Anti-human IgG4 monoclonal antibody and methods of making and using same
11372001 · 2022-06-28
Assignee
Inventors
- Yuya Teruuchi (Koriyama, JP)
- Yuri Matsuki (Tokyo, JP)
- Kazumitsu Inagaki (Koriyama, JP)
- Daisuke Sasaki (Koriyama, JP)
- Haruka Kashiwagura (Koriyama, JP)
Cpc classification
C07K2317/64
CHEMISTRY; METALLURGY
G01N33/53
PHYSICS
G01N33/543
PHYSICS
C07K2317/92
CHEMISTRY; METALLURGY
International classification
Abstract
Provided are: a monoclonal antibody against human IgG4, for which the epitope is present in the CH3 of human IgG4 given by SEQ ID NO: 4; a hybridoma that produces the monoclonal antibody; a method for detecting IgG4 using the monoclonal antibody; and a kit used in this method.
Claims
1. A monoclonal antibody specifically binding to human IgG4, wherein the monoclonal antibody binds to: the region consisting of the amino acid sequence at positions 221 to 274 of the human IgG4 heavy chain constant region represented by SEQ ID NO: 4, the region consisting of the amino acid sequence at positions 275 to 327 of the human IgG4 heavy chain constant region represented by SEQ ID NO: 4, and glutamic acid at position 299 of the human IgG4 heavy chain constant region represented by SEQ ID NO: 4.
2. The monoclonal antibody according to claim 1, wherein the monoclonal antibody binds to the human IgG4 with a dissociation constant of from 1.1×10.sup.−9 to 3.0×10.sup.−10 or less.
3. A monoclonal antibody against human IgG4, comprising a heavy chain variable region and a light chain variable region, wherein complementarity determining regions (CDR) 1, 2, and 3 of the heavy chain variable region consist of amino acid sequences represented by SEQ ID NOS: 9, 10, and 11, respectively, and CDRs 1, 2, and 3 of the light chain variable region consist of amino acid sequences represented by SEQ ID NOS: 12, 13, and 14, respectively.
4. The monoclonal antibody according to claim 3, wherein the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 5, and the light chain variable region comprises an amino acid sequence of SEQ ID NO: 6.
5. The monoclonal antibody according to claim 4, wherein the monoclonal antibody is produced by a hybridoma Ma14-08.
6. A bivalent antibody molecule or a bivalent antibody fragment comprising two antigen binding sites of the monoclonal antibody according to claim 1.
7. The antibody fragment according to claim 6, wherein the antibody fragment is F(ab′).sub.2.
8. A kit for detecting human IgG4, comprising the monoclonal antibody according to claim 1, or the bivalent antibody molecule or the bivalent antibody fragment comprising two antigen binding sites of the monoclonal antibody.
9. The kit according to claim 8, wherein the kit is for a diagnosis of an IgG4-related disease.
10. A method of producing a monoclonal antibody specifically binding to human IgG4 comprising: selecting, from monoclonal antibodies binding to human IgG4, an antibody which binds to: the region consisting of the amino acid sequence at positions 221 to 274 of the human IgG4 heavy chain constant region represented by SEQ ID NO: 4, the region consisting of the amino acid sequence at positions 275 to 327 of the human IgG4 heavy chain constant region represented by SEQ ID NO: 4, and glutamic acid at position 299 of the human IgG4 heavy chain constant region represented by SEQ ID NO: 4.
11. A method for detecting human IgG4 in a sample comprising: contacting the sample with: the monoclonal antibody according to claim 1, or a bivalent antibody molecule or the bivalent antibody fragment comprising two antigen binding sites of the monoclonal antibody; and detecting the human IgG4 in the sample.
12. The method according to claim 11, wherein the method is an immunological particle agglutination inhibition method.
13. The method according to claim 12, wherein the human IgG4 in the sample is detected by: (1) binding the human IgG4 in the sample to the monoclonal antibody or the bivalent antibody molecule or the bivalent antibody fragment; (2) adding an insoluble carrier on which human IgG4 or a peptide fragment thereof is immobilized to cause an agglutination reaction between the insoluble carrier and the monoclonal antibody or the bivalent antibody molecule or the bivalent antibody fragment that is not bound to the human IgG4 in the sample; and (3) detecting the agglutinated insoluble carrier.
14. The method according to claim 11, wherein the method is performed to assist a diagnosis of an IgG4-related disease.
15. A kit for the method according to claim 13, the kit comprising: (1) the monoclonal antibody, or the bivalent antibody molecule or the bivalent antibody fragment; (2) an isolated human IgG4 or a peptide fragment thereof; and (3) an insoluble carrier.
16. The kit according to claim 15, wherein (2) the isolated human IgG4 or the peptide fragment thereof is adsorbed on (3) the insoluble carrier.
17. The kit according to claim 15, wherein (3) the insoluble carrier is a latex particle.
18. A monoclonal antibody against human IgG4, comprising a heavy chain variable region and a light chain variable region, wherein complementarity determining regions (CDRs) 1, 2, and 3 of the heavy chain variable region consist of amino acid sequences represented by SEQ ID NOS: 15, 16, and 17, respectively, and CDRs 1, 2, and 3 of the light chain variable region of the antibody consist of amino acid sequences represented by SEQ ID NOS: 18, 19, and 20, respectively.
19. The monoclonal antibody according to claim 18, wherein the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 7, and the light chain variable region comprises an amino acid sequence of SEQ ID NO: 8.
20. The monoclonal antibody according to claim 19, wherein the monoclonal antibody is produced by a hybridoma Ma14-09.
21. An isolated peptide consisting of: the amino acid sequence at positions 221 to 274 of the human IgG4 heavy chain constant region represented by SEQ ID NO: 4, all or part of the amino acid sequence at positions 275 to 327 of the human IgG4 heavy chain constant region represented by SEQ ID NO: 4, and having glutamic acid at position 299.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
DESCRIPTION OF EMBODIMENTS
(21) A monoclonal antibody according to an embodiment of the present invention is produced by, for example, a hybridoma obtained by immunizing an animal with a purified human IgG4 as an immunogen and fusing a cell producing an anti-human IgG4 antibody produced by the animal with a bone marrow tumor cell. The animal to be used is not limited, and examples of animals other than humans include a mouse, a rat, a guinea pig, a hamster, and a rabbit. In particular, a mouse, IgG subtypes of which are IgG1, IgG2a, IgG2b, and IgG3, is preferable.
(22) The hybridoma can be obtained by the following method. That is, human IgG4 is mixed with a conventional adjuvant such as Freund's complete or incomplete adjuvant, aluminum hydroxide adjuvant, or pertussis adjuvant to prepare an adjuvant solution for sensitization, and this liquid is administered to an animal such as a mouse or a rat intraperitoneally, subcutaneously or via the tail vein, in several portions every 1-3 other weeks to immunize the animal. The amount of the antigen for sensitization is in the range of 1 μg to 100 mg, but is preferably about 50 μg in general. The number of immunizations is generally 2 to 7, but various methods are known. Subsequently, a cell producing antibody derived from the spleen or the like is fused with a cell having proliferative ability such as a bone marrow tumor cell (myeloma cell) or the like in a test tube. The antibody-producing cell can be obtained from the spleen or the like of a mouse, a nude mouse, a rat, or the like.
(23) As the fusion method, the Kohler and Milstein method with polyethylene glycol (PEG) (Nature. 256, 495. 1975) is well known. The fusion can be also carried out by Sendai virus or an electrofusion method.
(24) A method of selecting a hybridoma that produces an antibody that recognizes a human IgG4 from the fused cells can be carried out as follows. That is, the hybridoma is selected from colonies formed by cells surviving in a HAT medium and a HT medium by subjecting the fused cells to a limiting dilution method. In a case where an antibody against a human IgG4 is contained in a supernatant of a medium which cultured colonies of the fused cells seeded into a 96-well plate or the like, a clone capable of producing a monoclonal antibody against a human IgG4 can be selected by an ELISA method in which the supernatant is placed on an assay plate on which the human IgG4 is immobilized, and after the reaction, a labeled secondary antibody such as HRP labeled anti-mouse immunoglobulin antibody is reacted with the antibody. As a labeling substance of the labeled antibody, an enzyme other than HRP, such as alkaline phosphatase, a fluorescent substance, a radioactive substance, and the like, can be used. In addition, specific antibodies against human IgG4 can be screened by simultaneously carrying out, as a control, ELISA with an assay plate on which only BSA, which is a blocking agent, is bound. That is, a clone which is positive on a plate having a human IgG4 but negative in ELISA with BSA can be selected.
(25) A hybridoma according to an embodiment of the present invention is in particular preferably a hybridoma that produces an antibody that binds to a human IgG4 but does not bind to other human immunoglobulins (other IgGs, e.g. IgG1, IgG2 and IgG3, IgA, e.g. IgA1 and IgA2, IgD, IgE, and IgM) among hybridomas that produce a monoclonal antibody recognizing human IgG4.
(26) Here, “binds to human IgG4 but does not bind to other human immunoglobulins” in brief refers to the following: for example, in an ordinary ELISA under the same assay conditions except for the conditions mentioned below, a ratio of absorbance to a control (blank) which does not contain any human immunoglobulin is 40 or more, preferably 50 or more, and more preferably 100 or more in a case where a human IgG4 is contained as a solid phase antigen, whereas a ratio of absorbance to a control (blank) which does not contain any human immunoglobulin is 5 or less and preferably 2 or less in a case where IgG other than human IgG4 is contained as a solid phase antigen.
(27) The term also means that the antibody exhibits higher binding affinity with human IgG4 than other human immunoglobulins, which can be evaluated with a binding rate constant and a dissociation constant. Specifically, an antibody according to a preferred embodiment of the present invention binds to a specific epitope in a human IgG4 heavy chain constant region at a binding rate constant of 4.0×10.sup.5 or more and generally 4.0×10.sup.5 to 6.0×10.sup.5 and a dissociation constant of 5.0×10.sup.−10 or less and generally 5.0×10.sup.−10 to 3.0×10.sup.−10.
(28) The hybridoma may be cultured on a medium used for ordinary cell culture, such as α-MEM, RPMI1640, ASF, or S-clone, and a monoclonal antibody can be recovered from the supernatant of the culture medium. Alternatively, an animal from which the hybridoma cell has been derived, such as a nude mouse, is previously treated with pristine, the cell is intraperitoneally injected into the animal to cause accumulation of ascites, and the monoclonal antibody is recovered from the ascites.
(29) A method for recovering the monoclonal antibody from the supernatant or the ascites may be a conventional method. An example of the above method includes a salting-out treatment with ammonium sulfate, sodium sulfate and the like, chromatography, ion exchange chromatography, or affinity chromatography with protein A, protein G and the like.
(30) An immunoassay method with a monoclonal antibody according to an embodiment of the present invention allows a human IgG4 in a specimen to be detected with high sensitivity and specificity. Examples of a specimen include blood, serum, plasma, and the like taken or isolated from a subject. The specimen may be a biopsy sample from a lesion tissue of the body, such as pituitary gland, lacrimal gland, salivary gland, thyroid, prostate, bronchial epithelium, alveolar septum, pancreatic duct, retroperitoneum, bile duct wall, and rheumatoid arthritis synovium.
(31) The “immunoassay method” refers to a biochemical assay for detecting a level of a substance contained in a biological sample through a reaction between an antibody and an antigen.
(32) Examples of a detection system for the “immunoassay method” with a monoclonal antibody according to an embodiment of the present invention include a sandwich ELISA method, a chemiluminescent enzyme immunoassay method (CLEIA method), a fluorescent immunoassay method (FIA method), a latex (particle) agglutination method (turbidimetry method), and a latex (particle) agglutination inhibition method is more preferable.
(33) The “ELISA method” means Enzyme-Linked ImmunoSorbent Assay (ELISA)/EnzymeImmuno Assay (EIA), and refers to a method for detecting or quantifying a concentration of a substance contained in a sample through an enzyme reaction. A substance of interest is detected and assayed by using color development or light emission based on the enzyme reaction as a signal.
(34) A “competitive ELISA method” means an ELISA method for assaying at what ratio a “labeled antigen” and an “antigen present in the sample” bind to the antibody under a competitive condition.
(35) The “immunoturbidimetry” is a method for assaying an amount of an antigen contained in a specimen, the method being performed by reacting the antigen with an antibody to form a precipitate of an immune complex, irradiating the agglutination with light, and measuring an attenuation (absorbance) of the irradiated light due to scattering with an automatic analyzer.
(36) The “immunonephelometry” is a method of detecting an antigen contained in a specimen, the method being performed by reacting an antibody with an antigen to form a precipitate of an immune complex, irradiating the complex with light, and measuring scattered light.
(37) The “latex (particle) agglutination method” is a method for detecting an antigen by immobilizing an antibody onto latex particles, agglutinating the latex particles in the presence of an antigen and observing the agglutination.
(38) The “latex (particle) agglutination inhibition method” is a method on indirectly detecting “the antigen present in the sample” comprising immobilizing an antigen onto latex particles, and detecting at what ratio “the antigen bound to the latex particles” and “the antigen present in the sample” bind to the antibody under a competitive condition through the aggregate of the latex particle.
(39) In the both methods, for the observation of the aggregate, an attenuation (absorbance) of irradiated light due to scattering may be measured (immunoturbidimetry), or scattered light may be measured (immunonephelometry).
(40) In an embodiment of the present invention, “the antigen bound to the latex particles” may not be necessarily the same molecule as “the antigen present in the sample”, and in terms of the binding with the antibody according to the present invention or an antigen-binding fragment thereof it may just be a molecule that competes with “the antigen present in the sample”. In other words, in a case where the antibody according to the present invention is used for “the latex (particle) agglutination inhibition method”, it is preferable that “the antigen bound to the latex particles” and “the antigen present in the sample” each comprise an epitope to which the antibody binds.
(41) The epitope refers to a part of an antigen recognized by an antibody. A human IgG4 is a heterotetramer molecule having a molecular weight of about 146000, and composed of two molecules of light chains consisting of a variable region VL and a constant region CL, and two molecules of heavy chains consisting of a variable region VH, a constant region CH1, a hinge region, a constant region CH2, and a constant region CH3. The antibody does not recognize an entire antigen, but recognizes only a relatively small part of an antigen to bind thereto. In order to function as an epitope, at least 10 amino acid residues in length and more preferably 5 amino acid residues in length are required. The antibody binding site is called an “epitope” or an “antigenic determinant”.
(42) An antibody according to an embodiment of the present invention is required to recognize IgG4 but not IgG1, IgG2, or IgG3. Since light chains are common to IgG1 to IgG4, it is preferable that an epitope is in a heavy chain, in particular, a heavy chain constant region. Heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4 are represented by SEQ ID NOS: 1, 2, 3, and 4, respectively, and a portion at which homology between SEQ ID NOS: 1 to 3 and SEQ ID NO: 4 is low is preferably selected as an epitope. As demonstrated in Examples later, in particular, it is preferably an epitope present in a human IgG4 CH3 region, more specifically an epitope present within an amino acid sequence at positions 221 to 327 of a human IgG4 heavy chain constant region represented by SEQ ID NO: 4, and comprising glutamic acid at position 299, in terms of achieving a specific binding to IgG4 without an interaction with other IgG subclasses. In other words, an epitope to which the antibody binds according to a preferred embodiment of the present invention consists of all or a part of an amino acid sequence at positions 221 to 327 of a human IgG4 heavy chain constant region represented by SEQ ID NO: 4, and comprises glutamic acid at position 299. Therefore, according to another preferred embodiment of the present invention, there is provided a peptide comprising an epitope, and more particularly, a peptide consisting of all or a part of an amino acid sequence at positions 221 to 327 of a human IgG4 heavy chain constant region represented by SEQ ID NO: 4, and comprising glutamic acid at position 299. The part of the amino acid sequence generally consist of 5 to 50 amino acids, and preferably 10 to 30 amino acids.
(43) In the “latex (particle) agglutination method”, agglutination usually does not occur without a plurality of monoclonal antibodies (i.e., polyclonal antibody) directed to different epitopes. However, since IgG4 itself is a dimer of a heterodimer consisting of a light chain and a heavy chain, there may be a monoclonal antibody used for agglutination reaction. In addition, if a plurality of antibody molecules are adsorbed onto latex particles, agglutination can occur even in a case where the antibody molecules are a monovalent antibody molecule (one antigen (recognition) binding site per molecule).
(44) An example of the “monovalent antibody” includes a Fab fragment that can be obtained by treating a natural antibody with papain or a single-chain variable fragment (scFV) obtained by binding a light chain variable region and a heavy chain variable region in genetic engineering.
(45) On the other hand, in the “latex (particle) agglutination inhibition method”, a polyclonal antibody is not suitable, because reactions in an assay system may vary in a case of using a plurality of antibodies having different binding constants, epitopes, and specificities, such as a polyclonal antibody.
(46) In addition, a monovalent antibody molecule is also not suitable, because where an antibody to be used is a monovalent antibody molecule, an agglutination reaction between latex particles through the antibody (adsorbed to antigen) does not occur. Two or more antigen (recognition) binding sites per molecule are required, and wild type immunoglobulins (IgG (divalent)), IgA (tetravalent), IgD (divalent), IgE (divalent), and IgM (decavalent)), F(ab′)2 (divalent) that can be obtained by pepsin treatment, or a multimer of a “monovalent antibody” is required.
(47) The “antigen (recognition) binding site” refers to a minimum site of an antibody that can bind to an antigen. It, but not limited to, refers to a site comprising complementarity determining regions (CDRs) of a heavy chain and a light chain. The antigen (recognition) binding site may have a V.sub.L region, a light chain variable region, and a V.sub.H region, a heavy chain variable region. These regions may be bound to each other genetically or through an SS bond.
(48) Generally, latex refers to a colloidal aqueous dispersion of a polymer resin, but the “latex particle” as used herein refers to a polymer resin having a uniform particle size. Any latex particle used in a general immunoassay method may be used, but a latex particle made of polystyrene as a main material is preferable.
(49) A particle size of the latex particle used in the present application is 50 nm to 500 nm, preferably 75 nm to 306 nm, and more preferably 100 nm to 111 nm.
(50) When a method according to an embodiment of the present invention is implemented, the method is performed with a kit for immunoassay of a human IgG4, comprising (1) an antibody of the present invention, (2) an isolated human IgG4 or a peptide fragment thereof, and (3) a solid support.
(51) In the kit, the solid support and the isolated human IgG4 or the peptide fragment solution thereof may be separately prepared, and when IgG4 is assayed, an antibody may be adsorbed on the solid support. Alternatively, an antibody adsorbed on the solid support in advance may be provided. The kit preferably comprises a washing solution to remove components un-adsorbed on the solid support after an isolated human IgG4 in a specimen or a peptide fragment thereof is bound to an antibody. An example of the washing solution can include a Tris buffer solution containing a surfactant.
(52) In addition, the kit of the present invention can further comprise a specimen dilute solution, if appropriate. The specimen dilute solution, for example, includes a buffer solution such as Tris and the like. Such a buffer solution may contain a chelating agent such as EDTA.2Na and a mineral salt such as sodium chloride, if appropriate.
(53) As mentioned above, “an isolated human IgG4 or a peptide fragment thereof” is used as the “antigen bound to the latex particle”. The isolated human IgG4 or the peptide fragment thereof is therefore required to comprise an epitope to which the antibody of the present invention binds. An isolated and purified natural IgG4 molecule may be used, or a “peptide fragment” genetically engineered, for example, obtained by cloning a part or the whole of a human IgG4 light chain or heavy chain constant region, may be used. A part or the whole of the human IgG4 heavy chain constant region may include a part or the whole of the amino acid sequence of SEQ ID NO: 4.
(54) In an embodiment of the present invention, IgG4 can be assayed by a sandwich ELISA method with a monoclonal antibody of the present invention. In this case, the assay can be implemented additionally using another monoclonal antibody against another IgG4, other than the antibody of the present invention. A specific example of the method for assaying IgG4 by sandwich assay is as follows. First, an antibody of the present invention as a primary antibody is adsorbed on a solid support such as a plate, the primary antibody is reacted with IgG4 in a specimen such as serum, and the solid support is cleaned. The adsorbed IgG4 and a biotinized secondary antibody such as a biotinized different monoclonal antibody or a polyclonal antibody against the IgG4 are reacted, the reactant is reacted with peroxidase-labeled streptavidin, and then a peroxidase enzyme reaction and a coloring reaction are carried out, thereby detecting IgG4. Alternatively, the same assay can be carried out using a secondary antibody directly labeled with an enzyme such as peroxidase and alkaline phosphatase. In addition, a substance bound to a secondary antibody to be labeled is not limited to an enzyme, and may be a radioactive isotope, a fluorescent substance, a magnetic material, or colloid depending on an assay method.
(55) In an embodiment of the present invention, when sandwich ELISA with an antibody of the present invention is carried out, a kit for sandwich ELISA can be used.
(56) When an assay of the present invention is carried out with sandwich ELISA, for example, IgG4 can be assayed with a kit for immunoassay of IgG4, comprising: i) a solid support, ii) an antibody of the present invention, iii) a labeled different antibody against the IgG4, and iv) a component for detecting the label.
(57) The component for detecting the label refers to a component for assaying a labeled antibody. In a case where the label is biotin, it may comprise peroxidase-labeled streptavidin, a peroxidase enzyme substrate of tetramethylbenzidine, and hydrogen peroxide. In a case where the label is alkaline phosphatase, it may comprise p-nitrophenyl phosphate. The kit may also include a washing solution, if appropriate.
(58) In the present invention, when the kit is used, the kit preferably comprised a washing solution for removing components un-adsorbed on the solid support after IgG4 in a specimen is bound to an antibody. An example of the washing solution can include a Tris buffer solution containing a surfactant. In addition, a kit of the present invention can further comprise a specimen dilution solution, if appropriate. The specimen dilution solution for example includes a buffer solution such as Tris and the like. Such a buffer solution may contain a chelating agent such as EDTA.Math.2Na and a mineral salt such as sodium chloride, if appropriate.
(59) Such a detection by the immunohistochemical staining method can be carried out using a kit comprising, as components, i) a monoclonal antibody of the present invention, ii) a secondary labeled antibody, and iii) a coloring reagent. Examples of the secondary labeled antibody include an animal-derived anti-IgG antiserum and an anti-IgG polyclonal antibody which are labeled with an enzyme such as peroxidase and alkaline phosphatase. The coloring reagent includes a reagent such as a chromogenic substrate usually used for coloring an enzyme used as a label.
(60) In the present invention, in a case where the chemiluminescent enzyme immunoassay method (CLEIA method), the fluorescent immunoassay method (FIA method), or the latex agglutination method is carried out with an antibody of the present invention, the method can be performed with a known kit for the chemiluminescent enzyme immunoassay method (CLEIA method), a known kit for the fluorescent immunoassay method (FIA method), or a known kit for the latex agglutination method.
EXAMPLES
(61) Hereinafter, the present invention will be described in more detail with reference to Examples, Comparative Examples, and Reference Examples, but the present invention is not limited to these Examples.
<Example 1> Production and Evaluation of Monoclonal Antibody
(62) (1) Selection and Preparation of Antigen for Producing Monoclonal Antibody
(63) A hybridoma for producing a monoclonal antibody that recognizes human IgG4 was produced in accordance with the known method (for example, Kohler and Milstein, Nature (1975) 256, p. 495-497). IgG4 used as an antigen was prepared from a human serum. Specifically, a human serum is fractionated and dialyzed by ammonium sulfate precipitation, and an IgG4 antigen was then purified according to the attachment to CaptureSelectIgG4 Affinity Matrix (Thermo Fisher Scientific).
(64) (2) Immunity
(65) 0.5 mg/mL of the human IgG4 purified by the above method from human serum was mixed with Freund's complete adjuvant (Sigma-Aldrich Co. LLC) in the same volume until they become emulsified, thereby preparing an emulsified suspension. Balb/c mouse aged 4-weeks was anesthetized with diethyl ether, and the emulsified suspension was intraperitoneally administered in an amount of 50 μg in terms of human IgG4 per mouse. An emulsified suspension prepared with Freund's incomplete adjuvant (Sigma-Aldrich Co. LLC) in the above-described manner was injected to each mouse 6 times at intervals of about two weeks. After about three weeks from sixth injection, the emulsified suspension was injected as a final immunity in the above-described manner.
(66) (3) Establishment of Hybridoma
(67) 3 days after the final immunity, the spleen surgically extracted from each mouse under diethyl ether anesthesia was aseptically dispersed to prepare spleen cells. The cell fusion was carried out using polyethylene glycol at a 5:1 fusion ratio of the number of spleen cells to the number of myeloma cells P3-X63-Ag8-U1 (P3U1). The fused cells were dispersed in a 10% FBS (HyClone Laboratories Inc.) ASF (Cosmo Bio Co., Ltd.) HAT (Cosmo Bio Co., Ltd.) medium, and the medium was dispensed into a 48-well plate (Sumitomo Bakelite Company Limited) and cultured under conditions of 37° C. and 5% CO.sub.2. 4481 hybridoma colonies were used for the following screening.
(68) (4) Screening
(69) The obtained hybridomas was subjected to screening of three stages to confirm 1) binding ability to IgG4, 2) specificity, and 3) adaptability to an immunological agglutination inhibition method.
(70) 1) Evaluation of Binding Ability to IgG4
(71) The purified human IgG4 used as the antigen was dispensed into a 96-well plate (Nunc) at 0.1 μg/well. The plate was shaken by a shaker under the condition of 700 rpm and 25.0° C. for 1 hour. The solution was discarded, the plate was cleaned with 300 μL of PBST (10 mM of sodium dihydrogen phosphate; 150 mM sodium chloride; and 0.05% polyoxyethylene (20) sorbitan monolaurate; pH 7.4) 3 times, 100 μL of a blocking buffer solution (10 mM of sodium dihydrogen phosphate; 150 mM sodium chloride; and 1% block ace powder (Sumitomo Dainippon Pharma Co., Ltd.); pH 7.4) was added to each well, and then the plate was stored at 4° C. one night or more. Similarly, after cleaning with PBST, the supernatant of the culture medium for the hybridoma colony was added to each well by 100 μL, and the plate was shaken under the same condition as mentioned above. Similarly, after cleaning with PBST, a HRP labeled anti-mouse IgG(H+L) antibody (Life Technologies Corporation) diluted 10000-fold with an antibody dilute buffer solution (10 mM of sodium dihydrogen phosphate; 150 mM sodium chloride; and 0.05% polyoxyethylene (20) sorbitan monolaurate; and 0.05% bovine serum albumin; pH 7.4) was added to each well by 100 μL, and the plate was shaken under the same condition as mentioned above. Similarly, after cleaning with PBST, 100 μL of SureBlue (KPL) was added. After the plate was left at room temperature for 15 minutes, 100 μL of 0.5 mol/L sulfuric acid (Wako Pure Chemical Corporation) was added. Absorbance at a wavelength of 450 nm was measured with a microplate reader (BIO-RAD Laboratories, Inc.). Binding ability to IgG4 was observed in 192 wells among 4481 wells in total, which were selected. The selected hybridomas were monoclonized, and the culture was continued.
(72) 2) Evaluation of Specificity
(73) Specificity of the antibody produced from the clone selected in 1) was evaluated. Myeloma human IgG1 (EMD Millipore), Myeloma human IgG2 (EMD Millipore), Myeloma human IgG3 (Sigma-Aldrich Co. LLC), Myeloma human IgG4 (EMD Millipore) were adjusted to 1 μg/mL with PBS(−). The adjusted samples were added to a 96-well plate (Thermo Fisher Scientific) by 100 μL, respectively. Shaking by a shaker as well as the procedures thereafter was carried out in the same manner as mentioned in 1). Among 192 clones, 8 clones strongly reacted to Myeloma human IgG4 as compared to Myeloma human IgG1, 2, and 3 were selected.
(74) 3) Evaluation of Adaptability to Immunological Particle Agglutination Inhibition Method
(75) Antibodies produced from the clones selected in 2) were evaluated in terms of adaptability to an immunological particle agglutination inhibition method.
(76) i) Preparation of First Reagent (R1)
(77) A solution containing each of antibodies derived from the selected 8 clones was added to a 2-[4-(2-hydroxyethyl)-1-piperazinyl]ethanesulfonic acid (HEPES) buffer solution 1 in a concentration of 15 μg/mL to prepare a first reagent.
(78) ii) Preparation of Second Reagent (R2)
(79) To 18 mL of a solution of latex particles made of polystyrene (concentration: 2%, particle size: 107 nm), 18 mL of 0.35 mg/mL human IgG4 solution roughly purified by an ordinary method from a human serum was added, and stirring was performed at room temperature for 1 hour to physically adsorb the human IgG4 onto the latex particles. Subsequently, centrifugation was carried out at 20,000 rpm for 90 minutes, and then a precipitate was recovered by discarding the supernatant. To the precipitate, 24 mL of a coating buffer solution containing 3% bovine serum albumin was added to suspend the precipitate, the resultant was completely dispersed by ultrasonication, and then stirred at room temperature for 1 hour. To the precipitate again obtained by carrying out centrifugation, 12 mL of the HEPES buffer solution 2 was added to suspend the precipitate, the resultant was completely dispersed by ultrasonication, and the concentration of latex was then adjusted to 0.12% by the HEPES buffer solution 2 to obtain a human IgG4 sensitive latex particle suspension. The human IgG4 sensitive latex particle suspension was used as a second reagent common to each first reagent.
(80) The composition of each reagent is as follows.
(81) HEPES Buffer Solution 1
(82) 25 mM of 2-[4-(2-hydroxyethyl)-1-piperazinyl]ethanesulfonic acid (Saikyo Kasei K.K.); 100 mM of 3-(cyclohexylamino)-1-propane sulfonic acid (Saikyo Kasei K.K.); 150 mM of sodium chloride (Wako Pure Chemical Corporation); 1 mM of EDTA.2Na (Wako Pure Chemical Corporation); 3.3% dextran 70 (Tokyo Chemical Industry Co., Ltd.); 0.1% Block-Ace (Sumitomo Dainippon Pharma Co., Ltd.); and 0.09% sodium azide (Wako Pure Chemical Corporation); pH 7.40
(83) Coating Buffer Solution
(84) 25 mM of 2-[4-(2-hydroxyethyl)-1-piperazinyl]ethanesulfonic acid (Saikyo Kasei K.K.); 150 mM of sodium chloride (Wako Pure Chemical Corporation); 1 mM of EDTA.2Na (Wako Pure Chemical Corporation); 3% bovine serum albumin (Millipore Corporation); and 0.09% sodium azide (Wako Pure Chemical Corporation); pH 7.50
(85) HEPES Buffer Solution 2
(86) 500 mM of 2-[4-(2-hydroxyethyl)-1-piperazinyl]ethanesulfonic acid (Saikyo Kasei K.K.); 25 mM of 2-morpholinoethanesulfonic acid (Wako Pure Chemical Corporation); 1 mM of EDTA.2Na (Wako Pure Chemical Corporation); 150 mM of L-arginine hydrochloride (Wako Pure Chemical Corporation); and 0.075% ProClin 950 (Sigma-Aldrich Co. LLC); pH 6.00
(87) iii) Measurement of Change Amount of Absorbance
(88) As standard samples, standard human serums with human IgG4 concentrations adjusted to 0.0, 1.6, 6.3, 12.5, 25.0, and 50.0 mg/dL were used. In addition, a saline solution was used as a sample with 0.0 mg/dL. Hitachi type 7180 automatic analyzer was used, 120 μL of the first reagent and 120 μL of the second reagent were reacted with 3 μL of a sample, and change amount of absorbance in the range of photometric points of 18 to 28 (corresponding to 1 minute to 4 minutes after addition of R2) was measured at a main wavelength of 570 nm and a complementary wavelength of 800 nm by a two-point end method (n=2). The antibodies produced by 5 clones among the 8 clones exhibited the greatest absorbance change amount at 0.0 mg/dL, and the absorbance change amount was decreased as the human IgG4 concentration was increased. Accordingly, the 5 clones (MaI4-09, MaI4-08, MaI4-01, MaI4-06, and MaI4-03) had adaptability to the immunological agglutination inhibition method. On the other hand, in the other 3 clones (MaI4-02, MaI4-04, and MaI4-05), the greatest absorbance change amount at 0.0 mg/dL, or decrease in absorbance change amount dependent on increase in human IgG4 concentration was not observed, and the other 3 clones had no adaptability to the immunological agglutination inhibition method (
(89) (5) Deposit
(90) The selected hybridomas MaI4-08 and MaI4-09 were received by the Patent Microorganisms Depositary in the National Institute of Technology and Evaluation with NITE Receipt Nos. NITE AP-02112 (MaI4-08) and NITE AP-02113 (MaI4-09) on Sep. 1, 2015, and confirmed to be viable on Sep. 14, 2015. Thereafter, Accession Nos. NITE P-02112 (MaI4-08) and NITE P-02113 (MaI4-09) were given (accession receipt was issued on Sep. 30, 2015).
(91) The deposit is specified by the following descriptions.
(92) [1] Name and address of the depository
(93) Name: National Institute of Technology and Evaluation, Patent Microorganisms Depositary
(94) Address: 2-5-8 Kazusa Kamatari Kisarazu-shi, Chiba, Japan (zip code 292-0818)
(95) [2] Deposit date: Sep. 1, 2015
(96) [3] Accession number
(97) NITE P-02112 (Hybridoma MaI4-08) NITE P-02113 (Hybridoma MaI4-09)
(98) Thereafter, for the international deposit of the same hybridoma, a Request for transfer of microorganisms was filed with the Patent Microorganism Depositary of the National Institute of Technology and Evaluation, and NITE Receipt Nos. NITE ABP-02112 (MaI4-08) and NITE ABP-02113 (MaI4-09) were received on Jun. 8, 2018.
(99) (6) Production of Monoclonal Antibodies by Cell Culture Method
(100) A method for producing antibodies with the hybridomas was carried out based on a known method (for example, Monoclonal antibody: Biochemistry experimental method, Tokyo Kagaku Dojin Co. Ltd., Japan). Specifically, in order to produce a monoclonal antibody, culture in virto and culture in vivo may be used. In the in virto culture method, a hybridoma is cultured in a culture medium, and in the in vivo culture method, mouse ascites is prepared. In virto culture was selected, and supernatants of culture mediums containing monoclonal antibodies were obtained.
(101) (7) Purification of Monoclonal Antibodies
(102) A method for purifying the monoclonal antibodies was carried out based on a known method (for example, Monoclonal antibody: Biochemistry experimental method, Tokyo Kagaku Dojin Co. Ltd., Japan). Affinity chromatography purification is generally used for purifying a monoclonal antibody, and a sepharose column on which protein G, protein A, or the like is carried is used. A protein G sepharose column (GE Healthcare) on which protein G is carried was selected to carry out the purification. Regarding the obtained monoclonal antibodies, absorbance at 280 nm was measured to observe the antibody concentration. The concentration was adjusted, and the monoclonal antibodies were then sterilized by filtration with a filter of 0.45 μm or less.
(103) (8) Observation of Antibodies
(104) Isotypes of MaI4-08 and MaI4-09-produced antibodies were determined according to the attachment to Iso-Gold Rapid Mouse-Monoclonal Isotyping Kit (with κ and λ) (BioAssay Works). The isotypes were shown in Table 1.
(105) TABLE-US-00001 TABLE 1 Hybridoma identification Heavy chain Light chain MaI4-08 IgG1 κ MaI4-09 IgG1 κ
(106) (9) Evaluation of Specificity by ELISA
(107) Myeloma human IgA1 (Abcam), Myeloma human IgA2 (Abcam), Myeloma human IgD (Abcam), Myeloma human IgE (Abcam), Myeloma human IgM (Abcam), Myeloma human IgG1 (EMD Millipore), Myeloma human IgG2 (EMD Millipore), Myeloma human IgG3 (Sigma-Aldrich Co. LLC), and Myeloma human IgG4 (EMD Millipore) were adjusted to 1 μg/mL with PBS(−). The adjusted samples were added to a 96-well plate (Thermo Fisher Scientific) by 100 μL, respectively. The plate was shaken by a shaker under the condition of 700 rpm and 25.0° C. for 1 hour. The solutions were discarded, the plate was cleaned with 300 μL of PBST 3 times, 100 μL of a blocking buffer solution was added to each well, and then the plate was stored at 4° C. one night or more. Similarly, after cleaning with PBST, the MaI4-08 and MaI4-09-produced antibodies were adjusted to 1 μg/mL with an antibody dilute buffer solution and then added to each well by 100 μL, and the plate was shaken under the same condition as mentioned above. Similarly, after cleaning with PBST, a HRP labeled anti-mouse IgG antibody (Abcam) diluted 4000-fold with an antibody dilute buffer solution was added to each well by 100 μL, and the plate was shaken under the same condition as mentioned above. Similarly, after cleaning with PBST, 100 μL of SureBlue (KPL) was added. 5 or 3 minutes later, 100 μL of 0.5 mol/L sulfuric acid (Wako Pure Chemical Corporation) was added to each of MaI4-08 and MaI4-09. Absorbance at a wavelength of 450 nm was measured with a microplate reader (BIO-RAD Laboratories, Inc.). As a result, a strong signal was given to Myeloma human IgG4 as compared to the other samples (Tables 2 and 3, and
(108) TABLE-US-00002 TABLE 2 (−) IgA1 IgA2 IgD IgE IgM IgG1 IgG2 IgG3 IgG4 (−) 0.058 0.052 0.051 0.055 0.052 0.053 0.049 0.045 0.048 0.050 MaI4-08 0.042 0.043 0.043 0.042 0.041 0.042 0.048 0.047 0.044 2.044
(109) TABLE-US-00003 TABLE 3 (−) IgAl IgA2 IgD IgE IgM IgG1 IgG2 IgG3 IgG4 (−) 0.040 0.041 0.043 0.047 0.049 0.044 0.046 0.042 0.045 0.041 MaI4-09 0.048 0.058 0.050 0.051 0.050 0.055 0.063 0.064 0.052 2.284
(110) (10) Amino Acid Sequence Analysis of Monoclonal Antibody
(111) MaI4-08 and MaI4-09 each were subjected to mRNA extraction, cloning, and sequencing according to the protocol of Fusion Antibodies Ltd. As a result of analysis, variable regions of MaI4-08 were SEQ ID NO: 5 (heavy chain variable region) and SEQ ID NO: 6 (light chain variable region), variable regions of MaI4-09 were SEQ ID NO: 7 (heavy chain variable region) and SEQ ID NO: 8 (light chain variable region). The amino acid sequences of CDRs were as shown in Table 4.
(112) TABLE-US-00004 TABLE 4 CDR1 CDR2 CDR3 MaI4-08 Heavy SYILH YINPYNDGTKYKEKFKG SGGGYGNYAWFAY chain (SEQ ID NO: 9) (SEQ ID NO: 10) (SEQ ID NO: 11) Light RASQDIGSSLN ATSSLDS LQYASYPPT chain (SEQ ID NO: 12) (SEQ ID NO: 13) (SEQ ID NO: 14) MaI4-09 Heavy SSVMH YINPYNDGTRYNEKFQG SFYYGNSHVLFAY chain (SEQ ID NO: 15) (SEQ ID NO: 16) (SEQ ID NO: 17) Light KASQDINSYLS RANRLVD LQYDELPYT chain (SEQ ID NO: 18) (SEQ ID NO: 19) (SEQ ID NO: 20)
<Example 2> Assay Reagent Preparation and Assay with MaI4-08 and MaI4-09-Produced Antibodies
(113) (1) Preparation of Reagents
(114) 1) Preparation of First Reagent (R1)
(115) A MaI4-08 or MaI4-09-produced antibody solution was added to a 2-[4-(2-hydroxyethyl)-1-piperazinyl]ethanesulfonic acid (HEPES) buffer solution 1 in a concentration of 15 μg/mL to prepare a first reagent. Similarly, as control reagents, a MaI4-05-produced antibody and a commercially available antibody HP6025 (Millipore Corporation) were added to a HEPES buffer solution 1 to prepare solutions.
(116) 2) Preparation of Second Reagent (R2)
(117) To 18 mL of a solution of latex particles made of polystyrene (concentration: 2%, particle size: 107 nm), 18 mL of 0.35 mg/mL human IgG4 solution roughly purified by a general method from a human serum was added, and stirring was performed at room temperature for 1 hour to physically adsorb the human IgG4 onto the latex particles. Subsequently, centrifugation was carried out at 20,000 rpm for 90 minutes, and then a precipitate was recovered by discarding the supernatant. To the precipitate, 24 mL of coating buffer solution containing 3% bovine serum albumin was added to suspend the precipitate, the resultant was completely dispersed by ultrasonication, and then stirred at room temperature for 1 hour. To the precipitate again obtained by carrying out centrifugation, 12 mL of the HEPES buffer solution 2 was added to suspend the precipitate, the resultant was completely dispersed by ultrasonication, and the concentration of latex was then adjusted to 0.12% by the HEPES buffer solution 2 to obtain a human IgG4 sensitive latex particle suspension. The human IgG4 sensitive latex particle suspension was used as a second reagent common to each first reagent.
(118) The composition of each reagent is as follows.
(119) TABLE-US-00005 TABLE 5 HEPES buffer solution 1 2-[4-(2-Hydroxyethyl)- Saikyo Kasei K.K. 25 mM 1-piperazinyl] ethanesulfonic acid 3-(Cyelohexylamino)- Saikyo Kasei K.K. 100 mM 1-propane sulfonic acid Sodium chloride Wake Pure Chemical Corporation 150 mM EDTA .Math. 2Na Wake Pure Chemical Corporation 1 mM Dextran 70 Tokyo Chemical Industry Co., Ltd. 3.3% Block-Ace Sumitomo Dainippon Pharma Co., Ltd. 0.1% Sodium azide Wako Pure Chemical Corporation 0.09% pH7.40
(120) TABLE-US-00006 TABLE 6 Coating buffer solution 2-[4-(2-Hydroxyethyl)- Saikyo Kasei K.K. 25 mM 1-piperazinyl] ethanesulfonic acid Sodium chloride Wako Pure Chemical Corporation 150 mM EDTA .Math. 2Na Wako Pure Chemical Corporation 1 mM Bovine serum albumin Millipore Corporation 3% Sodium azide Wako Pure Chemical Corporation 0.09% pH7.50
(121) TABLE-US-00007 TABLE 7 HEPES buffer solution 2 2-[4-(2-Hydroxyethyl)- Saikyo Kasei K.K. 500 mM 1-piperazinyl] ethanesulfonic acid 2-Morpholinoethanesulfonic Wako Pure Chemical Corporation 25 mM acid EDTA .Math. 2Na Wako Pure Chemical Corporation 1 mM L-Arginine hydrochloride Wako Pure Chemical Corporation 150 mM ProClin 950 Sigma-Aldrich Co. LLC 0.075% pH6.00
(122) (2) Measurement of Change Amount of Absorbance
(123) Standard human serums with human IgG4 concentrations adjusted to 1.6, 6.3, 12.5, 25, and 50 mg/dL were used as standard samples. In the assay, specimen samples were diluted 20-fold and then assayed, and the final standard sample concentrations are therefore set to 20-fold higher ones, namely 31.3, 125, 250, 500, and 1000 mg/dL. The final concentrations of all samples described later are set to 20-fold higher ones. A saline solution containing 0.85% sodium chloride was used as a sample with a human IgG4 concentration of 0.0 mg/dL. For the measurement of human IgG4 concentrations, Hitachi type 7180 automatic analyzer was used, 120 μL of the first reagent and 120 μL of the second reagent were reacted with 3 μL of a sample, and change amounts of absorbance in the range of photometric points of 18 to 28 (corresponding to 1 minute to 4 minutes after addition of R2) were measured at a main wavelength of 570 nm and a complementary wavelength of 800 nm by a two-point end method (n=2).
(124) (3) Measurement Result
(125) Upon the measurement of the human IgG4 concentrations with the above-mentioned reagents, change amounts of absorbance are shown in Table 8 and
(126) TABLE-US-00008 TABLE 8 Human IgG4 concentration Absorbance change amount in 800 nm (mg/dL) MaI4-08 MaI4-09 MaI4-05 HP6025 0.0 0.4123 0.5648 0.0029 0.0030 31.3 0.3928 0.5193 0.0027 0.0036 125 0.3557 0.4305 0.0024 0.0033 250 0.3144 0.3519 0.0021 0.0034 500 0.2151 0.2414 0.0021 0.0031 1000 0.0350 0.0955 0.0016 0.0030
(127) As demonstrated in Table 8 and
(128) (4) Evaluation of Dilution Linearity
(129) In a case where the MaI4-08-produced antibody or the MaI4-09-produced antibody was used as an anti-human IgG4 mouse monoclonal antibody in the first reagent, dilution linearity was evaluated. A standard human serum with a human IgG4 concentration adjusted to 1000 mg/dL, and specimen samples serially diluted with a saline solution containing 0.85% sodium chloride were used as samples. A saline solution was used for a sample having a human IgG4 concentration of 0.0 mg/dL. For the measurement of the human IgG4 concentration, 120 μL of the first reagent and 120 μL of the second reagent were reacted with 3 μL of a sample using Hitachi type 7180 automatic analyzer, and change amount of absorbance in the range of photometric points of 18 to 28 (corresponding to 1 minute to 4 minutes after addition of R2) was measured at a main wavelength of 570 nm and a complementary wavelength of 800 nm by a two-point end method (n=2). A calibration curve was created from the results of Table 8, and the human IgG4 concentration in a sample was calculated therefrom.
(130) (5) Evaluation of Tolerance to Prozone Phenomenon
(131) In a case where the MaI4-08-produced antibody or the MaI4-09-produced antibody was used as an anti-human IgG4 mouse monoclonal antibody in the first reagent, tolerance to a prozone phenomenon was evaluated. A standard human serum with a human IgG4 concentration adjusted to 8000 mg/dL and specimen samples serially diluted with a saline solution containing 0.85% sodium chloride were used as samples. For the measurement of human IgG4 concentrations, 120 μL of the first reagent and 120 uL of the second reagent were reacted with 3 uL of a sample using Hitachi type 7180 automatic analyzer, and change amount of absorbance in the range of photometric points of 18 to 28 (corresponding to 1 minute to 4 minutes after addition of R2) was measured at a main wavelength of 570 nm and a complementary wavelength of 800 nm by a two-point end method (n=2). A calibration curve was created from the results of Table 8, and the human IgG4 concentration in a sample was calculated therefrom.
(132) (6) Evaluation of Specificity to Human IgG4
(133) In a case where the MaI4-08-produced antibody or the MaI4-09-produced antibody was used as an anti-human IgG4 mouse monoclonal antibody in the first reagent, specificity to human IgG4 was evaluated. As a sample, Myeloma human IgG4 solution (EMD Millipore) adjusted to 3000 mg/dL was used. In addition, as control samples, Myeloma human IgG1 solution (EMD Millipore), Myeloma human IgG2 solution (EMD Millipore), and Myeloma human IgG3 solution (Sigma-Aldrich Co. LLC) prepared similarly to the above were used. A saline solution was used as a blank sample. For the measurement of human IgG4 concentrations, 120 μL of the first reagent and 120 μL of the second reagent were reacted with 3 μL of a sample using Hitachi type 7180 automatic analyzer, and change amount of absorbance in the range of photometric points of 18 to 28 (corresponding to 1 minute to 4 minutes after addition of R2) was measured at a main wavelength of 570 nm and a complementary wavelength of 800 nm by a two-point end method (n=2). A calibration curve was created from the results of Table 8 and the human IgG4 concentration in a sample was calculated therefrom.
(134) (7) Assay Results
(135) The results are shown in
(136) TABLE-US-00009 TABLE 9 MaI4-08 Sample Blank IgG1 IgG2 IgG3 IgG4 Measured value 0.0 10.1 12.8 4.1 1088.8
(137) TABLE-US-00010 TABLE 10 MaI4-09 Sample Blank IgG1 IgG2 IgG3 IgG4 Measured value 0.0 9.5 11.8 4.1 1331.0
(138) In a case where the anti-human IgG4 mouse monoclonal antibodies produced by the hybridoma of the present invention was used in the first reagent, it was confirmed that the dilution linearity was sufficient within the calibration range of 0 to 1000 mg/dL (
(139) As described above, it was newly found that there are antibodies that are not suitable for the immunological particle agglutination inhibition method not only in the screening stage but also in an antibody (HP6025) reported as an anti-IgG4 monoclonal antibody (Non-Patent Literature 6). In order to clarify difference between an antibody suitable for the immunological particle agglutination inhibition method and an antibody not suitable for the immunological particle agglutination inhibition method, interaction analysis and epitope analysis of the antibodies were carried out.
<Example 3> Interaction Analysis
(140) MaI4-08 and MaI4-09-produced antibodies, and, as a control, MaI4-05-produced antibody and 1 mg/mL of HP6025 were adjusted to 1 mg/mL. In addition, 1 mg/mL of IgG4 was prepared from the one purified from human serum. According to the protocol of Sumika Chemical Analysis Service, Ltd., IgG4 was immobilized onto a chip by an amino coupling method, and a sensorgram was obtained by a Biacore model. The obtained binding rate constant (k.sub.a), dissociation rate constant (k.sub.d), and dissociation constant (KD) were as shown in Table 11.
(141) TABLE-US-00011 TABLE 11 k.sub.a[M.sup.−1S.sup.−1] k.sub.d[S.sup.−1] KD[M] MaI4-08 5.492E+05 2.229E−04 4.058E−10 MaI4-09 4.419E+05 1.444E−04 3.268E−10 MaI4-05 2.858E+04 6.492E−05 2.272E−09 HP6025 1.669E+03 6.814E−04 4.084E−07
(142) Among 3 types of antibodies, the binding rate constant k.sub.a of the MaI4-05-produced antibody was one-tenth or less of those of the MaI4-08 and MaI4-09-produced antibodies. The binding rate constant k.sub.a of the HP6025 antibody was one-hundredth or less of those of the MaI4-08 and MaI4-09-produced antibodies.
<Example 4> Analysis of Epitope
(143) From Uniprot, an amino acid sequence of the human IgG4 heavy chain constant region was obtained (P01861, SEQ ID NO: 4). The obtained amino acid sequence was partially or not deleted to obtain the amino acid sequences H1 to 12 (
(144) In addition, in an amino acid sequence (H10, SEQ ID NO: 33) in the human IgG4 heavy chain CH3 region, human IgG4-specific sequences were partially substituted with corresponding amino acids of the human IgG1 heavy chain constant region to obtain the amino acid sequences H31 to 39 (
(145) Based on the designed amino acid sequences, base sequences suitable for expressing protein in E. coli were designed according to the protocol of GenScript Corporation, thereby preparing vector pGEX-6P-1 (GE Healthcare Bio-Sciences Corp.) to which the respective base sequences are inserted. The prepared expression plasmid was introduced to E. coli BL 21 strain, thereby obtaining a transformant. The transformant was cultured by an ordinary method and a protein expression was induced by IPTG. After the cells were collected by centrifugation, the cells were dissolved with an ordinary lysis solution, and subjected to ultrasonication. 6 μL of an SDS sample buffer solution was added to 6 μL of the obtained lysate. The respective prepared samples were subjected to a heat treatment at 95° C. for 5 minutes. 10 μL of the E. coli disrupted sample was added to each well of 5 to 20% electrophoresis gel (Atto Corportation) to which an SDS electrophoresis buffer solution was added. Similarly, a molecular weight standard (Bio-Rad Laboratories, Inc.) was added to each well and electrophoresed. After completing the electrophoresis, the electrophoresis gel was transcribed to a PVDF membrane (Millipore Corporation) with a transfer buffer solution. The PVDF membrane was immersed in a membrane blocking buffer solution, and then shaking was carried out at room temperature for 30 minutes. Amino groups of MaI4-08, MaI4-09, and MaI4-05-produced antibodies were subjected to a POD labeling treatment with a POD labeling kit (Dojindo Molecular Technologies, Inc.). The obtained labeled antibodies each were diluted 1000-fold by PBST. After the PVDF membrane was cleaned with PBST, the antibody solutions prepared each were added to the PVDF membrane, and then the reaction was performed at room temperature for 1 hour. After the PVDF membrane was cleaned by PBST, a signal was detected with ECL Prime Western Blotting Detection Reagents (GE Healthcare) with Image Quant Las4000.
(146) As a result, regarding both the MaI4-08 and MaI4-09-produced antibodies, signals were observed in relation to H-1, H-7, H-8, H-9, and H-10. Accordingly, it was found that the epitopes of the MaI4-08 and MaI4-09-produced antibodies are present in an amino acid sequence at positions 221 to 327 of the human IgG4 heavy chain constant region (
(147) Regarding the MaI4-08 and MaI4-09-produced antibodies, signals were also observed under the condition in which glutamic acid was maintained at position 299 (H-10, H-31, H-32, H-34, and H-37), but signals were not observed under the condition in which glutamic acid at position 299 was substituted with glutamine (H-33, H-35, H-36, and H-38). Therefore, it was found that the epitopes of the MaI4-08 and MaI4-09-produced antibodies were present in the amino acid sequence at positions of 221 to 327 of the human IgG4 heavy chain constant region, the amino acid sequence being necessary to contain a glutamic acid residue at position 299 in the human IgG4 heavy chain constant region (
(148) Meanwhile, regarding the MaI4-05-produced antibody, a signal was observed only in the amino acid sequence at positions 99 to 110, namely a sequence containing a hinge region (H-1, H-2, H-3, H-4, H-5, H-7, and H-12). Therefore, it was found that the epitope of the MaI4-05-produced antibody was present in the amino acid sequence at positions of 99 to 110 of the human IgG4 heavy chain constant region (
(149) The amino acid sequences of H-1 to H-12 and H-31 to H-39 are shown as follows.
(150) TABLE-US-00012 TABLE 12-1 Sample name Amino acid sequence H1 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL SEQ ID NO: 4 YSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHE ALHNHYTQKSLSLSLGK H2 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL SEQ ID NO: 25 YSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTT H3 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL SEQ ID NO: 26 YSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAK H4 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL SEQ ID NO: 27 YSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVH H5 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL SEQ ID NO: 28 YSLSSVVTVPSSSLGTKTYTCNVDHPSNTKVDKRVESKYGPPCPSCP H6 ASTKGPSNFPLAPCSRSTSESTAALGUNKDYFPEPVTVANSGALTSGVHTFPA SEQ ID NO: 29 H7 VLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGG SEQ ID NO: 30 PSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVF SCSVMHEALHNHYTQKSLSLSLGK H8 APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPR SEQ ID NO: 31 EEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPS QEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR WQEGNVFSCSVMHEALHNHYNHYTQSLSLGK H9 NAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQ SEQ ID NO: 32 VYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSR LTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK H10 GQPREPQVYT LPPSQEEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN SEQ ID NO: 33 YKTTPPVLDSDGSFFLYSRL TVDKSRWQEG NVFSCSVMHE ALHNHYTQKS LSLSLGK
(151) TABLE-US-00013 TABLE 12-2 H11 PPVLDS DGSFFLYSRL TVDKSRWQEG NVFSCSVMHE ALHNYTQKS LSLSLGK SEQ ID NO: 34 H12 ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVD SEQ ID NO: 35 GVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKCVSNKGLPSSIEKTISKAK H31 GQPREPQVYT LPPSREEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN SEQ ID NO: 36 YKTTPPVLDS DGSFFLYSRL TVDKSRWQEG NVFSCSVMHE ALHNHYTQKS LSLSLGK H32 GQPREPQVYT LPPSQEEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN SEQ ID NO: 37 YKTTPPVLDS DGSFFLYSKL TVDKSRWQEG NVFSCSVMHE ALHNHYTQKS LSLSLGK H33 GQPREPQVYT LPPSQEEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN SEQ ID NO: 38 YKTTPPVLDS DGSFFLYSRL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSLGK H34 GQPREPQVYT LPPSQEEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN SEQ ID NO: 39 YKTTPPVLDS DGSFFLYSRL TVDKSRWQEG NVFSCSVMHE ALHNHYTQKS LSLSPGK H35 GQPREPQVYT LPPSREEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN SEQ ID NO: 40 YKTTPPVLDS DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSPGK H36 GQPREPQVYT LPPSRDELTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN SEQ ID NO: 41 YKTTPPVLDS DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSPGK H37 GQPREPQVYT LPPSQEEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN SEQ ID NO: 42 YKTTPPVLDS DGSFFLYSKL TVDKSRWQEG NVFSCSVMHE ALHNHYTQKS LSLSPGK H38 GQPREPQVYT LPPSQEEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN SEQ ID NO: 43 YKTTPPVLDS DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSPGK H39 GQPREPQVYT LPPSRDELTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN SEQ ID NO: 44 YKTTPPVLDS DGSFFLYSKL TVDKSRWQEG NVFSCSVMHE ALHNHYTQKS LSLSPGK
(152) In addition, compositions of the respective reagents are as follows.
(153) TABLE-US-00014 TABLE 13 SDS sample buffer solution Tris Sigma-Aldrich Co. LLC 125 mM SDS Wako Pure Chemical Corporation 4% Sucrose Wako Pure Chemical Corporation 10% Bromophenol blue Nacalai Tesque Inc, 0.01% DTT Sigma-Aldrich Co. LLC 200 mM SDS electrophoresis buffer solution Tris Sigma-Aldrich Co. LLC 3.03 g/L Glycine Wako Pure Chemical Corporation 14.4 g/L SDS Wake Pure Chemical Corporation 1.0 g/L Transfer buffer solution Tris Sigma-Aldrich Co. LLC 3.03 g/L Glycine Wako Pure Chemical Corporation 14.1 g/L SDS Wako Pure Chemical Corporation 0.1 g/L PBST Sodium dihydrogen Wako Pure Chemical Corporation 10 mM phosphate Sodium chloride Wako Pure Chemical Corporation 150 mM Polyoxyethylene (20) Wako Pure Chemical Corporation 0.05% sorbitan monolaurate pH7.4 Membrane blocking buffer solution Sodium dihydrogen Wako Pure Chemical Corporation 10 mM phosphate Sodium chloride Wako Pure Chemical Corporation 150 mM Polyoxyethylene (20) Wako Pure Chemical Corporation 0.05% sorbitan monolaurate Skim milk Wako Pure Chemical Corporation 5% pH7.4
INDUSTRIAL APPLICABILITY
(154) As described in detail above, according to the immunoassay method of the present invention, a substance of interest can be specifically and accurately assayed while excluding influence of competitive substances (IgG1 to 3) in a reaction system by means of an antibody with high reactivity and selectivity to a substance of interest (human IgG4). With an anti-human IgG4 antibody of the present invention, human IgG4 in a sample can be specifically detected and assayed, and it is extremely effective in the field of a diagnosis or a clinical examination for an IgG4-related disease.
(155) Sequence Listing