degrading accumulated glycogen, comprising: administering to a subject having GSD III an isolated nucleic acid molecule comprising a nucleic acid sequence encoding either a microbial polypeptide or a truncated human glycogen debranching enzyme, wherein the nucleic acid sequence is CpG-depleted and codon-optimized for expression in a human or a mammalian cell.
[0144] In an aspect, a disclosed nucleic acid sequence can have a coding sequence that is less than about 4.5 kilobases.
[0145] In an aspect, a disclosed encoded polypeptide can cleave α glycosidic bonds in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond at the branching point in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can cleave the α(1.fwdarw.6) bond and the α(1.fwdarw.4) bond in glycogen, limit dextrin, or both. In an aspect, a disclosed encoded polypeptide can be truncated human glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a bacterial glycogen debranching enzyme or a non-bacterial glycogen debranching enzyme. In an aspect, a disclosed encoded microbial polypeptide can be a type I Pullulanase from Bacillus subtilis. In an aspect, a disclosed encoded microbial polypeptide can comprise the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed encoded microbial polypeptide can comprise a sequence having at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:01. In an aspect, a disclosed human glycogen debranching enzyme can comprise the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed truncated human glycogen debranching enzyme can comprise a sequence having at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% identity to the sequence set forth in SEQ ID NO:02. In an aspect, a disclosed nucleic acid sequence can comprise the sequence set forth in SEQ ID NO:04. In an aspect, a disclosed nucleic acid sequence can comprise a sequence having at least 50-69%, at least 70-89%, or at least 90-99% identity to the sequence set forth in SEQ ID NO:04.
[0146] In an aspect, a disclosed the isolated nucleic acid molecule can be administered intravenously, intramuscularly, intrathecally, intraventricularly, intraarterially, intraperitoneally, subcutaneously, or directly into utero. In an aspect, a subject can be a human subject. In an aspect, a disclosed isolated nucleic acid molecule can be delivered to the subject's liver, heart, skeletal muscle, smooth muscle, CNS, PNS, other tissues, or a combination thereof.
[0147] In an aspect, a disclosed isolated nucleic acid molecule can be present in a vector. In an aspect, a disclosed vector can be a viral vector or a non-viral vector. In an aspect, a disclosed non-viral vector can be a polymer-based vector, a peptide-based vector, a lipid nanoparticle, a solid lipid nanoparticle, or a cationic lipid based vector. In an aspect, a disclosed viral vector can be an adenovirus vector, an adeno-associated virus vector, a herpes simplex virus vector, a retrovirus vector, a lentivirus vector, and alphavirus vector, a flavivirus vector, a rhabdovirus vector, a measles virus vector, a Newcastle disease viral vector, a poxvirus vector, or a picornavirus vector. In an aspect, a disclosed viral vector can be an AAV vector. AAV vectors include, but are not limited to, AAV1, AAV2, AAV3 (including 3a and 3b), AAV4, AAV5, AAV6, AAV7, AAV8, AAVrh8, AAV.hum8, AAV9, AAV10, AAVrh10, AAV11, AAV12, AAV13, AAVrh39, AAVrh43, AAVcy.7 as well as bovine AAV, caprine AAV, canine AAV, equine AAV, ovine AAV, avian AAV, primate AAV, non-primate AAV, and any other virus classified by the International Committee on Taxonomy of Viruses (ICTV) as an AAV. In an aspect, AAV capsids can be chimeras either created by capsid evolution or by rational capsid engineering from the naturally isolated AAV variants to capture desirable serotype features such as enhanced or specific tissue tropism and host immune response escape, including but not limited to AAV-DJ, AAV-HAE1, AAV-HAE2, AAVM41, AAV-1829, AAV2 Y/F, AAV2 T/V, AAV2i8, AAV2.5, AAV9.45, AAV9.61, AAV-B1, AAV-AS, AAV9.45A-String (e.g., AAV9.45-AS), AAV9.45Angiopep, AAV9.47-Angiopep, and AAV9.47-AS., AAV-PHP.B, AAV-PHP.eB, AAV-PHP.S, AAV-F, AAVcc.47, and AAVcc.81. In an aspect, an AAV vector can be AAV9, AAVcc.47, or AAVcc.81. In an aspect, a disclosed AAV vector can be AAV-Rh74 or a related variant (e.g., capsid variants such as RHM4-1).
[0148] In an aspect, a disclosed vector can comprise a ubiquitous promoter operably linked to the isolated nucleic acid molecule, wherein the ubiquitous promoter drives the expression of the polypeptide. In an aspect, a disclosed ubiquitous promoter can be a CB promoter or a CpG-free mCMV/hEF1α promoter.
[0149] In an aspect, a disclosed vector can comprise a tissue-specific promoter operably linked to the isolated nucleic acid molecule. In an aspect, a disclosed tissue-specific promoter can be a liver-specific promoter, a muscle-specific promoter, a neuron-specific promoter, or a combination of two or more disclosed promoters. In an aspect, a liver-specific promoter can be a α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter. In an aspect, a liver specific promoter can comprise about 845-bp and comprise the thyroid hormone-binding globulin promoter sequences (2382 to 13), two copies of α1-microglobulinybikunin enhancer sequences (22,804 through 22,704), and a 71-bp leader sequence as described by Ill CR, et al. (1997). In an aspect, a disclosed liver-specific promoter can comprise the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO:15. In an aspect, a disclosed liver-specific promoter can comprise a sequence having at least 40%-60%, at least 60%-80%, at least 80%-90%, or at least 90%-100% identity to the sequence set forth in SEQ ID NO:15.
[0150] In an aspect, a disclosed vector can comprise an immunotolerant dual promoter comprising a liver-specific promoter and a ubiquitous promoter. In an aspect, a disclosed immunotolerant dual promoter can comprise a α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter and a CB promoter. In an aspect, a disclosed immunotolerant dual promoter can comprise a α1-microglobulin/bikunin enhancer/thyroid hormone-binding globulin promoter and a CpG-free mCMV/hEF1α promoter. In an aspect, a disclosed immunotolerant dual promoter can comprise the sequence set forth in SEQ ID NO:05 or SEQ ID NO:06. In an aspect, a disclosed immunotolerant dual promoter can comprise a sequence having at least 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO:05 or SEQ ID NO:06. In an aspect, a disclosed vector can comprise an isolated nucleic acid molecule comprising one or more promoters, the CpG-depleted and codon-optimized nucleic acid sequence encoding the polypeptide, and a polyadenylation sequence.
[0151] In an aspect, a disclosed method can comprise reducing the expression level, activity level, or both of glycogen synthase. In an aspect, a glycogen synthase can be GYS1 (muscle glycogen synthase) or GYS2 (liver glycogen synthase) or both. In an aspect, a disclosed method of reducing the expression level, activity level, or both of glycogen synthase can comprise administering an RNA therapeutic. RNA therapeutics are known to the art and include double stranded RNA-mediated interference (RNAi) and antisense oligonucleotides (ASO). Thus, in an aspect, a disclosed method can comprise administering RNAi or administering ASO or both. In an aspect, a disclosed method can comprise administering RNAi or administering ASO or both directed at GSY1, GSY2, or both.
[0152] In an aspect, a disclosed method can restore one or more aspects of the glycogen signaling pathway, restore one or more aspects of the glycogenolysis signaling pathway, can restore one or more aspects of the glycogenesis signaling pathway, or any combination thereof. In an aspect, a restoring one or more aspects of a disclosed signaling pathway can comprise restoring the activity and/or functionality of one or more enzymes associated with dysfunction and/or misfunction of the glycogen signaling pathway. In an aspect, restoration can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or any amount of restoration when compared to a pre-existing level such as, for example, a pre-treatment level. In an aspect, the amount of restoration can be 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, 80-90%, or 90-100% more than a pre-existing level such as, for example, a pre-treatment level. In an aspect, restoration can be measured against a control level (e.g., a level in a subject not having a GSD). In an aspect, restoration can be a partial or incomplete restoration. In an aspect, restoration can be complete or near complete restoration such that the level of expression, activity and/or functionality is similar to that of a wild-type or control level.
[0153] In an aspect, a disclosed method can restore one or more aspects of cellular homeostasis. Restoring one or more aspects of cellular homeostasis can comprise correcting cell starvation, normalizing aspects of autophagy pathway (correcting, preventing, and/or ameliorating autophagy, improving, enhancing, restoring, and/or preserving mitochondrial function, improving, enhancing, restoring, and/or preserving organelle function, improving, enhancing, restoring, and/or preserving hypoglycemia, ketosis, liver abnormalities, correcting/redressing neurogenic bladder, gait disturbances, and/or neuropathy, or any combination thereof. In an aspect, restoring one or more aspects of cellular homeostasis can comprise improving, enhancing, restoring, and/or preserving one or more aspects of mitochondrial function.
[0154] In an aspect, restoration can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or any amount of restoration when compared to a pre-existing level such as, for example, a pre-treatment level. In an aspect, the amount of restoration can be 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, 80-90%, or 90-100% more than a pre-existing level such as, for example, a pre-treatment level. In an aspect, restoration can be measured against a control level (e.g., a level in a subject not having a GSD). In an aspect, restoration can be a partial or incomplete restoration. In an aspect, restoration can be complete or near complete restoration such that the level of expression, activity and/or functionality is similar to that of a wild-type or control level.
[0155] In an aspect, a disclosed method can comprise administering to the subject a therapeutically effective amount of a therapeutic agent. In an aspect, a disclosed method can comprise reducing glycogen levels by administering a glycogen synthase inhibitor (e.g., RNAi, ASO, etc.) to the subject, or modifying the subject's diet, for example, by using cornstarch or another slow release starch to prevent hypoglycemia, or modifying the subject's diet, for example, by consuming a high amount of protein, fat, or other anaplerotic agents (such as, for example, C7 compounds like triheptanoin), or a combination thereof.
[0156] In an aspect, a disclosed method can comprise administering one or more immune modulators. In an aspect, a disclosed immune modulator can be methotrexate, rituximab, intravenous gamma globulin, or bortezomib, or a combination thereof. In an aspect, a disclosed immune modulator can be bortezomib or SVP-Rapamycin.
[0157] In an aspect, a disclosed immune modulator such as methotrexate can be administered at a transient low to high-dose. In an aspect, a disclosed immune modulator can be administered at a dose of about 0.1 mg/kg body weight to about 0.6 mg/kg body weight. In an aspect, a disclosed immune modulator can be administered at a dose of about 0.4 mg/kg body weight. In an aspect, a disclosed immune modulator can be administered at about a daily dose of 0.4 mg/kg body weight for 3 to 5 or greater cycles, with up to three days per cycle. In an aspect, a disclosed immune modulator can be administered at about a daily dose of 0.4 mg/kg body weight for a minimum of 3 cycles, with three days per cycle. In an aspect, a disclosed immune modulator can be administered as many times as necessary to achieve a desired clinical effect.
[0158] In an aspect, a disclosed immune modulator can be administered orally about one hour before a disclosed therapeutic agent. In an aspect, a disclosed immune modulator can be administered subcutaneously about 15 minutes before a disclosed therapeutic agent. In an aspect, a disclosed immune modulator can be administered concurrently with a disclosed therapeutic agent.
[0159] In an aspect, a disclosed immune modulator can be administered orally about one hour or a few days before a disclosed isolated nucleic acid molecule, a disclosed vector, a disclosed pharmaceutical formulation, or a combination thereof. In an aspect, a disclosed immune modulator can be administered subcutaneously about 15 minutes before or a few days before a disclosed isolated nucleic acid molecule, a disclosed vector, a disclosed pharmaceutical formulation, or a combination thereof. In an aspect, a disclosed immune modulator can be administered concurrently with a disclosed isolated nucleic acid molecule, a disclosed vector, a disclosed pharmaceutical formulation, or a combination thereof.
[0160] In an aspect, a disclosed method can comprise administering one or more proteasome inhibitors (e.g., bortezomib, carfilzomib, marizomib, ixazomib, and oprozomib). In an aspect, a proteasome inhibitor can be an agent that acts on plasma cells (e.g., daratumumab). In an aspect, an agent that acts on a plasma cell can be melphalan hydrochloride, melphalan, pamidronate disodium, carmustine, carfilzomib, carmustine, cyclophosphamide, daratumumab, doxorubicin hydrochloride liposome, doxorubicin hydrochloride liposome, elotuzumab, melphalan hydrochloride, panobinostat, ixazomib citrate, carfilzomib, lenalidomide, melphalan, melphalan hydrochloride, plerixafor, ixazomib citrate, pamidronate disodium, panobinostat, plerixafor, pomalidomide, pomalidomide, lenalidomide, selinexor, thalidomide, thalidomide, bortezomib, selinexor, zoledronic acid, or zoledronic acid.
[0161] In an aspect, a disclosed method can comprise administering one or more proteasome inhibitors or agents that act on plasma cells prior to administering a disclosed isolated nucleic acid molecule, a disclosed vector, or a disclosed pharmaceutical formulation. In an aspect, a disclosed method can comprise administering one or more proteasome inhibitors or one or more agents that act on plasma cells concurrently with administering a disclosed isolated nucleic acid molecule, a disclosed vector, or a disclosed pharmaceutical formulation. In an aspect, a disclosed method can comprise administering one or more proteasome inhibitors or one or more agents that act on plasma cells subsequent to administering a disclosed isolated nucleic acid molecule, a disclosed vector, or a disclosed pharmaceutical formulation.
[0162] In an aspect, a disclosed method can comprise administering one or more proteasome inhibitors more than 1 time. In an aspect, a disclosed method can comprise administering one or more proteasome inhibitors repeatedly over time.
[0163] In an aspect, a disclosed method can comprise administering one or more immunosuppressive agents. In an aspect, an immunosuppressive agent can be, but are not limited to, azathioprine, methotrexate, sirolimus, anti-thymocyte globulin (ATG), cyclosporine (CSP), mycophenolate mofetil (MMF), steroids, or a combination thereof. In an aspect, a disclosed method can comprise administering one or more immunosuppressive agents more than 1 time. In an aspect, a disclosed method can comprise administering one or more one or more immunosuppressive agents repeatedly over time. In an aspect, a disclosed method can comprise administering a compound that targets or alters antigen presentation or humoral or cell mediated or innate immune responses.
[0164] In an aspect, a disclosed method can comprise administering a compound that exerts a therapeutic effect against B cells and/or a compound that targets or alters antigen presentation or humoral or cell mediated immune response. In an aspect, a disclosed compound can be rituximab, methotrexate, intravenous gamma globulin, anti CD4 antibody, anti CD2, an anti-FcRN antibody, a BTK inhibitor, an anti-IGF1R antibody, a CD19 antibody (e.g., inebilizumab), an anti-IL6 antibody (e.g., tocilizumab), an antibody to CD40, an IL2 mutein, or a combination thereof. Also, Treg infusions as a way to help with immune tolerance, antigen specific Treg cells to AAV.
[0165] In an aspect, a disclosed method can further comprise monitoring the subject for adverse effects. In an aspect, in the absence of adverse effects, the method can further comprise continuing to treat the subject. In an aspect, in the presence of adverse effects, the method can further comprise modifying the treating step. In an aspect of a disclosed method, methods and techniques to monitor a subject can comprise qualitative (or subjective) means as well as quantitative (or objective) means. In an aspect, qualitative means (or subjective means) can comprise a subject's own perspective. For example, a subject can report how he/she is feeling, whether he/she has experienced improvements and/or setbacks, whether he/she has experienced an amelioration or an intensification of one or more symptoms, or a combination thereof. In an aspect, quantitative means (or objective means) can comprise methods and techniques that include, but are not limited to, the following: (i) fluid analysis (e.g., tests of a subject's fluids including but not limited to aqueous humor and vitreous humor, bile, blood, blood serum, breast milk, cerebrospinal fluid, cerumen (earwax), digestive fluids, endolymph and perilymph, female ejaculate, gastric juice, mucus (including nasal drainage and phlegm), peritoneal fluid, pleural fluid, saliva, sebum (skin oil), semen, sweat, synovial fluid, tears, vaginal secretion, vomit, and urine), (ii) imaging (e.g., ordinary x-rays, ultrasonography, radioisotope (nuclear) scanning, computed tomography (CT), magnetic resonance imaging (MRI), positron emission tomography (PET), and angiography), (iii) endoscopy (e.g., laryngoscopy, bronchoscopy, esophagoscopy, gastroscopy, GI endoscopy, coloscopy, cystoscopy, hysteroscopy, arthroscopy, laparoscopy, mediastinoscopy, and thoracoscopy), (iv) analysis of organ activity (e.g., electrocardiography (ECG), electroencephalography (EEG), and pulse oximetry), (v) biopsy (e.g., removal of tissue samples for microscopic evaluation), and (vi) genetic testing.
(a) Agents
Biologically Active Agents
[0166] As used herein, the term “biologically active agent” or “biologic active agent” or “bioactive agent” means an agent that is capable of providing a local or systemic biological, physiological, or therapeutic effect in the biological system to which it is applied. For example, the bioactive agent can act to control infection or inflammation, enhance cell growth and tissue regeneration, control tumor growth, act as an analgesic, promote anti-cell attachment, and enhance bone growth, among other functions. Other suitable bioactive agents can include anti-viral agents, vaccines, hormones, antibodies (including active antibody fragments sFv, Fv, and Fab fragments), aptamers, peptide mimetics, functional nucleic acids, therapeutic proteins, peptides, or nucleic acids. Other bioactive agents include prodrugs, which are agents that are not biologically active when administered but, upon administration to a subject are converted to bioactive agents through metabolism or some other mechanism. Additionally, any of the compositions of the invention can contain combinations of two or more bioactive agents. It is understood that a biologically active agent can be used in connection with administration to various subjects, for example, to humans (i.e., medical administration) or to animals (i.e., veterinary administration). As used herein, the recitation of a biologically active agent inherently encompasses the pharmaceutically acceptable salts thereof.
Pharmaceutically Active Agents
[0167] As used herein, the term “pharmaceutically active agent” includes a “drug” or a “vaccine” and means a molecule, group of molecules, complex or substance administered to an organism for diagnostic, therapeutic, preventative medical, or veterinary purposes. This term includes externally and internally administered topical, localized and systemic human and animal pharmaceuticals, treatments, remedies, nutraceuticals, cosmeceuticals, biologicals, devices, diagnostics and contraceptives, including preparations useful in clinical and veterinary screening, prevention, prophylaxis, healing, wellness, detection, imaging, diagnosis, therapy, surgery, monitoring, cosmetics, prosthetics, forensics and the like. This term may also be used in reference to agriceutical, workplace, military, industrial and environmental therapeutics or remedies comprising selected molecules or selected nucleic acid sequences capable of recognizing cellular receptors, membrane receptors, hormone receptors, therapeutic receptors, microbes, viruses or selected targets comprising or capable of contacting plants, animals and/or humans. This term can also specifically include nucleic acids and compounds comprising nucleic acids that produce a bioactive effect, for example deoxyribonucleic acid (DNA) or ribonucleic acid (RNA). Pharmaceutically active agents include the herein disclosed categories and specific examples. It is not intended that the category be limited by the specific examples. Those of ordinary skill in the art will recognize also numerous other compounds that fall within the categories and that are useful according to the invention. Examples include a radiosensitizer, the combination of a radiosensitizer and a chemotherapeutic, a steroid, a xanthine, a beta-2-agonist bronchodilator, an anti-inflammatory agent, an analgesic agent, a calcium antagonist, an angiotensin-converting enzyme inhibitors, a beta-blocker, a centrally active alpha-agonist, an alpha-1-antagonist, carbonic anhydrase inhibitors, prostaglandin analogs, a combination of an alpha agonist and a beta blocker, a combination of a carbonic anhydrase inhibitor and a beta blocker, an anticholinergic/antispasmodic agent, a vasopressin analogue, an antiarrhythmic agent, an antiparkinsonian agent, an antiangina/antihypertensive agent, an anticoagulant agent, an antiplatelet agent, a sedative, an ansiolytic agent, a peptidic agent, a biopolymeric agent, an antineoplastic agent, a laxative, an antidiarrheal agent, an antimicrobial agent, an antifungal agent, or a vaccine. In a further aspect, the pharmaceutically active agent can be coumarin, albumin, bromolidine, steroids such as betamethasone, dexamethasone, methylprednisolone, prednisolone, prednisone, triamcinolone, budesonide, hydrocortisone, and pharmaceutically acceptable hydrocortisone derivatives; xanthines such as theophylline and doxophylline; beta-2-agonist bronchodilators such as salbutamol, fenterol, clenbuterol, bambuterol, salmeterol, fenoterol; antiinflammatory agents, including antiasthmatic anti-inflammatory agents, antiarthritis antiinflammatory agents, and non-steroidal antiinflammatory agents, examples of which include but are not limited to sulfides, mesalamine, budesonide, salazopyrin, diclofenac, pharmaceutically acceptable diclofenac salts, nimesulide, naproxene, acetominophen, ibuprofen, ketoprofen and piroxicam; analgesic agents such as salicylates; calcium channel blockers such as nifedipine, amlodipine, and nicardipine; angiotensin-converting enzyme inhibitors such as captopril, benazepril hydrochloride, fosinopril sodium, trandolapril, ramipril, lisinopril, enalapril, quinapril hydrochloride, and moexipril hydrochloride; beta-blockers (i.e., beta adrenergic blocking agents) such as sotalol hydrochloride, timolol maleate, timol hemihydrate, levobunolol hydrochloride, esmolol hydrochloride, carteolol, propanolol hydrochloride, betaxolol hydrochloride, penbutolol sulfate, metoprolol tartrate, metoprolol succinate, acebutolol hydrochloride, atenolol, pindolol, and bisoprolol fumarate; centrally active alpha-2-agonists (i.e., alpha adrenergic receptor agonist) such as clonidine, brimonidine tartrate, and apraclonidine hydrochloride; alpha-1-antagonists such as doxazosin and prazosin; anticholinergic/antispasmodic agents such as dicyclomine hydrochloride, scopolamine hydrobromide, glycopyrrolate, clidinium bromide, flavoxate, and oxybutynin; vasopressin analogues such as vasopressin and desmopressin; prostaglandin analogs such as latanoprost, travoprost, and bimatoprost; cholinergics (i.e., acetylcholine receptor agonists) such as pilocarpine hydrochloride and carbachol; glutamate receptor agonists such as the N-methyl D-aspartate receptor agonist memantine; anti-Vascular endothelial growth factor (VEGF) aptamers such as pegaptanib; anti-VEGF antibodies (including but not limited to anti-VEGF-A antibodies) such as ranibizumab and bevacizumab; carbonic anhydrase inhibitors such as methazolamide, brinzolamide, dorzolamide hydrochloride, and acetazolamide; antiarrhythmic agents such as quinidine, lidocaine, tocainide hydrochloride, mexiletine hydrochloride, digoxin, verapamil hydrochloride, propafenone hydrochloride, flecaimide acetate, procainamide hydrochloride, moricizine hydrochloride, and diisopyramide phosphate; antiparkinsonian agents, such as dopamine, L-Dopa/Carbidopa, selegiline, dihydroergocryptine, pergolide, lisuride, apomorphine, and bromocryptine; antiangina agents and antihypertensive agents such as isosorbide mononitrate, isosorbide dinitrate, propranolol, atenolol and verapamil; anticoagulant and antiplatelet agents such as coumadin, warfarin, acetylsalicylic acid, and ticlopidine; sedatives such as benzodiazapines and barbiturates; ansiolytic agents such as lorazepam, bromazepam, and diazepam; peptidic and biopolymeric agents such as calcitonin, leuprolide and other LHRH agonists, hirudin, cyclosporin, insulin, somatostatin, protirelin, interferon, desmopressin, somatotropin, thymopentin, pidotimod, erythropoietin, interleukins, melatonin, granulocyte/macrophage-CSF, and heparin; antineoplastic agents such as etoposide, etoposide phosphate, cyclophosphamide, methotrexate, 5-fluorouracil, vincristine, doxorubicin, cisplatin, hydroxyurea, leucovorin calcium, tamoxifen, flutamide, asparaginase, altretamine, mitotane, and procarbazine hydrochloride; laxatives such as senna concentrate, casanthranol, bisacodyl, and sodium picosulphate; antidiarrheal agents such as difenoxine hydrochloride, loperamide hydrochloride, furazolidone, diphenoxylate hydrochloride, and microorganisms; vaccines such as bacterial and viral vaccines; antimicrobial agents such as penicillins, cephalosporins, and macrolides, antifungal agents such as imidazolic and triazolic derivatives; and nucleic acids such as DNA sequences encoding for biological proteins, and antisense oligonucleotides. It is understood that a pharmaceutically active agent can be used in connection with administration to various subjects, for example, to humans (i.e., medical administration) or to animals (i.e., veterinary administration). As used herein, the recitation of a pharmaceutically active agent inherently encompasses the pharmaceutically acceptable salts thereof.
Anti-Bacterial Agents
[0168] As used herein, anti-bacterial agents are known to the art. For example, the art generally recognizes several categories of anti-bacterial agents including (1) penicillins, (2) cephalosporins, (3) quinolones, (4) aminoglycosides, (5) monobactams, (6) carbapenems, (7) macrolides, and (8) other agents. For example, as used herein, an anti-bacterial agent can comprise Afenide, Amikacin, Amoxicillin, Ampicillin, Arsphenamine, Augmentin, Azithromycin, Azlocillin, Aztreonam, Bacampicillin, Bacitracin, Balofloxacin, Besifloxacin, Capreomycin, Carbacephem (loracarbef), Carbenicillin, Cefacetrile (cephacetrile), Cefaclomezine, Cefaclor, Cefadroxil (cefadroxyl), Cefalexin (cephalexin), Cefaloglycin (cephaloglycin), Cefalonium (cephalonium), Cefaloram, Cefaloridine (cephaloradine), Cefalotin (cephalothin), Cefamandole, Cefaparole, Cefapirin (cephapirin), Cefatrizine, Cefazaflur, Cefazedone, Cefazolin (cephazolin), Cefcanel, Cefcapene, Cefclidine, Cefdaloxime, Cefdinir, Cefditoren, Cefedrolor, Cefempidone, Cefepime, Cefetamet, Cefetrizole, Cefivitril, Cefixime, Cefluprenam, Cefmatilen, Cefmenoxime, Cefmepidium, Cefmetazole, Cefodizime, Cefonicid, Cefoperazone, Cefoselis, Cefotaxime, Cefotetan, Cefovecin, Cefoxazole, Cefoxitin, Cefozopran, Cefpimizole, Cefpirome, Cefpodoxime, Cefprozil (cefproxil), Cefquinome, Cefradine (cephradine), Cefrotil, Cefroxadine, Cefsumide, Ceftaroline, Ceftazidime, Ceftazidime/Avibactam, Cefteram, Ceftezole, Ceftibuten, Ceftiofur, Ceftiolene, Ceftioxide, Ceftizoxime, Ceftobiprole, Ceftriaxone, Cefuracetime, Cefuroxime, Cefuzonam, Cephalexin, Chloramphenicol, Chlorhexidine, Ciprofloxacin, Clarithromycin, Clavulanic Acid, Clinafloxacin, Clindamycin, Cloxacillin, Colimycin, Colistimethate, Colistin, Crysticillin, Cycloserine 2, Demeclocycline, Dicloxacillin, Dirithromycin, Doripenem, Doxycycline, Efprozil, Enoxacin, Ertapenem, Erythromycin, Ethambutol, Flucloxacillin, Flumequine, Fosfomycin, Furazolidone, Gatifloxacin, Geldanamycin, Gemifloxacin, Gentamicin, Glycopeptides, Grepafloxacin, Herbimycin, Imipenem, Isoniazid, Kanamycin, Levofloxacin, Lincomycin, Linezolid, Lipoglycopeptides, Lomefloxacin, Meropenem, Meticillin, Metronidazole, Mezlocillin, Minocycline, Mitomycin, Moxifloxacin, Mupirocin, Nadifloxacin, Nafcillin, Nalidixic Acid, Neomycin, Netilmicin, Nitrofurantoin, Norfloxacin, Ofloxacin, Oxacillin, Oxazolidinones, Oxolinic Acid, Oxytetracycline, Oxytetracycline, Paromomycin, Pazufloxacin, Pefloxacin, Penicillin G, Penicillin V, Pipemidic Acid, Piperacillin, Piromidic Acid, Pivampicillin, Pivmecillinam, Platensimycin, Polymyxin B, Pristinamycin, Prontosil, Prulifloxacin, Pvampicillin, Pyrazinamide, Quinupristin/dalfopristin, Rifabutin, Rifalazil, Rifampin, Rifamycin, Rifapentine, Rosoxacin, Roxithromycin, Rufloxacin, Sitafloxacin, Sparfloxacin, Spectinomycin, Spiramycin, Streptomycin, Sulbactam, Sulfacetamide, Sulfamethizole, Sulfamethoxazole, Sulfanilimide, Sulfisoxazole, Sulphonamides, Sultamicillin, Teicoplanin, Telavancin, Telithromycin, Temafloxacin, Tetracycline, Thiamphenicol, Ticarcillin, Tigecycline, Tinidazole, Tobramycin, Tosufloxacin, Trimethoprim, Trimethoprim-Sulfamethoxazole, Troleandomycin, Trovafloxacin, Tuberactinomycin, Vancomycin, Viomycin, or pharmaceutically acceptable salts thereof (e.g., such as, for example, chloride, bromide, iodide, and periodate), or a combination thereof. As used herein, the recitation of an anti-bacterial agent inherently encompasses the pharmaceutically acceptable salts thereof.
Anti-Fungal Agents
[0169] Anti-fungal agents are known to the art. The art generally recognizes several categories of anti-fungal agents including (1) azoles (imidazoles), (2) antimetabolites, (3) allylamines, (4) morpholine, (5) glucan synthesis inhibitors (echinocandins), (6) polyenes, (7) benoxaaborale; (8) other antifungal/onychomycosis agents, and (9) new classes of antifungal/onychomycosis agents. For example, as used herein, an anti-fungal agent can comprise Abafungin, Albaconazole, Amorolfin, Amphotericin B, Anidulafungin, Bifonazole, Butenafine, Butoconazole, Candicidin, Caspofungin, Ciclopirox, Clotrimazole, Econazole, Fenticonazole, Filipin, Fluconazole, Flucytosine, Griseofulvin, Haloprogin, Hamycin, Isavuconazole, Isoconazole, Itraconazole, Ketoconazole, Micafungin, Miconazole, Naftifine, Natamycin, Nystatin, Omoconazole, Oxiconazole, Polygodial, Posaconazole, Ravuconazole, Rimocidin, Sertaconazole, Sulconazole, Terbinafine, Terconazole, Tioconazole, Tolnaftate, Undecylenic Acid, Voriconazole, or pharmaceutically acceptable salts thereof, or a combination thereof. In an aspect, an anti-fungal agent can be an azole. Azoles include, but are not limited to, the following: clotrimazole, econazole, fluconazole, itraconazole, ketoconazole, miconazole, oxiconazole, sulconazole, and voriconazole. As used herein, the recitation of an anti-fungal agent inherently encompasses the pharmaceutically acceptable salts thereof.
Anti-Viral Agents
[0170] Anti-viral agents are known to the art. As used herein, for example, an anti-viral can comprise Abacavir, Acyclovir (Aciclovir), Adefovir, Amantadine, Ampligen, Amprenavir (Agenerase), Umifenovir (Arbidol), Atazanavir, Atripla, Baloxavir marboxil (Xofluza), Biktarvy, Boceprevir, Bulevirtide, Cidofovir, Cobicistat (Tybost), Combivir, Daclatasvir (Daklinza), Darunavir, Delavirdine, Descovy, Didanosine, Docosanol, Dolutegravir, Doravirine (Pifeltro), Edoxudine, Efavirenz, Elvitegravir, Emtricitabine, Enfuvirtide, Entecavir, Etravirine (Intelence), Famciclovir, Fomivirsen, Fosamprenavir, Foscarnet, Ganciclovir (Cytovene), Ibacitabine, Ibalizumab (Trogarzo), Idoxuridine, Imiquimod, Imunovir, Indinavir, Lamivudine, Letermovir (Prevymis), Lopinavir, Loviride, Maraviroc, Methisazone, Moroxydine, Nelfinavir, Nevirapine, Nexavir (formerly Kutapressin), Nitazoxanide, Norvir, Oseltamivir (Tamiflu), Penciclovir, Peramivir, Penciclovir, Peramivir (Rapivab), Pleconaril, Podophyllotoxin, Raltegravir, Remdesivir, Ribavirin, Rilpivirine (Edurant), Rilpivirine, Rimantadine, Ritonavir, Saquinavir, Simeprevir (Olysio), Sofosbuvir, Stavudine, Taribavirin (Viramidine), Telaprevir, Telbivudine (Tyzeka), Tenofovir alafenamide, Tenofovir disoproxil, Tenofovir, Tipranavir, Trifluridine, Trizivir, Tromantadine, Truvada, Umifenovirk, Valaciclovir, Valganciclovir (Valtrex), Vicriviroc, Vidarabine, Zalcitabine, Zanamivir (Relenza), Zidovudine, and combinations thereof. As used herein, the recitation of any anti-viral agent inherently encompasses the pharmaceutically acceptable salts thereof.
Corticosteroids
[0171] Corticosteroids are well-known in the art. Corticosteroids mimic the effects of hormones that the body produces naturally in your adrenal glands. Corticosteroids can suppress inflammation and can reduce the signs and symptoms of inflammatory conditions (e.g., arthritis and asthma). Corticosteroids can also suppress the immune system. Corticosteroids can act on a number of different cells (e.g., mast cells, neutrophils, macrophages and lymphocytes) and a number of different mediators (e.g., histamine, leukotriene, and cytokine subtypes).
[0172] Steroids include, but are not limited to, the following: triamcinolone and its derivatives (e.g., diacetate, hexacetonide, and acetonide), betamethasone and its derivatives (e.g., dipropionate, benzoate, sodium phosphate, acetate, and valerate), dexamethasone and its derivatives (e.g., dipropionate and valerate), flunisolide, prednisone and its derivatives (e.g., acetate), prednisolone and its derivatives (e.g., acetate, sodium phosphate, and tebutate), methylprednisolone and its derivatives (e.g., acetate and sodium succinate), fluocinolone and its derivatives (e.g., acetonide), diflorasone and its derivatives (e.g., diacetate), halcinonide, desoximetasone (desoxymethasone), diflucortolone and its derivatives (e.g., valerate), flucloronide (fluclorolone acetonide), fluocinonide, fluocortolone, fluprednidene and its derivatives (e.g., acetate), flurandrenolide (flurandrenolone), clobetasol and its derivatives (e.g., propionate), clobetasone and its derivatives (e.g., butyrate), alclometasone, flumethasone and its derivatives (e.g., pivalate), fluocortolone and its derivatives (e.g., hexanoate), amcinonide, beclometasone and its derivatives (e.g., dipropionate), fluticasone and its derivatives (e.g., propionate), difluprednate, prednicarbate, flurandrenolide, mometasone, and desonide. As used herein, the recitation of a corticosteroid inherently encompasses the pharmaceutically acceptable salts thereof.
Analgesics
[0173] The compositions of the present disclosure can also be used in combination therapies with opioids and other analgesics, including narcotic analgesics, Mu receptor antagonists, Kappa receptor antagonists, non-narcotic (i.e., non-addictive) analgesics, monoamine uptake inhibitors, adenosine regulating agents, cannabinoid derivatives, Substance P antagonists, neurokinin-1 receptor antagonists and sodium channel blockers, among others. Preferred combination therapies comprise a composition useful in methods described herein with one or more compounds selected from aceclofenac, acemetacin, .alpha.-acetamidocaproic acid, acetaminophen, acetaminosalol, acetanilide, acetylsalicylic acid (aspirin), S-adenosylmethionine, alclofenac, alfentanil, allylprodine, alminoprofen, aloxiprin, alphaprodine, aluminum bis (acetylsalicylate), amfenac, aminochlorthenoxazin, 3-amino-4-hydroxybutyric acid, 2-atnino-4-picoline, aminopropylon, aminopyrine, amixetrine, ammonium salicylate, ampiroxicam, amtolmetin guacil, anileridine, antipyrine, antipyrine salicylate, antrafenine, apazone, bendazac, benorylate, benoxaprofen, benzpiperylon, benzydamine, benzylmorphine, bermoprofen, bezitramide, .alpha.-bisabolol, bromfenac, p-bromoacetanilide, 5-bromosalicylic acid acetate, bromosaligenin, bucetin, bucloxic acid, bucolome, bufexamac, bumadizon, buprenorphine, butacetin, butibufen, butophanol, calcium acetylsalicylate, carbamazepine, carbiphene, carprofen, carsalam, chlorobutanol, chlorthenoxazin, choline salicylate, cinchophen, cinmetacin, ciramadol, clidanac, clometacin, clonitazene, clonixin, clopirac, clove, codeine, codeine methyl bromide, codeine phosphate, codeine sulfate, cropropamide, crotethamide, desomorphine, dexoxadrol, dextromoramide, dezocine, diampromide, diclofenac sodium, difenamizole, difenpiramide, diflunisal, dihydrocodeine, dihydrocodeinone enol acetate, dihydromorphine, dihydroxyalutninum acetylsalicylate, dimenoxadol, dimepheptanol, dimethylthiambutene, dioxaphetyl butyrate, dipipanone, diprocetyl, dipyrone, ditazol, droxicam, emorfazone, enfenamic acid, epirizole, eptazocine, etersalate, ethenzamide, ethoheptazine, ethoxazene, ethylmethylthiambutene, ethylmorphine, etodolac, etofenamate, etonitazene, eugenol, felbinac, fenbufen, fenclozic acid, fendosal, fenoprofen, fentanyl, fentiazac, fepradinol, feprazone, floctafenine, flufenamic acid, flunoxaprofen, fluoresone, flupirtine, fluproquazone, flurbiprofen, fosfosal, gentisic acid, glafenine, glucametacin, glycol salicylate, guaiazulene, hydrocodone, hydromorphone, hydroxypethidine, ibufenac, ibuprofen, ibuproxam, imidazole salicylate, indomethacin, indoprofen, isofezolac, isoladol, isomethadone, isonixin, isoxepac, isoxicam, ketobemidone, ketoprofen, ketorolac, p-lactophenetide, lefetamine, levorphanol, lofentanil, lonazolac, lomoxicam, loxoprofen, lysine acetylsalicylate, magnesium acetylsalicylate, meclofenamic acid, mefenamic acid, meperidine, meptazinol, mesalamine, metazocine, methadone hydrochloride, methotrimeprazine, metiazinic acid, metofoline, metopon, mofebutazone, mofezolac, morazone, morphine, morphine hydrochloride, morphine sulfate, morpholine salicylate, myrophine, nabumetone, nalbuphine, 1-naphthyl salicylate, naproxen, narceine, nefopam, nicomorphine, nifenazone, niflumic acid, nimesulide, 5′-nitro-2′-propoxyacetanilide, norlevorphanol, normethadone, normorphine, norpipanone, olsalazine, opium, oxaceprol, oxametacine, oxaprozin, oxycodone, oxymorphone, oxyphenbutazone, papaveretum, paranyline, parsalmide, pentazocine, perisoxal, phenacetin, phenadoxone, phenazocine, phenazopyridine hydrochloride, phenocoll, phenoperidine, phenopyrazone, phenyl acetylsalicylate, phenylbutazone, phenyl salicylate, phenyramidol, piketoprofen, piminodine, pipebuzone, piperylone, piprofen, pirazolac, piritramide, piroxicam, pranoprofen, proglumetacin, proheptazine, promedol, propacetamol, propiram, propoxyphene, propyphenazone, proquazone, protizinic acid, ramifenazone, remifentanil, rimazolium metilsulfate, salacetamide, salicin, salicylamide, salicylamide o-acetic acid, salicyl sulfuric acid, salsalte, salverine, simetride, sodium salicylate, sufentanil, sulfasalazine, sulindac, superoxide dismutase, suprofen, suxibuzone, talniflumate, tenidap, tenoxicam, terofenamate, tetrandrine, thiazolinobutazone, tiaprofenic acid, tiaramide, tilidine, tinoridine, tolfenamic acid, tolmetin, tramadol, tropesin, viminol, xenbucin, ximoprofen, zaltoprofen and zomepirac. Analgesics are well known in the art. See, for example, The Merck Index, 12th Edition (1996), Therapeutic Category and Biological Activity Index, and the lists provided under “Analgesic”, “Anti-inflammatory” and “Antipyretic”. As used herein, the recitation of an analgesic inherently encompasses the pharmaceutically acceptable salts thereof.
Immunostimulants
[0174] The term “immunostimulant” is used herein to describe a substance which evokes, increases, and/or prolongs an immune response to an antigen. Immunomodulatory agents modulate the immune system, and, as used herein, immunostimulants are also referred to as immunomodulatory agents, where it is understood that the desired modulation is to stimulate the immune system. There are two main categories of immunostimulants, specific and non-specific. Specific immunostimulants provide antigenic specificity in immune response, such as vaccines or any antigen, and non-specific immunostimulants act irrespective of antigenic specificity to augment immune response of other antigen or stimulate components of the immune system without antigenic specificity, such as adjuvants and non-specific immunostimulators. Immunostimulants can include, but are not limited to, levamisole, thalidomide, erythema nodosum leprosum, BCG, cytokines such as interleukins or interferons, including recombinant cytokines and interleukin 2 (aldeslukin), 3D-MPL, QS21, CpG ODN 7909, miltefosine, anti-PD-1 or PD-1 targeting drugs, and acid (DCA, a macrophage stimulator), imiquimod and resiquimod (which activate immune cells through the toll-like receptor 7), chlorooxygen compounds such as tetrachlorodecaoxide (TCDO), agonistic CD40 antibodies, soluble CD40L, 4-1BB:4-1BBL agonists, OX40 agonists, TLR agonists, moieties that deplete regulatory T cells, arabinitol-ceramide, glycerol-ceramide, 6-deoxy and 6-sulfono-myo-insitolceramide, iNKT agonists, and TLR agonists. As used herein, the recitation of an immunostimulant inherently encompasses the pharmaceutically acceptable salts thereof.
Immune-Based Product
[0175] As used herein, immune-based products include, but are not limited to, toll-like receptors modulators such as tlr1, tlr2, tlr3, tlr4, tlr5, tlr6, tlr7, tlr8, tlr9, tlr10, tlr11, tlr12, and tlr13; programmed cell death protein 1 (Pd-1) modulators; programmed death-ligand 1 (Pd-L1) modulators; IL-15 agonists; DermaVir; interleukin-7; plaquenil (hydroxychloroquine); proleukin (aldesleukin, IL-2); interferon alfa; interferon alfa-2b; interferon alfa-n3; pegylated interferon alfa; interferon gamma; hydroxyurea; mycophenolate mofetil (MPA) and its ester derivative mycophenolate mofetil (MMF); ribavirin; rintatolimod, polymer polyethyleneimine (PEI); gepon; rintatolimod; IL-12; WF-10; VGV-1; MOR-22; BMS-936559; CYT-107, interleukin-15/Fc fusion protein, normferon, peginterferon alfa-2a, peginterferon alfa-2b, recombinant interleukin-15, RPI-MN, GS-9620, and IR-103. As used herein, the recitation of an immune-based product inherently encompasses the pharmaceutically acceptable salts thereof.
IV. Kits
[0176] Disclosed herein is a kit comprising a disclosed isolated nucleic acid molecule, a disclosed vector, a disclosed pharmaceutical formulation, or a combination thereof. In an aspect, a kit can comprise a disclosed isolated nucleic acid molecule, a disclosed vector, a disclosed pharmaceutical formulation, or a combination thereof, and one or more agents. “Agents” are known to the art and are described supra. In an aspect, the one or more agents can treat, prevent, inhibit, and/or ameliorate one or more comorbidities in a subject. In an aspect, one or more active agents can treat, inhibit, prevent, and/or ameliorate a GSD III symptom or a GSD III related complication.
[0177] In an aspect, a disclosed kit can comprise at least two components constituting the kit. Together, the components constitute a functional unit for a given purpose (such as, for example, treating a subject diagnosed with or suspected of having GSD III). Individual member components may be physically packaged together or separately. For example, a kit comprising an instruction for using the kit may or may not physically include the instruction with other individual member components. Instead, the instruction can be supplied as a separate member component, either in a paper form or an electronic form which may be supplied on computer readable memory device or downloaded from an internet website, or as recorded presentation. In an aspect, a kit for use in a disclosed method can comprise one or more containers holding a disclosed isolated nucleic acid molecule, a disclosed vector, a disclosed pharmaceutical formulation, or a combination thereof, and a label or package insert with instructions for use. In an aspect, suitable containers include, for example, bottles, vials, syringes, blister pack, etc. The containers can be formed from a variety of materials such as glass or plastic. The container can hold a disclosed isolated nucleic acid molecule, a disclosed vector, a disclosed pharmaceutical formulation, or a combination thereof, and can have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The label or package insert can indicate that a disclosed isolated nucleic acid molecule, a disclosed vector, a disclosed pharmaceutical formulation, or a combination thereof can be used for treating, preventing, inhibiting, and/or ameliorating GSD III or complications and/or symptoms associated with GSD III. A kit can comprise additional components necessary for administration such as, for example, other buffers, diluents, filters, needles, and syringes.
EXAMPLES
[0178] Thus, there is an urgent need for a viable GSD III mouse model as well as viable therapies to treat and/or prevent GSD III. The Examples that follow are illustrative of specific embodiments of the invention, and various uses thereof. They set forth for explanatory purposes only and are not to be taken as limiting the invention.
Example 1. Generation of a GSD IIIa Knockout Mouse Model
[0179] A knockout mouse model of GSD IIIa (Agl-KO) was generated by deleting the exons 6-10 from the Agl gene. (
[0180] Using this model, an innovative gene therapy approach with AAV vectors expressing a small bacterial GDE (Pullulanase derived from Bacillus subtilis) was developed. [35] Human GDE encoded by the AGL gene is a bifunctional enzyme that breaks down glycogen via two separate enzyme activities, amylo-α-1,6-glucosidase and 4-α-D-glucanotransferase. [36-38] Unlike human GDE, Pullulanase encoded by the amyX gene has only the amylo-α-1,6-glucosidase activity and can directly cleave the α(1.fwdarw.6) bonds at the branching points in limit dextrin. [39] Intravenous injection of an AAV9 vector containing a 2.2-kb codon-optimized Pullulanase cDNA driven by the CB promoter (AAV-CB-Pull) into infant (two weeks old) GSD IIIa mice significantly decreased (by 75-80%) glycogen accumulation in the heart and skeletal muscles (not in the liver) and significantly improved muscle function 10 weeks after injection. [35] AAV treatment also reduced the concentrations of urinary Glc4, a breakdown product of glycogen being recognized as a disease biomarker for GSD III. [1, 35, 40, 41] Subsequent treatment with an AAV8 vector (AAV-LSP-Pull) containing an immunotolerant liver-specific promoter (LSP) further reduced liver glycogen content by 75%, significantly decreased liver size, and completely reversed hepatic fibrosis. [35] However, when administered in adult GSD IIIa mice, the AAV-CB-Pull vector elicited strong transgene-related cytotoxic T lymphocyte (CTL) response, resulting in transient Pullulanase expression the liver, heart, and skeletal muscle. When administered in adult GSD IIIa mice, however, the AAV-LSP-Pull did not provoke anti-Pullulanase CTL response, and instead, achieved long-term correction of glycogen storage in the liver, but not in the muscle.
Example 2. Novel Dual Promoter Prevents Transgene-Specific CTL Responses and Allows Pullulanase Expression in All Affected Tissues
[0181] If transgene-induced immune responses can be prevented, then AAV-mediated gene therapy with Pullulanase is a possible treatment for GSD III. To examine whether a dual promoter having both a LSP promoter and the ubiquitous CB promoter would retain the ability of the LSP to induce immunotolerance to Pullulanase and enable therapeutic Pullulanase expression in all affected tissues by the CB in GSD IIIa mice, 3 different AAV vectors were constructed.
[0182] As shown in
[0183] To evaluate bio-distributions of AAV vectors, AAV genome copy numbers were quantified using real-time PCR in the liver, heart, and quadriceps of the AAV-treated GSD IIIa mice. At two weeks post injection, all treatments resulted in detectable AAV vector genomes in the liver, heart, and quadriceps but the highest number of vector genome were observed in the AAV-Dual-Pull treated tissues (
[0184] Consistent with the Pullulanase activity results, at two weeks post vector injection, all AAV treatments dramatically reduced liver glycogen accumulation to near wild-type (WT) level (
[0185] IV injection of the AAV9-Dual-Pull vector in adult GSD IIIa mice effectively prevented a Pullulanase-induced CTL response two weeks after AAV treatment. The data showed that mice having received AAV-LSP-Pull and AAV-Dual-Pull effectively prevented a Pullulanase-related CTL response in GSD IIIa mice. As
Example 3. AAV-Dual-Pull Enabled Long-Term Pullulanase Expression and Glycogen Clearance in All Affected Tissues
[0186] At ten weeks post vector injection, glycogen content in liver was slightly increased in the AAV-LSP-Pull treated mice and moderately increased in the AAV-Dual-Pull treated mice from the 2-week treatment time point but still remained significantly reduced (−78% by AAV-LSP-Pull and −60% by AAV-Dual-Pull) compared to that of the UT mice (
[0187] At ten weeks, AAV vector genomes were significantly decreased in the liver, heart, and quadriceps treated with AAV-CB-Pull or with co-administration of AAV-LSP-Pull and AAV-CB-Pull, but remained high in the AAV-Dual-Pull treated tissues. The AAV-LSP-Pull treatment showed relatively high vector genomes in the liver but not in the muscles (
[0188] PAS staining in various tissue sections showed that the AAV-Dual-Pull treatment markedly cleared glycogen storage in the diaphragm, soleus muscle, and kidney after ten weeks of AAV treatment (
Example 4. Treatment with AAV9-Dual-Pull Significantly Reduced Plasma Liver and Muscle Enzyme Activities and Ameliorated Hepatic Abnormalities and Reversed Liver Fibrosis
[0189] IV injection of the AAV9-Dual-Pull vector in adult GSD IIIa mice significantly improved liver function.
Example 5. Treatment with AAV9-Dual-Pull Improved Muscle Function in GSD IIIa Mice
[0190] IV injection of the AAV9-Dual-Pull vector in adult GSD IIIa mice effectively significantly improved muscle function. Ten weeks after injection, a treadmill test was performed to evaluate exercise tolerance in the AAV-treated and untreated mice. Only those mice receiving AAV-Dual-Pull demonstrated a significant improvement in muscle function.
Example 6. Depletion of CpG Motifs from Pullulanase Open-Reading Frame (ORF) Does Not Affect Pullulanase Expression and Glycogen Clearance in GSD IIIa Mice
[0191] Unmethylated CpG motifs within an AAV vector genome can trigger robust innate immune responses and thereby provoke CTL responses to both AAV capsid and transgene product through the activation of the Toll-like receptor 9 (TLR9)-MyD88 signaling pathway. [59-62] Depletion of all CpG sequences from a LacZ transgene expression cassette in a highly immunogenic AAVrh32.33 vector remarkably reduced the CD8+ T cell responses to the AAV capsid and transgene product (β-gal protein) in mice. [62] In the clinic, AAV vectors containing CpG-depleted human factor IX (hFIX) ORFs have been successfully used to reduce capsid-specific CTL responses for long-term hFIX expression in patients with hemophilia B. [58] Depletion of CpG motifs from the Pullulanase ORF along with the use of an immunotolerant dual promoter is expected to prevent CTL immune responses to the AAV capsids and therapeutic Pullulanase in patients with GSD III.
[0192] A CpG-free Pullulanase ORF (Pull.sup.CpG-free) was cloned into the AAV-Dual-Pull (LSP-CB) vector to replace the unmodified ORF (Pull), thereby generating the new AAV-Dual-Pull.sup.CpG-free vector plasmid. Both vectors were packaged in AAV9 and intravenously injected (via tail vein) into 3-month-old GSD IIIa mice at a dose of 5×10.sup.12 vg/kg. Four (4) weeks after vector injection, mice were euthanized. Tissues (including liver, heart, diaphragm, quadriceps, gastrocnemius, kidney, and the brain) were collected. Fresh tissue specimens are immediately frozen on dry ice and stored at −80° C. until used for biochemical analyses or fixed immediately for histology and IHC. [35] The CpG-free ORF (AAV9-Dual-Pull.sup.CpG-free) resulted in higher Pullulanase activities (
Example 7. An AAV9 Vector Containing a CpG-Free Pullulanase ORF under the LSP Promoter Effectively Reduced Glycogen Content in Liver of GSD IIIa Dogs in a Dose-Dependent Manner
[0193] For proof-of-concept, two 10.5-month-old GSD IIIa dogs were intravenously injected with an AAV9 vector carrying a CpG-depleted cassette (AAV-LSP-Pull.sup.CpG-free) at two different doses:
[0194] one with 5×10.sup.12 vg/kg (low dose) and the other with 2.5×10.sup.13 vg/kg (high dose). Liver and muscle biopsy were performed at pre-treatment (baseline) and two weeks post-treatment. Two weeks after AAV treatment, a dose-dependent high AAV transduction was observed in both liver and muscle (
Example 8. Effect of CpG Depletion from the Pullulanase ORF Under Control of Either a CpG-Free MCMV/HEF1α (EF1α) Promoter or a CpG-Depleted LSP-EF1α Dual Promoter on Pullulanase-Specific Immune Response
[0195] The PullCpG-free ORF is cloned into the AAV-EF1α-Pull and AAV-Dual-Pull (LSP-EF1a) vectors to replace the unmodified ORF, thereby generating the new AAV-EF1α-PullCpG-free and AAV-Dual-PullCpG-free vector plasmids. Here, four additional AAV vectors are packaged in AAV9 and intravenously injected (via tail vein) into 3-month-old GSD IIIa mice at a dose of 1×10.sup.13 vg/kg. Table 1 sets forth the four experimental groups plus the vehicle for this experiment, which enables a comparison of the PullCpG-free ORF and the unmodified Pull ORF for transgene-related CTL responses under the control of either the EF1α promoter (Group 2 vs. Group 3) or the LSP-EF1α dual promoter (Dual) (Group 4 vs. Group 5).
TABLE-US-00008 TABLE 1 Dose Group Animal Age Treatment Capsid (vg/kg) 1 Mice 3 mo Vehicle x x 2 Mice 3 mo AAV-EF1α-Pull AAV9 1 × 10.sup.13 3 Mice 3 mo AAV-EF1α-Pull.sup.CpG-free AAV9 1 × 10.sup.13 4 Mice 3 mo AAV-Dual-Pull AAV9 1 × 10.sup.13 5 Mice 3 mo AAV-Dual-Pull.sup.CpG-free AAV9 1 × 10.sup.13
[0196] Four (4) weeks after vector injection, mice are euthanized. Blood and tissues (including liver, heart, diaphragm, quadriceps, gastrocnemius, kidney, and the brain) are collected. Fresh tissue specimens are immediately frozen on dry ice and stored at −80° C. until used for biochemical analyses, or fixed immediately for histology and IHC. [35] Splenocytes are isolated from fresh individual spleens by mashing them through a cell strainer, lysing red blood, washing with phosphate-buffered saline, and cells are frozen and stored in liquid nitrogen until use.
Example 9. Effect of CpG Depletion on Pullulanase-Specific CTL Responses in Splenocyte Obtained from AAV-CB-Pull Treated Mice
[0197] Using a Pullulanase overlapping peptide library, a map of the Pullulanase-specific T cell epitopes in GSD IIIa mice is created. Using the splenocytes isolated from the AAV-CB-Pull treated GSD IIIa mice [71, 72], Pullulanase-specific immunodominant T cell epitopes are identified by interferon gamma (IFNγ) ELISpot. This overlapping peptide library was designed with 15 amino acid peptides overlapping by 10 amino acids (offset by 5) and 142 peptides in total were obtained from GenScript (Piscataway, N.J.). Then, using the splenocytes isolated from the GSD IIIa mice treated with different AAV vectors [47, 48, 71-73] (including those AAV vectors described in Tables 2 and 3), the Pullulanase-specific CTL responses are again identified by IFNγ ELISpot. To confirm the ELISpot results, immunohistochemical staining of CD4.sup.+, CD8.sup.+ T cells will be performed with tissue sections (as performed in
[0198] Moreover, biochemical analyses are performed to examine the correction of biochemical abnormalities. These analyses include measuring Pullulanase activity, and determining protein expression (Western blot), glycogen content, and AAV tissue bio-distribution (using real time-PCR) for at least the liver, heart, diaphragm, quadriceps, gastrocnemius, kidney, and the brain tissues. To ascertain the level of glycogen in various tissues, PAS staining is done. To ascertain the level of fibrosis in various tissues (especially the liver), Masson's trichrome staining is done. To evaluate histology, H&E staining of tissue is done. [16, 35, 69, 74].
Example 10. Cross-Species Evolution of AAV9 Variable Regions Yields Capsid Variants with Enhanced Skeletal Muscle Transduction
[0199] Current AAV serotypes will transduce muscle and liver, especially AAV9. However, the high dosing regimens of AAV9 that are required to transduce skeletal muscles can lead to multiple adverse reactions. These adverse reaction (including hepatotoxicity or liver failure) subsequently eliminate the transgene from the liver. [29, 30] This issue underscores the need for the development of more potent vectors. One approach to address this need is to alter natural AAV capsids through protein engineering and evolutionary strategies and improve the vector tropism to skeletal muscle. Traditional approaches to engineer AAV have relied on rational domain swapping, DNA shuffling, or peptide insertions. These traditional approaches, however, they are often plagued by disparate results between animal models and human patients. Thus, a substantial challenge to GSD III gene therapy development is that newly engineered AAV vectors must show enhanced potency for muscle tissue transduction in multiple animal species to facilitate preclinical-to-clinical translation.
[0200] An iterative, structure-guided approach to evolve natural AAV isolates across multiple animal species so to improve properties suitable for clinical translation has emerged. [63] To isolate novel AAV9 capsid variants with enhanced skeletal muscle transduction, two libraries from the AAV9 parental serotype, were synthesized and intravenously injected into mice. The first library was from within variable region 4 (VR4, red) and the second library was from within variable region 8 (VR8, blue). (
Example 11. Transduction Efficiencies and Glycogen Clearance Capacities of CcAAVs (AAVcc.47 and AAVcc.81) in GSD IIIa Mice
[0201] The optimal AAV-Dual-PullCpG-free cassette (as determined from the Examples presented herein) is packaged into AAV9, AAVcc.47, and AAVcc.81 capsids according to Table 2. The resulting capsids are intravenously injected into GSD IIIa mice (tail vein) at the same dose (1×10.sup.13 vg/kg). Four weeks after administration, all animals are euthanized to collect tissues. Endpoints assessed include AAV vector tissue bio-distribution, Pullulanase expression, glycogen reduction, and histology of various tissues (including liver, heart, diaphragm, quadriceps, gastrocnemius, kidney, and the brain).
TABLE-US-00009 TABLE 2 Dose Group Animal Age Treatment Capsid (vg/kg) 1 Mice 3 mo Vehicle x x 2 Mice 3 mo AAV-Dual-Pull.sup.CpG-free AAV9 1 × 10.sup.13 3 Mice 3 mo AAV-Dual-Pull.sup.CpG-free AAVcc.47 1 × 10.sup.13 4 Mice 3 mo AAV-Dual-Pull.sup.CpG-free AAVcc.81 1 × 10.sup.13
Example 12. Transduction Efficiencies and Glycogen Clearance Capacities of AAVcc.47 and AAVcc.81 in GSD IIIa Dogs
[0202] Prior to AAV treatment, all GSD IIIa dogs are pre-screened for pre-existing neutralizing antibodies against the three AAV capsids. The AAV-Dual-PullCpG-free vector is packaged in AAV9, AAVcc.47, and AAVcc.81 according to Table 3. These AAVs are intravenously injected (via jugular vein) into GSD IIIa dogs at the same dose (1×10.sup.13 vg/kg). Four (4) weeks after administration, all dogs are euthanized. At that time, tissues including liver, gastrocnemius, quadriceps, heart, diaphragm, spleen, bladder, kidney, brain, and reproductive organs are collected. Whole blood is used for isolating peripheral blood mononuclear cells (PBMCs) and fresh spleen is used for isolating splenocytes.
TABLE-US-00010 TABLE 3 Dose Group Animal Age Treatment Capsid (vg/kg) 1 Dogs 6 mo Vehicle x x 2 Dogs 6 mo AAV-Dual-Pull.sup.CpG-free AAV9 1 × 10.sup.13 3 Dogs 6 mo AAV-Dual-Pull.sup.CpG-free AAVcc.47 1 × 10.sup.13 4 Dogs 6 mo AAV-Dual-Pull.sup.CpG-free AAVcc.81 1 × 10.sup.13
Example 13. Examination of AAV Neutralizing Antibodies and AAV Pharmacokinetic Profiles
[0203] Viral vectors packaging a luciferase transgene under control of the chicken beta actin (CBA) promoter are incubated with serial dilutions of dog serum or FBS control for 30 min. Huh7 cells are then added and incubated for 24-48 hours. After incubation, cells are lysed and luciferase activity is determined by bioluminescence measurement.
[0204] For pharmacokinetic studies, the vector genome copy numbers are calculated from total DNA isolated from 10 μL of blood at pre-dose, 0.25 hour, 1 hour, 2 hours, 6 hours, 24 hours, and 48 hours post-injection. Viral genome copy numbers are determined by qPCR using vector-specific primers normalized to lamin B2.
Example 14. Determination of Gene Therapy-Related Acute Immune Responses and Evaluation of Pullulanase-Specific CTL Response by IFNγ ELISpot and IHC
[0205] Approximately 1-4 mL of blood is taken from each dog at the following time points: 0 (pre-dose), 0.25 hour, 1 hour, 2 hours, 6 hours, 24 hours, and 48 hours post-vector injection. Serum samples are analyzed for cytokines IFN-γ, IL-6, IL-8, IL-10, MCP-1, and TNF-α using a MILLIPLEX Map Canine Cytokine/Chemokine Premixed Magnetic Bead Kit. Splenocytes and peripheral blood mononuclear cells (PBMCs) are isolated from the Vehicle-treated and AAV-treated GSD IIIa dogs. [71, 72] Pullulanase-specific immunodominant T cell epitopes are mapped using the Pullulanase overlapping peptide library and the splenocytes from the AAV-treated dogs [71, 72] Pullulanase-specific CTL responses by IFNγ ELISpot with the splenocytes are determined. Whole blood is used for isolating peripheral blood mononuclear cells (PBMCs) and fresh spleen is used for isolating splenocytes. To confirm the ELISpot results, immunohistochemical staining of CD4+, CD8+ T cells is performed with tissue sections (as performed in
Example 15. Examination of Transduction Efficiencies and Glycogen Clearance Capacities of AAVcc.47 and AAVcc.81 in Human GSD IIIa Patient Muscle Cells
[0206] The transduction efficiency of AAVcc.47 and AAVcc.81 and their glycogen clearance capability in isolated human primary myoblasts is examined. AAVcc.47, AAVcc.81, and AAV9 capsids packaging either the AAV-CBA-GFP or the AAV-Dual-PullCpG-free are prepared. Early-passage GSD IIIa patient myoblasts are seeded onto collagen-coated 6-well plates in growth medium (Day 1). When cells reached 70-80% confluence (Day 4), a low-serum differentiation medium is introduced to induce differentiation into myotubes. [76] On Day 10, cells are infected each AAV vector in differentiation medium at different multiplicity of infection (MOI) ranging from 2×10.sup.3 to 1×10.sup.5 in triplicates. [77] A proteasome inhibitor (e.g., Bortezomib) is used to improve in vitro AAV transduction. [78] After 5 days, cells are harvested for detection of transgene expression (i) by immunofluorescence microscopy (GFP and Pullulanase) or (ii) by enzyme activity assay and Western blot (Pullulanase). Glycogen reduction is determined by glycogen content assay and by PAS staining. [35]
Example 16. Human Liver Chimeric Mice are a Powerful Tool to Validate Human Gene Therapy and Increase Clinical Translatability
[0207] GSD III patients present not only with muscle but also with liver problems. Therefore, it is important to evaluate this approach also in primary human hepatocytes. However, in contrast to muscle cells, hepatocytes ex vivo underlie a constantly changing expression profile and almost hourly deteriorate in tissue culture. To address this experimental limitation and validate the hepatocyte, humanized mice are used. Mice with human livers are repopulated with human hepatocytes, which upon genetic selection [67] expand in the murine liver and generate a human liver chimerism of up to 95%. [66] Humanization can be evaluated by measuring human proteins, such as human albumin, in the murine blood. In the FRG (Fah−/−/Rag2−/−Il2rg−/−) mouse [67], human albumin levels correlate with human liver chimerism assessed by immunostaining for human cells. [66] (
Example 17. Transduction Efficiencies of AAVcc.47 and AAVcc.81 and Evaluate Toxicity of Pullulanase Expression in Human Liver Chimeric Mice
[0208] To generate human liver chimeric FRG mice, human hepatocyte transplantation is done by splenic injections as described for mouse hepatocytes. [79] In brief, 3×10.sup.6 human hepatocytes (source: cadaveric, cryopreserved hepatocytes—from the same donor for all mice) in a volume of 50 μL is injected into the spleen of 2 months old FRG mice. Immediately after transplantation, selection pressure towards transplanted human hepatocytes is applied by withdrawing the drug NTBC from the drinking water. [64-66] After 2 weeks, mice are again put on the drug NTBC for 3 days before a second withdrawal (cycling). Cycling is repeated until mice have a human chimerism of >60%. Human chimerism is determined by measuring the human albumin in the murine blood (ELISA). (See
TABLE-US-00011 TABLE 4 Dose Group Animal Capsid (vg/kg) 1 Vehicle X X 2 AAV-Dual-Pull.sup.CpG-free AAV9 1 × 10.sup.13 3 AAV-Dual-Pull.sup.CpG-free AAVcc.47 1 × 10.sup.13 4 AAV-Dual-Pull.sup.CpG-free AAVcc.81 1 × 10.sup.13
[0209] AAV vectors are injected into the tail vein of highly humanized mice as previously described. [65] Mice are weighed prior to injection, 2 days post-injection, 7 days post-injection, and then weekly. To detect hepatotoxicity, several liver parameters (e.g., AST, ALT, GGT, AP and bilirubin) are measured in the blood at multiple time points (e.g., pre-injection and 2 days, 7 days, 14 days, 21 days, etc. post injection). Six weeks post-injection, all mice are euthanized and the liver of each mouse is harvested. Human hepatocytes are detected by immunostaining for FAH. The AAV transgene is detected by staining for the influenza Hemagglutinin (HA) peptide tagged to the c-terminus of the Pullulanase protein. To determine transduction efficiency of human hepatocytes in vivo, double stained cells are quantified using the Image J software as described previously. [65] Hepatotoxicity of all groups is determined by blood chemistry as described above and with immune staining for caspase 3 and the TUNEL assay (apoptosis test). Additionally, liver sections are examined for infiltration, microscopic signs of inflammation, and accumulation of macrophages by F4/80 staining.
Example 18. Examination of Long-Term Efficacy of AAV Vector in GSD IIIa Mice
[0210] To determine the minimum effective dose (MED), a short-term dose-ranging study is conducted by injecting AAV vector (either AAVcc.47 or AAVcc.81) at escalating doses (2×10.sup.12, 1×10.sup.13, and 5×10.sup.13 vg/kg) in 3-month-old male and female GSD IIIa mice. (See Table 5). Six weeks after injection, functional tests (including treadmill, wire-hang, and Rota-rod) are performed for mice in each group. [35, 81] All mice are then euthanized to collect blood, urine, and tissues (liver, heart, diaphragm, quadriceps, gastrocnemius, kidney, and the brain).
TABLE-US-00012 TABLE 5 Dose Group Age Treatment Capsid (vg/kg) 1 3 mo Vehicle x x 2 3 mo AAV-Dual-Pull.sup.CpG-free AAVcc.47/81 2 × 10.sup.12 3 3 mo AAV-Dual-Pull.sup.CpG-free AAVcc.47/81 1 × 10.sup.13 4 3 mo AAV-Dual-Pull.sup.CpG-free AAVcc.47/81 5 × 10.sup.13
[0211] Having identified the minimum effective dose for the lead AAV, a long-term efficacy study in 3-month-month old male and female mice with the lead AAV vector at the MED is conducted. (See Table 6). Functional tests are performed at time of administration, 13 weeks, 26 weeks, 39 weeks, and 52 weeks post-administration. To collect blood, urine, and tissues, mice are euthanized at either 26 weeks post-administration or at 52 weeks post-administration.
TABLE-US-00013 TABLE 6 Dose Group Age Treatment Capsid (vg/kg) 1 3 mo Vehicle x x 2 3 mo AAV-Dual-Pull.sup.CpG-free AAVcc.47/81 MED
[0212] Finally, aged (12-month-old) male and female mice are treated with the lead AAV vector at 3 different doses (low, medium, high). (Table 7). Functional tests are performed at time of administration as well as at 13 weeks and 26 weeks post-administration. All mice are euthanized at 26 weeks post-administration to collect blood, urine, and tissues. Key assessments performed with the collected samples include (i) AAV bio-distribution, Pullulanase expression, glycogen reduction, fibrosis reversal, and histology correction in tissues [35]; (ii) improvement liver functions as determined by a liver panel assay with serum that includes ALT, ALP, AST, CK, glucose, albumin, bilirubin, and total protein; and (iii) normalization of disease biomarker Glc4 in urine analyzed by stable isotope-dilution electrospray tandem mass spectrometry. [82]
TABLE-US-00014 TABLE 7 Dose Group Age Treatment Capsid (vg/kg) 1 12 mo Vehicle x x 2 12 mo AAV-Dual-Pull AAVcc.47/81 2 × 10.sup.12 3 12 mo AAV-Dual-Pull AAVcc.47/81 1 × 10.sup.13 4 12 mo AAV-Dual-Pull AAVcc.47/81 5 × 10.sup.13
Example 19. Investigation of Safety and Efficacy of AAV Vector in GSD IIIa Dogs
[0213] To determine the long-term safety and efficacy of gene therapy, 6-month-old GSD IIIa dogs are treated with vehicle (Group 1) and the AAV vector at doses of 1×10.sup.13 (Group 2) and 5×10.sup.13 vg/kg (Group 3). Blood is collected from awake dogs via venipuncture at the indicated time points for serum preparation (0.5-1.0 mL blood) and/or PBMCs isolation (30 mL blood). Urine is collected at the indicated time points for urinary Glc4 analysis. A series of liver biopsies by laparotomy and skeletal muscle (quadriceps and gastrocnemius) biopsies are performed on each dog under general anesthesia at 0.5 months prior to injection and then 0.5 months, 3 months, 6 months, and 9 months post-injection. All dogs are euthanized at 12 months post-AAV injection.
[0214] Acute immune responses by cytokine-chemokine profiling with serum is determined at the time of injection as well as at 0.25 hour, 1 hour, 2 hours, 6 hours, 24 hours, and 48 hours post-injection. Pullulanase-specific CTL response by IFNγ ELISpot with PBMCs is measured at the time of injection as well as at 1 month, 3 months, 6 months, and 12 months post-injection. Blood chemistry for liver and muscle enzymes is determined at the time of injection as well as at 1 day, 3 days, 7 days, and 15 days post-injection and at 1 month, 3 months, 6 months, 9 months, and 12 months post-injection. Serum samples are sent to a commercial laboratory for a panel of routine biochemical tests that includes, but is not limited to, ALT, AST, ALP, CK, glucose, triglycerides, bilirubin, albumin, and cholesterol. [16, 41, 69] Liver and muscle biopsies obtained at the indicated time points or the tissues (liver, gastrocnemius, quadriceps, heart, diaphragm, spleen, bladder, kidney, brain, and reproductive organs) collected at euthanasia are analyzed for (i) AAV vector genome copies, (ii) Pullulanase activities, (iii) Western blot, and (iv) glycogen contents. These samples are also used for histological analysis including PAS staining (glycogen content), Trichrome staining (fibrosis), and H&E staining (morphology). Urine samples collected at the indicated time points are used to determine Glc4 concentrations.
[0215] All data are presented as mean±standard deviation. For analysis of data from multiple groups, one-way ANOVA with post hoc test (Tukey) is performed using Prism software (Graphpad). For two-group comparison, equal variance, unpaired, two-tailed Student's t-test is performed. A sample size of 5-7 mice or 3 dogs per group is projected to be sufficient to achieve statistical significance for detecting a difference of 35% in biochemical corrections of tissues, with a study power of 0.85 and significance level of 0.05.
Methods used in Examples 1-19
[0216] The following exemplary methods were used in the present disclosure.
[0217] AAV vector constructs and AAV viral packaging. To generate the pAAV-LSP-CB-Pull vector plasmid, the LSP promoter was amplified from the pAAV-LSP-Pull vector using primers: XbaI-LSP-F and AflII-LSP-R (Table 8) and the CB promoter was amplified from the pAAV-CB-Pull vector (14) using primers AflII-CB-F and KpnI-CB-R (Table 8). The amplified XbaI-LSP-AflII and AflII-CB-KpnI fragments were ligated through the AflII site and amplified again using primers: XbaI-LSP-F and KpnI-CB-R (Table 8). The amplified XbaI-LSP-CB-KpnI fragment was cloned into the pAAV-LSP-Pull vector at the XbaI and KpnI sites to replace the LSP promoter. The pAAV-LSP-Pull, pAAV-CB-Pull, and pAAV-LSP-CB-Pull vectors were packaged as AAV9 in HEK293T cells using the calcium phosphate transferase method and purified using the iodixanol gradient ultracentrifugation method (34). The titer of the viral stock was determined by Southern blot using purified viral DNA and a biotin-labeled probe generated with Prime-A-Gene labeling kit (Promega, Madison, Wis.). The viral vector stock was handled according to Biohazard Safety Level 2 guidelines published by the National Institutes of Health.
TABLE-US-00015 TABLE 8 Target Name Sequences SEQ ID NO: LSC FWD Xba1-LSP-F AGTTCTAGAGCGGCCGCCAG SEQ ID NO: 07 REV Afl11-LSP-R CCCCTTAAGCCATTTTTATAGCA SEQ ID NO: 08 TGTCCTGTATTGCAAAACTA CB FWD Afl11-CB-F CCCCTTAAGGTTCCGCGTTACAT SEQ ID NO: 09 AACTTACGGTAAAT REV Kpn1-CB-R GTCGACGGTACCGCGCAG SEQ ID NO: 10 Pullulanase FWD Pull-F GCCACTGGATGCCTACAACT SEQ ID NO: 11 REV Pull-R CGTGCTGGTGCAGTGTATTG SEQ ID NO: 12 B-Actin FWD Actin-F AGAGGGAAATCGTGCGTGAC SEQ ID NO: 13 REV Actin-R CAATAGTGATGACCTGGCCGT SEQ ID NO: 14
[0218] Animal and viral vector administration. Animal care and experiments were conducted following Duke University Institutional Animal Care and Use Committee approved guidelines. Ten-week-old GSD IIIa (Agl knockout) mice were injected with AAV9-LSP-Pull (LSP), AAV9-CB-Pull (CB), AAV9-LSP-Pull+AAV9-CB-Pull co-administration (Co), or AAV9-LSP-CB-Pull (Dual) at the same dose of 5.0×10.sup.12 vg/kg (
[0219] AAV vector biodistribution. AAV vector genomes were quantified by real-time PCR. Genomic DNA was extracted from frozen tissues using the Wizard Genomic DNA Purification kit (Promega, Madison, Wis.). PCR was performed using SYBR Green (Roche, Basel, Switzerland) and the gene-specific primer pairs for Pullulanase and mouse β-actin (Table 8). The pAAV-CB-Pull plasmid DNA was used to generate a standard curve for calculating viral vector copy numbers.
[0220] Pullulanase activity assay. Pullulanase activity was measured using the Pullulanase activity assay kit (Megazyme, Wicklow, Ireland) following the manufacturer's protocol. Briefly, tissues were homogenized using a tissue homogenizer (Caframo LTD, Ontario, Canada) on ice in PBS containing a protease/phosphatase inhibitor cocktail (Cell Signaling Technology, Danvers, Mass.). After centrifugation at 18,000×g at 4° C. for 15 min, the lysates were incubated with the substrate (6-O-Benzylidene-4-nitrophenyl-63-α-D-maltotri osyl-maltotriose), thermostable α-glucosidase, and thermostable β-glucosidase at 40° C. After 10 min, the reaction was stopped by adding the stop buffer [2% (w/v) Tris buffer, pH 9.0]. The absorbance was read at 405 nm using a victor X multi-label plate reader (PerkinElmer Corporation, Waltham, Mass.). Kit-provided Pullulanase enzyme was used as a standard to determine the enzyme activity. Protein concentrations in tissue lysates were determined by BCA assay and used to normalize the data.
[0221] Glycogen content assay. The same lysates from Pullulanase activity assay were diluted 1:5 in distilled water and boiled for 3 min to inactivate endogenous enzymes. The diluted samples were incubated with 0.175 U/mL (final concentration in the reaction) of Amyloglucosidase (Sigma-Aldrich Co., St. Louis, Mo.) for 90 min at 37° C. The reaction mixtures were then boiled again for 3 min to stop the reaction. 30 μL of the mixtures were incubated with 1 mL of Pointe Scientific Glucose (Hexokinase) Liquid Reagents (Fisher, Hampton, N.H.) for at least 10 min at room temperature. The absorbance at 340 nm was read using a UV-VIS Spectrophotometer (Shimadzu UV-1700 PharmaSpec, Tokyo, Japan).
[0222] Histology. Fresh tissues were fixed immediately in 10% neutral-buffered formalin (NBF) for 48 h. After primary immersion fixation, the samples were post-fixed with 1% periodic acid (PA) in 10% NBF for 48 h at 4° C. The samples were then washed with PBS, dehydrated with ascending grades of alcohol, cleared with xylene, and infiltrated with paraffin. For PAS staining, sections of paraffin-embedded tissues were processed and stained using Schiff reagent as described (14). Briefly, the slides were oxidized with freshly made 0.5% PA for 5 min and rinsed with distilled water for 1 min. The slides were then stained with Schiff reagent for 15 min and washed with tap water for 10 min. The slides were counterstained with Hematoxylin and rinsed with tap water, incubated with bluing reagent for 1 min, dehydrated, and mounted. For trichrome staining, the paraffin-embedded liver sections were processed and stained using Masson's trichrome staining kit (Sigma-Aldrich Co., St. Louis, Mo.) following the manufacturer's protocol. Images were taken on a BZ-X710 microscope (Keyence America, Itasca, Ill.).
[0223] Plasma enzyme activity tests. The activities of plasma ALT, AST, and CK were measured using the Liquid ALT (SGPT), Liquid AST (SGOT), and Liquid Creatine Kinase Reagent Set, respectively (Pointe Scientific, Inc. Canton, Mich.). Whole blood was collected in green blood collection tube (coated with lithium heparin) and plasma was separated by centrifugation at 2,000×g, 4° C. for 10 min and diluted (1:5) with normal saline [0.9% (w/v) of NaCl]. The diluted plasma was incubated with the working reagent (R1 and R2 mixture) at 37° C. and absorbance at 340 nm was recorded every minute for five minutes.
[0224] Treadmill exhaustion test. Mice were acclimated for 15 min in the chamber of the treadmill (LE8709, Panlab Harvard Apparatus, Holliston, Mass.) and warmed up by running at the lowest speed, 5 cm/sec and 25 degrees of slope for 3 min. Then, mice were allowed to run at 8 cm/sec for 3 min. The speed was increased by 4 cm/sec every three min until mice were exhausted or the maximal speed (32 cm/sec) was reached.
[0225] Immunohistochemistry. Paraffin-embedded sections were deparaffinized and rehydrated. The slides were incubated in Tris-EDTA (pH 9.0) buffer at 100° C. for 20 min for antigen retrieval and wash the slides with cold tap water and TBS containing 0.025% Triton X-100 (TBST). The samples were incubated with 10% normal goat serum with 1% BSA in TBS for 2 h at room temperature, and primary antibodies diluted in 1% BSA/TBS at 4° C. overnight. The following primary antibodies were used: recombinant anti-CD4 antibody (Abcam, Cambridge, Mass., ab183685) and recombinant anti-CD8 alpha antibody (Abcam, Cambridge, Mass., ab209775). The next day, the slides were washed with TBST, incubated with 0.3% H202 in TBS for 15 min, and incubated with HRP conjugated secondary antibody for 1 h at room temperature. The samples were washed and developed with SignalStain DAB substrate Kit (Cell Signaling Technology, Danvers, Mass.). The slides were rinsed, counterstained with Hematoxylin, dehydrated, cleared, and mounted. The images were taken on a BZ-X710 microscope (Keyence America, Itasca, Ill.).
[0226] Statistics. Statistical significance was determined by multiple t-tests using Prism software (GraphPad, La Jolla, Calif.); data are presented as mean±standard deviation (SD). p<0.05 was considered statistically significant.
REFERENCES
[0227] 1. Kishnani P S, et al. (2010) Glycogen storage disease type III diagnosis and management guidelines. Genet Med. 12(7):446-63.
[0228] 2. Dagli A, C. P. Sentner, and D. A. Weinstein, Glycogen Storage Disease Type III, in GeneReviews®, M. P. Adam, et al., Editors. 2010, University of Washington, Seattle: Seattle (Wash.).
[0229] 3. Demo E, et al. (2007) Glycogen storage disease type III-hepatocellular carcinoma a long-term complication? J Hepatol. 46(3):492-8.
[0230] 4. Halaby C A, et al. (2019) Liver fibrosis during clinical ascertainment of glycogen storage disease type III: a need for improved and systematic monitoring. Genet Med.
[0231] 5. Lee P J, et al. (1997) Comparison of the functional significance of left ventricular hypertrophy in hypertrophic cardiomyopathy and glycogenosis type III. Am J Cardiol. 79(6):834-8.
[0232] 6. Labrune P, et al. (1991) Cardiomyopathy in glycogen-storage disease type III: clinical and echographic study of 18 patients. Pediatr Cardiol. 12(3):161-3.
[0233] 7. Olson L J, et al. (1984) Cardiac involvement in glycogen storage disease III: morphologic and biochemical characterization with endomyocardial biopsy. Am J Cardiol. 53(7):980-1.
[0234] 8. Moses S W, et al. (1986) Neuromuscular involvement in glycogen storage disease type III. Acta Paediatr Scand. 75(2):289-96.
[0235] 9. Mogahed E A, et al. (2015) Skeletal and cardiac muscle involvement in children with glycogen storage disease type III. Eur J Pediatr. 174(11):1545-8.
[0236] 10. Sentner C P, et al. (2012) Heart Failure Due to Severe Hypertrophic Cardiomyopathy Reversed by Low Calorie, High Protein Dietary Adjustments in a Glycogen Storage Disease Type IIIa Patient. JIMD Rep. 5:13-6.
[0237] 11. Kishnani P S, et al. (2009) Early treatment with alglucosidase alpha prolongs long-term survival of infants with Pompe disease. Pediatr Res. 66(3):329-35.
[0238] 12. Kishnani P S, et al. (2010) Cross-reactive immunologic material status affects treatment outcomes in Pompe disease infants. Mol Genet Metab. 99(1):26-33.
[0239] 13. Van der Ploeg A T, et al. (2010) A randomized study of alglucosidase alfa in late-onset Pompe's disease. N Engl J Med. 362(15):1396-406.
[0240] 14. Van der Ploeg A T, et al. (2012) Open-label extension study following the Late-Onset Treatment Study (LOTS) of alglucosidase alfa. Mol Genet Metab. 107(3):456-61.
[0241] 15. Sun B, et al. (2013) Alglucosidase alfa enzyme replacement therapy as a therapeutic approach for glycogen storage disease type III. Mol Genet Metab. 108(2):145-7.
[0242] 16. Yi H, et al. (2014) Correction of glycogen storage disease type III with rapamycin in a canine model. J Mol Med (Berl). 92(6):641-50.
[0243] 17. Pursell N, et al. (2018) Inhibition of Glycogen Synthase II with RNAi Prevents Liver Injury in Mouse Models of Glycogen Storage Diseases. Mol Ther. 26(7):1771-1782.
[0244] 18. Inagaki K, et al. (2006) Robust systemic transduction with AAV9 vectors in mice: efficient global cardiac gene transfer superior to that of AAV8. Mol Ther. 14(1):45-53.
[0245] 19. Zincarelli C, et al. (2008) Analysis of AAV serotypes 1-9 mediated gene expression and tropism in mice after systemic injection. Mol Ther. 16(6):1073-80.
[0246] 20. Jacobs F, et al. (2011) Adeno-associated viral vectors for correction of inborn errors of metabolism: progressing towards clinical application. Curr Pharm Des. 17(24):2500-15.
[0247] 21. Dayton R D, et al. (2012) The advent of AAV9 expands applications for brain and spinal cord gene delivery. Expert Opin Biol Ther. 12(6):757-66.
[0248] 22. Nathwani A C, et al. (2014) Long-term safety and efficacy of factor IX gene therapy in hemophilia B. N Engl J Med. 371(21):1994-2004.
[0249] 23. Uspenskaya O, et al. (2020) Design of Phase ½a Study of AAV9-Based Gene Therapy for Parkinson's Disease with Pathogenic GBA1 Mutations (PROPEL Trial). Neurology. 94(15).
[0250] 24. Flanigan K M, et al. (2020) Transpher A, a multicenter, single-dose, phase ½ clinical trial of ABO-102, an intravenous AAV9-based gene therapy for Sanfilippo Syndrome Type A (Mucopolysaccharidosis IIIA). Neurology. 94(15).
[0251] 25. de los Reyes E, et al. (2020) Single-dose AAV9-CLN6 gene transfer stabilizes motor and language function in CLN6-type Batten disease: Interim results from the first clinical gene therapy trial. Molecular Genetics and Metabolism. 129(2): S46-S47.
[0252] 26. Kuzmin D A, et al. (2020) A Systematic Review of Clinical Safety and Efficacy of AAV Gene Therapies. Molecular Therapy. 28(4):559-559.
[0253] 27. Rittie L, et al. (2019) The Landscape of Early Clinical Gene Therapies outside of Oncology. Molecular Therapy. 27(10):1706-1717.
[0254] 28. Vidal P, et al. (2018) Rescue of GSDIII Phenotype with Gene Transfer Requires Liver- and Muscle-Targeted GDE Expression. Mol Ther. 26(3):890-901.
[0255] 29. Hinderer C, et al. (2018) Severe Toxicity in Nonhuman Primates and Piglets Following High-Dose Intravenous Administration of an Adeno-Associated Virus Vector Expressing Human SMN. Human Gene Therapy. 29(3):285-298.
[0256] 30. Feldman A G, et al. (2020) Subacute Liver Failure Following Gene Replacement Therapy for Spinal Muscular Atrophy Type 1. J Pediatr.
[0257] 31. Lee C S, et al. (2017) Adenovirus-mediated gene delivery: Potential applications for gene and cell-based therapies in the new era of personalized medicine. Genes & Diseases. 4(2):43-63.
[0258] 32. Carbonaro-Sarracino, D. A., et al. (2020) Dosing and Re-Administration of Lentiviral Vector for In Vivo Gene Therapy in Rhesus Monkeys and ADA-Deficient Mice. Mol Ther Methods Clin Dev. 16:78-93.
[0259] 33. Themis M, et al. (2005) Oncogenesis following delivery of a nonprimate lentiviral gene therapy vector to fetal and neonatal mice. Mol Ther. 12(4):763-71.
[0260] 34. Escors D. et al. (2010) Lentiviral Vectors in Gene Therapy: Their Current Status and Future Potential. Archivum Immunologiae Et Therapiae Experimentalis. 58(2):107-119.
[0261] 35. Lim J A, et al. (2020) A Novel Gene Therapy Approach for GSD III Using an AAV Vector Encoding a Bacterial Glycogen Debranching Enzyme. Mol Ther Methods Clin Dev. 18:240-249.
[0262] 36. Taylor C, et al. (1975) Debranching enzyme from rabbit skeletal muscle. Purification, properties and physiological role. Eur J Biochem. 51(1):105-15.
[0263] 37. Zhai L, et al. (2016) Crystal structure of glycogen debranching enzyme and insights into its catalysis and disease-causing mutations. Nat Commun. 7:11229.
[0264] 38. Bates E J, et al. (1975) Debranching enzyme from rabbit skeletal muscle; evidence for the location of two active centres on a single polypeptide chain. FEBS Lett. 58(1):181-5.
[0265] 39. Shim J H, et al. (2009) Role of maltogenic amylase and pullulanase in maltodextrin and glycogen metabolism of Bacillus subtilis 168. J Bacteriol. 191(15):4835-44.
[0266] 40. Sluiter W, et al. (2012) Rapid ultraperformance liquid chromatography-tandem mass spectrometry assay for a characteristic glycogen-derived tetrasaccharide in Pompe disease and other glycogen storage diseases. Clin Chem. 58(7):1139-47.
[0267] 41. Brooks E D, et al. (2016) Natural Progression of Canine Glycogen Storage Disease Type IIIa. Comp Med. 66(1):41-51.
[0268] 42. Mingozzi F, et al. (2003) Induction of immune tolerance to coagulation factor IX antigen by in vivo hepatic gene transfer. Journal of Clinical Investigation. 111(9):1347-1356.
[0269] 43. Dobrzynski E, et al. (2006) Prevention of cytotoxic T lymphocyte responses to factor IX-expressing hepatocytes by gene transfer-induced regulatory T cells. Proceedings of the National Academy of Sciences of the United States of America. 103(12):4592-4597.
[0270] 44. Cao O, et al. (2009) P. A. Loduca, and R. W. Herzog, Role of regulatory T cells in tolerance to coagulation factors. Journal of Thrombosis and Haemostasis. 7:88-91.
[0271] 45. McIntosh J, et al. (2013) Therapeutic levels of FVIII following a single peripheral vein administration of rAAV vector encoding a novel human factor VIII variant. Blood. 121(17): 3335-44.
[0272] 46. Keeler G D, et al. (2019) Liver induced transgene tolerance with AAV vectors. Cell Immunol. 342:103728.
[0273] 47. Zhang P, et al. (2012) Immunodominant liver-specific expression suppresses transgene-directed immune responses in murine pompe disease. Hum Gene Ther. 23(5):460-72.
[0274] 48. Franco L M, et al. (2005) Evasion of immune responses to introduced human acid alpha-glucosidase by liver-restricted expression in glycogen storage disease type II. Mol Ther. 12(5):876-84.
[0275] 49. Koeberl D, et al. (2020) A phase 1 study of gene therapy with ACTUS-101 in late-onset Pompe disease. Mol Genet Metab. 129(2): S91.
[0276] 50. Kishnani P S, et al. (2019) Liver depot gene therapy for Pompe disease. Ann Transl Med. 7(13):288.
[0277] 51. Wang L, et al. (2000) Sustained expression of therapeutic level of factor IX in hemophilia B dogs by AAV-mediated gene therapy in liver. Mol Ther. 1(2):154-8.
[0278] 52. Wang L, et al. (1999) Sustained correction of bleeding disorder in hemophilia B mice by gene therapy. Proc Natl Acad Sci U S A. 96(7):3906-10.
[0279] 53. Ill C R, et al. (1997) Optimization of the human factor VIII complementary DNA expression plasmid for gene therapy of hemophilia A. Blood Coagul Fibrinolysis. 8 Suppl 2:S23-30.
[0280] 54. Thomas J, et al. (2018) Pegvaliase for the treatment of phenylketonuria: Results of a long-term phase 3 clinical trial program (PRISM). Mol Genet Metab. 124(1):27-38.
[0281] 55. Harding C O, et al. (2018) Pegvaliase for the treatment of phenylketonuria: A pivotal, double-blind randomized discontinuation Phase 3 clinical trial. Mol Genet Metab. 124(1):20-26.
[0282] 56. Gupta S, et al. (2018) Association of immune response with efficacy and safety outcomes in adults with phenylketonuria administered pegvaliase in phase 3 clinical trials. EBioMedicine. 37:366-373.
[0283] 57. Bell P, et al. (2011) Evaluation of adeno-associated viral vectors for liver-directed gene transfer in dogs. Hum Gene Ther. 22(8):985-97.
[0284] 58. Wright J F, et al. (2020) Codon Modification and PAMPs in Clinical AAV Vectors: The Tortoise or the Hare? Molecular Therapy. 28(3):701-703.
[0285] 59. Zhu J G, et al. (2009) The TLR9-MyD88 pathway is critical for adaptive immune responses to adeno-associated virus gene therapy vectors in mice. Journal of Clinical Investigation. 119(8):2388-2398.
[0286] 60. Rogers G L, et al. (2015) Unique Roles of TLR9-and MyD88-Dependent and -Independent Pathways in Adaptive Immune Responses to AAV-Mediated Gene Transfer. Journal of Innate Immunity. 7(3):302-314.
[0287] 61. Rogers G L, et al. (2013) Innate immune responses to AAV vectors. Frontiers in Microbiology, 011. 2.
[0288] 62. Faust S M, et al. (2013) CpG-depleted adeno-associated virus vectors evade immune detection. J Clin Invest. 123(7):2994-3001.
[0289] 63. Gonzalez T J, et al. (2020) Cross-Species Evolution of Synthetic AAV Strains for Clinical Translation. Molecular Therapy. 28(4S1):12-13.
[0290] 64. Barzi M, et al. (2017) A novel humanized mouse lacking murine P450 oxidoreductase for studying human drug metabolism. Nat Commun. 8(1):39.
[0291] 65. Bissig-Choisat B, et al. (2015), Development and rescue of human familial hypercholesterolaemia in a xenograft mouse model. Nat Commun. 6:7339.
[0292] 66. Bissig K D, et al. (2010) Human liver chimeric mice provide a model for hepatitis B and C virus infection and treatment. J Clin Invest. 120(3):924-30.
[0293] 67. Bissig K D, et al. (2007) Repopulation of adult and neonatal mice with human hepatocytes: a chimeric animal model. Proc Natl Acad Sci U S A. 104(51):20507-11.
[0294] 68. Gregory B L, et al. (2007) Glycogen storage disease type IIIa in curly-coated retrievers. J Vet Intern Med. 21(1):40-6.
[0295] 69. Yi H, et al. (2012) Characterization of a canine model of glycogen storage disease type IIIa. Dis Model Mech. 5(6):804-11.
[0296] 70. Mack D L, et al. (2017) Systemic AAV8-Mediated Gene Therapy Drives Whole-Body Correction of Myotubular Myopathy in Dogs. Molecular Therapy. 25(4):839-854.
[0297] 71. Manno C S, et al. (2006) Successful transduction of liver in hemophilia by AAV-Factor IX and limitations imposed by the host immune response (vol 12, pg 342, 2006). Nature Medicine. 12(5):592-592.
[0298] 72. Wang Z J, et al. (2012) Analyzing Cellular Immunity to AAV in a Canine Model Using ELISPOT Assay. Handbook of Elispot: Methods and Protocols. Second Edition. 792:65-74.
[0299] 73. Martino A T, et al., Measuring Immune Responses to Recombinant AAV Gene Transfer. Adeno-Associated Virus: Methods and Protocols. 807:259-272.
[0300] 74. Sun, B., et al. (2005) Correction of glycogen storage disease type II by an adeno-associated virus vector containing a muscle-specific promoter. Mol Ther. 11(6):889-98.
[0301] 75. Wang Z., et al. (2007) Sustained AAV-mediated dystrophin expression in a canine model of Duchenne muscular dystrophy with a brief course of immunosuppression. Mol Ther. 15(6): 1160-6.
[0302] 76. Sun B D, et al. (2013) Alglucosidase alfa enzyme replacement therapy as a therapeutic approach for glycogen storage disease type III. Molecular Genetics and Metabolism. 108(2): 145-147.
[0303] 77. Kimura T. et al. (2019) Production of adeno-associated virus vectors for in vitro and in vivo applications. Sci Rep. 9(1):13601.
[0304] 78. Mitchell A M et al. (2013) Mechanistic Insights into the Enhancement of Adeno-Associated Virus Transduction by Proteasome Inhibitors. Journal of Virology. 87(23):13035-13041.
[0305] 79. Ponder K P, et al. (1991) Mouse Hepatocytes Migrate to Liver Parenchyma and Function Indefinitely after Intrasplenic Transplantation. Proceedings of the National Academy of Sciences of the United States of America. 88(4):1217-1221.
[0306] 80. Pankowicz F P, et al. (2018) Rapid Disruption of Genes Specifically in Livers of Mice Using Multiplex CRISPR/Cas9 Editing. Gastroenterology. 155(6):1967-+.
[0307] 81. Lim J A, et al. (2018) A Single Intravenous Injection of an AAV-PHP. B Vector Encoding Human Acid alpha-Glucosidase Corrects Both Muscle and Brain Defects in Murine Pompe Disease. Molecular Therapy. 26(5): 382-383.
[0308] 82. Young S P, et al. (2003) Analysis of a glucose tetrasaccharide elevated in Pompe disease by stable isotope dilution-electrospray ionization tandem mass spectrometry. Anal Biochem. 316(2): 175-80.
[0309] 83. Mount J D, et al. (2002) Sustained phenotypic correction of hemophilia B dogs with a factor IX null mutation by liver-directed gene therapy. Blood. 99(8):2670-6.
[0310] 84. Callan M B, et al. (2016) Successful Phenotype Improvement following Gene Therapy for Severe Hemophilia A in Privately Owned Dogs. PLoS One. 11(3):e0151800.
[0311] 85. Crudele J M, et al. (2015) AAV liver expression of FIX-Padua prevents and eradicates FIX inhibitor without increasing thrombogenicity in hemophilia B dogs and mice. Blood. 125(10):1553-61.
[0312] 86. Chao H, et al. (1999) Persistent expression of canine factor IX in hemophilia B canines. Gene Ther. 6(10):1695-704.
[0313] 87. Shin J H, et al. (2013) Microdystrophin Ameliorates Muscular Dystrophy in the Canine Model of Duchenne Muscular Dystrophy. Molecular Therapy. 21(4):750-757.
[0314] 88. Childers M K, et al. (2014) Gene therapy prolongs survival and restores function in murine and canine models of myotubular myopathy. Sci Transl Med. 6(220):220ra10.
[0315] 89. Dupont J B, et al. (2020) AAV-Mediated Gene Transfer Restores a Normal Muscle Transcriptome in a Canine Model of X-Linked Myotubular Myopathy. Molecular Therapy. 28(2):382-393.
[0316] 90. Sun B, et al. (2010) Immunomodulatory gene therapy prevents antibody formation and lethal hypersensitivity reactions in murine pompe disease. Mol Ther. 18(2):353-60.
[0317] 91. Sun B, et al. (2008) Correction of multiple striated muscles in murine Pompe disease through adeno-associated virus-mediated gene therapy. Mol Ther. 16(8):1366-71.
[0318] 92. Yi H, et al. (2017) Systemic Correction of Murine Glycogen Storage Disease Type IV by an AAV-Mediated Gene Therapy. Hum Gene Ther. 28(3):286-294.
[0319] 93. Koeberl D D, et al. (2008) AAV vector-mediated reversal of hypoglycemia in canine and murine glycogen storage disease type Ia. Mol Ther. 16(4):665-72.