PLANTS AND METHODS FOR PRODUCING 2-PYRONE-4, 6-DICARBOXYLIC ACID (PDC)

20220195447 · 2022-06-23

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention provides a genetically modified plant or plant cell comprising a nucleic acid encoding one or more heterologous enzymes operably linked a promoter, wherein one or more heterologous enzymes synthesizes 2-pyrone-4,6-dicarboxylic acid (PDC).

    Claims

    1. A genetically modified plant or plant cell comprising a nucleic acid encoding one or more heterologous enzymes operably linked a promoter, wherein one or more heterologous enzymes synthesizes 2-pyrone-4,6-dicarboxylic acid (PDC).

    2. The genetically modified plant or plant cell of claim 2 comprising one or more nucleic acids encoding protocatechuate 4,5-dioxygenase (PmdAB), or a homologous enzyme thereof, and/or 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (PmdC), or a homologous enzyme thereof, or operably linked to one or more promoters, wherein the genetically modified plant or plant cell is capable of producing protocatechuate (PCA) and produces 2-pyrone-4,6-dicarboxylic acid (PDC).

    3. The genetically modified plant or plant cell of claim 2 comprising a nucleic acid encoding 3-dehydroshikimate dehydratase (QsuB), or a homologous enzyme thereof.

    4. The genetically modified plant or plant cell of claim 2 comprising a nucleic acid encoding feedback-resistant DAHP synthase (AroG*), or a homologous enzyme thereof.

    5. The genetically modified plant or plant cell of claim 2 comprising a nucleic acid encoding p-hydroxybenzoate 3-monooxygenase (PobA), or PobA*, or a homologous enzyme thereof, and chorismate pyruvate-lyase (UbiC), or a homologous enzyme thereof.

    6. The genetically modified plant or plant cell of claim 5 comprising a nucleic acid encoding feedback-resistant DAHP synthase (AroG*), or a homologous enzyme thereof.

    7. The genetically modified plant or plant cell of claim 2 comprising one or more nucleic acids encoding 3-deoxy-D-arabinoheptulosonate 7-phosphate synthase (AroG), or feedback-resistant DAHP synthase (AroG*), or a homologous enzyme thereof, and 3-dehydroshikimate dehydratase (QsuB), or a homologous enzyme thereof, wherein the genetically modified plant or plant cell is capable of producing erythrose 4-phosphate (E4P) and phosphoenolpyruvate (PEP).

    8. The genetically modified plant or plant cell of claim 1 comprising one or more nucleic acids encoding PobA*, or a homologous enzyme thereof, chorismate pyruvate-lyase (UbiC), or a homologous enzyme thereof, feedback-resistant DAHP synthase (AroG*), or a homologous enzyme thereof, protocatechuate 3,4-dioxygenase subunit alpha (PcaG), or a homologous enzyme thereof, and protocatechuate 3,4-dioxygenase subunit beta (PcaH), or a homologous enzyme thereof, wherein the genetically modified plant or plant cell synthesizes 2-pyrone-4,6-dicarboxylic acid (PDC).

    9. A genetically modified plant or plant cell comprising one or more nucleic acids encoding protocatechuate 4,5-dioxygenase (PmdAB), or a homologous enzyme thereof, and/or 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (PmdC), or a homologous enzyme thereof, or operably linked to one or more promoters, wherein the genetically modified plant or plant cell is capable of producing protocatechuate (PCA) and produces 2-pyrone-4,6-dicarboxylic acid (PDC). A genetically modified plant or plant cell comprising one or more nucleic acids encoding one or more of the following enzymes: 3-deoxy-D-arabinoheptulosonate 7-phosphate synthase (AroG), or feedback-resistant DAHP synthase (AroG*), chorismate pyruvate-lyase (UbiC), 3-dehydroshikimate dehydratase (QsuB), p-hydroxybenzoate 3-monooxygenase (PobA), or PobA* (such as a Y385F/T294A PobA mutant), protocatechuate 4,5-dioxygenase (PmdAB), 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (PmdC), protocatechuate 3,4-dioxygenase (PcaGH), and 2-pyrone-4,6-dicarboxylate hydrolase (LigI), or any homologous enzyme of any of the enzymes thereof, operably linked to one or more promoters, wherein the genetically modified plant or plant cell is capable of producing chorismate (CHA) and produces 2-pyrone-4,6-dicarboxylic acid (PDC).

    10. A method for producing a PDC comprising: (a) optionally genetically modifying a plant or plant cell to produce a genetically modified plant or plant cell of the present invention, (b) growing or culturing the genetically modified plant or plant cell to produce a PDC, and (c) optionally recovering the PDC produced from the plant or plant cell.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0035] The foregoing aspects and others will be readily appreciated by the skilled artisan from the following description of illustrative embodiments when read in conjunction with the accompanying drawings.

    [0036] FIG. 1. Schematic diagram of the metabolic pathway implemented in plant plastids to produce PDC. Red arrows indicate biosynthetic steps catalyzed by bacterial enzymes introduced in Arabidopsis. Abbreviation are: E4P, erythrose 4-phosphate; PEP, phosphoenolpyruvate; PCA, protocatechuic acid; CHMS, 4-carboxy-2-hydroxymuconate-6-semialdehyde; PDC, 2-pyrone-4,6-dicarboxylic acid. Enzymes names: AroG*, feedback-insensitive 3-deoxy-D-arabino-heptulosonate (DAHP) synthase with L175Q mutation; PmdA, PCA 4,5-dioxygenase alpha subunit; PmdB, PCA 4,5-dioxygenase beta subunit; PmdC, CHMS dehydrogenase; QsuB, 3-dehydroshikimate dehydratase.

    [0037] FIG. 2A. Production of PDC in tobacco leaves by transient expression of AroG*, QsuB, and the proposed PDC biosynthetic enzymes PmdA, PmdB, and PmdC. In-planta conversion of PCA into PDC requires co-expression of the PmdA, PmdB, and PmdC genes. Error bars represent the SE from three biological replicates (n=3). Asterisks indicate significant differences using the unpaired Student's t-test (*P<0.01). Nd, not detected.

    [0038] FIG. 2B. Production of PDC in tobacco leaves by transient expression of AroG*, QsuB, and the proposed PDC biosynthetic enzymes PmdA, PmdB, and PmdC. Representative HPLC-ESI-TOF MS chromatograms of metabolite extracts obtained from leaves infiltrated with buffer only (top panel) or co-infiltrated with AroG*, QsuB, pmdA, pmdB, and pmdC (middle panel) in comparison with a PDC standard solution (lower panel). Insets show PDC mass spectra.

    [0039] FIG. 3. Schematic representation of binary vectors used for Arabidopsis transformations. (A) AroG* expression cassette used for the transformation of an Arabidopsis QsuB background. (B) Construct used for the production of PDC in an Arabidopsis QsuB background (C) Construct used for the production of PDC in wildtype Arabidopsis. Boxes labeled “Schl” denote plastid transit peptides. Abbreviations are: Schl1, transit peptide of the sunflower (Helianthus annuus) ribulose-1,5-bisphosphate carboxylase small subunit (RuBisCo, GenBank: XP_021992670); Schl2, transit peptide from Arabidopsis chloroplastic photosystem II 22 kDa protein (GenBank: AT1G44575); Schl3, synthetic transit peptide from fused sunflower and maize RuBisCo small subunits (Lebrun et al., 1992). pAtCESA4, pAtC4H, pAtGAUT 12, pAtC3′H, and pAtCESA7 designate the promoters of Arabidopsis cellulose synthase 4 (At5G44030), cinnamate 4-hydroxylase (At2G30490), galacturonosyltransferase 12 (At5G54690), coumarate 3′-hydroxylase (AT2G40890), and cellulose synthase 7 (AT5G17420) genes, respectively. Hyg.sup.R denotes the aminoglycoside phosphotransferase marker gene used for plant selection.

    [0040] FIG. 4. Enhancement of PCA production in a transgenic QsuB Arabidopsis background by overexpressing feedback-resistant DAHP synthase (AroG*). (A) Detection by PCR of AroG* (a) and QsuB (b) in five independent transformants containing the pAroG cassette. The pAroG plasmid (PC) and gDNA obtained from Arabidopsis wildtype (WT) and the QsuB parental background (QsuB) were used as controls. (B) Comparison of the growth parameters (height and dry weight) between WT and transgenic Arabidopsis. (B) PCA titers and (C) lignin content in Arabidopsis wildtype (WT), QsuB parental background (QsuB), and AroG* x QsuB lines. Error bars represent the SE from four biological replicates (n=4). Asterisks indicate significant differences from the QsuB line (in B) or the wildtype (in C) using the unpaired Student's t-test (*P<0.05; **P<0.01).

    [0041] FIG. 5. Production of PDC in a transgenic QsuB Arabidopsis background. (A) Detection by PCR of AroG* (a), PmdA (b), PmdB (c), and PmdC (d) in three independent transformants containing the pPDC-4G construct. The pPDC-4G plasmid (PC) and gDNA obtained from Arabidopsis wildtype (WT) and the QsuB parental background (QsuB) were used as controls. (B) PCA and PDC titers and (C) lignin content in Arabidopsis wildtype (WT), QsuB parental background (QsuB), and PDC-4G x QsuB lines. Error bars represent the SE from four biological replicates (n=4). Nd, not detected. (D) Growth parameters (height and dry weight) of wild-type (WT) and transgenic Arabidopsis lines. Error bars represent the SE from twelve biological replicates (n=12). Asterisks indicate significant differences from the wild type using the unpaired Student's t-test (*P<0.01).

    [0042] FIG. 6A. Production of PDC production in wildtype Arabidopsis. Detection by PCR of AroG* (a), QsuB (b) PmdA (c), PmdB (d), and PmdC (e) in six independent transformants containing the pPDC-5G construct. The pPDC-5G plasmid (PC) and gDNA obtained from Arabidopsis wildtype (WT) were used as controls.

    [0043] FIG. 6B. Production of PDC production in wildtype Arabidopsis. PCA and PDC titers in Arabidopsis wildtype (WT) and PDC-5G lines. Nd, not detected. Error bars represent the SE from four biological replicates (n=4). Asterisks indicate significant differences from the wild type using the unpaired Student's t-test (**P<0.01, *P<0.05).

    [0044] FIG. 6C. Production of PDC production in wildtype Arabidopsis. Lignin contents in Arabidopsis wildtype (WT) and PDC-5G lines. Nd, not detected. Error bars represent the SE from four biological replicates (n=4). Asterisks indicate significant differences from the wild type using the unpaired Student's t-test (**P<0.01, *P<0.05).

    [0045] FIG. 6D. Production of PDC production in wildtype Arabidopsis. Growth parameters (height and dry weight) of wild-type (WT) and transgenic Arabidopsis lines. Error bars represent the SE from eight biological replicates (n=8). Asterisks indicate significant differences from the wild type using the unpaired Student's t-test (**P<0.01,*P<0.05).

    [0046] FIG. 7. Biomass saccharification of wild-type (WT) and representative transgenic lines. Amounts of (A) glucose and (B) xylose released from biomass after 96-h enzymatic digestion are shown. Values are means±SE of four biological replicates (n=4). Asterisks indicate significant differences from the wild type using the unpaired Student's t-test (*p<0.01).

    [0047] FIG. 8. Verification by PCR of the integrity of plasmids extracted from Agrobacterium strains used for Arabidopsis transformations using the primers listed in Table 1. Plasmids are pAroG (A), pPDC-4G (B), and pPDC-5G (C). Amplified DNA correspond to the genes AroG* (a), PmdA (b), PmdB (c), PmdC (d), and QsuB (e).

    [0048] FIG. 9. Identification of the essential PDC biosynthetic enzymes in tobacco leaves by combinatorial transient expression of AroG* and QsuB with PmdA, PmdB, and PmdC. Error bars represent the SE from three biological replicates (n=3). nd, not detected.

    [0049] FIG. 10. Average PDC titers from Arabidopsis PDC-4G x QsuB and PDC-5G transgenic lines at the T1 generation (primary transformants). Error bars represent the SE from twelve and thirteen independent lines, respectively. Asterisks indicate a significant difference using the unpaired Student's t-test (*P<0.01).

    [0050] FIG. 11. Representative HPLC-ESI-TOF MS (high-performance liquid chromatography—electrospray ionization—time-of-flight mass spectrometry) chromatograms of the PCA glucose conjugate detected in non-hydrolysed metabolite extracts obtained from tobacco leaves transiently expressing QsuB alone (B), AroG* and QsuB (C), or the five enzymes AroG*, QsuB, PmdA, PmdB, and PmdC (D). Metabolite extracts obtained from tobacco leaves inoculated with the infiltration buffer were used as control (A). Insets in each chromatogram show the mass spectra of the PCA glucose conjugate (PCA-4-O-glucose is arbitrary shown).

    [0051] FIG. 12A. Strategy used for the production of PDC in plants. De novo biosynthetic pathway for PDC synthesis. Abbreviations are: E4P, erythrose 4-phosphate; PEP, phosphoenolpyruvate; CHA, chorismate; AAA, aromatic amino acids; PCA, protocatechuic acid; CHMS, 4-carboxy-2-hydroxymuconate-6-semialdehyde; PDC, 2-pyrone-4,6-dicarboxylic acid; HBA, 4-hydroxybenzoate; GAL, gallic acid; OMA, 4-oxalomesaconate. Enzymes names: AroG*, feedback-insensitive 3-deoxy-D-arabino-heptulosonate (DAHP) synthase with L175Q mutation; PmdA, PCA 4,5-dioxygenase alpha subunit; PmdB, PCA 4,5-dioxygenase beta subunit; PmdC, CHMS dehydrogenase; QsuB, 3-dehydroshikimate dehydratase; UbiC, chorismate pyruvate lyase; PobA, 4-hydroxybenzoate hydroxylase; PcaGH, protocatechuate 3,4-dioxygenase; LigI, 2-pyrone-4,6-dicarboxylate hydrolase.

    [0052] FIG. 12B. Strategy used for the production of PDC in plants. Production of PDC in tobacco leaves by the transient expression of the proposed de novo biosynthetic pathway.

    [0053] FIG. 12C. Strategy used for the production of PDC in plants. Production of PDC in tobacco leaves by the transient expression of pcaG and pcaH through GAL route.

    DETAILED DESCRIPTION OF THE INVENTION

    [0054] The foregoing aspects and others will be readily appreciated by the skilled artisan from the following description of illustrative embodiments when read in conjunction with the accompanying drawings.

    [0055] In this specification and in the claims that follow, reference will be made to a number of terms that shall be defined to have the following meanings:

    [0056] The terms “optional” or “optionally” as used herein mean that the subsequently described feature or structure may or may not be present, or that the subsequently described event or circumstance may or may not occur, and that the description includes instances where a particular feature or structure is present and instances where the feature or structure is absent, or instances where the event or circumstance occurs and instances where it does not.

    [0057] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.

    [0058] The term “about” refers to a value including 10% more than the stated value and 10% less than the stated value.

    [0059] As used herein, the term “promoter” refers to a polynucleotide sequence capable of driving transcription of a DNA sequence in a cell. Thus, promoters used in the polynucleotide constructs of the invention include cis- and trans-acting transcriptional control elements and regulatory sequences that are involved in regulating or modulating the timing and/or rate of transcription of a gene. For example, a promoter can be a cis-acting transcriptional control element, including an enhancer, a promoter, a transcription terminator, an origin of replication, a chromosomal integration sequence, 5′ and 3′ untranslated regions, or an intronic sequence, which are involved in transcriptional regulation. These cis-acting sequences typically interact with proteins or other biomolecules to carry out (turn on/off, regulate, modulate, etc.) gene transcription. Promoters are located 5′ to the transcribed gene, and as used herein, include the sequence 5′ from the translation start codon.

    [0060] A “constitutive promoter” is one that is capable of initiating transcription in nearly all cell types, whereas a “cell type-specific promoter” initiates transcription only in one or a few particular cell types or groups of cells forming a tissue. In some embodiments, the promoter is secondary cell wall-specific and/or fiber cell-specific. A “fiber cell-specific promoter” refers to a promoter that initiates substantially higher levels of transcription in fiber cells as compared to other non-fiber cells of the plant. A “secondary cell wall-specific promoter” refers to a promoter that initiates substantially higher levels of transcription in cell types that have secondary cell walls, e.g., lignified tissues such as vessels and fibers, which may be found in wood and bark cells of a tree, as well as other parts of plants such as the leaf stalk. In some embodiments, a promoter is fiber cell-specific or secondary cell wall-specific if the transcription levels initiated by the promoter in fiber cells or secondary cell walls, respectively, are at least 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 50-fold, 100-fold, 500-fold, 1000-fold higher or more as compared to the transcription levels initiated by the promoter in other tissues, resulting in the encoded protein substantially localized in plant cells that possess fiber cells or secondary cell wall, e.g., the stem of a plant. Non-limiting examples of fiber cell and/or secondary cell wall specific promoters include the promoters directing expression of the genes IRX1, IRX3, IRX5, IRX7, IRX8, IRX9, IRX10, IRX14, NST1, NST2, NST3, MYB46, MYB58, MYB63, MYB83, MYB85, MYB103, PAL1, PAL2, C3H, CcOAMT, CCR1, FSH, LAC4, LAC17, CADc, and CADd. See, e.g., Turner et al 1997; Meyer et al 1998; Jones et al 2001; Franke et al 2002; Ha et al 2002; Rohde et al 2004; Chen et al 2005; Stobout et al 2005; Brown et al 2005; Mitsuda et al 2005; Zhong et al 2006; Mitsuda et al 2007; Zhong et al 2007a, 2007b; Zhou et al 2009; Brown et al 2009; McCarthy et al 2009; Ko et al 2009; Wu et al 2010; Berthet et al 2011. In some embodiments, a promoter is substantially identical to a promoter from the lignin biosynthesis pathway. A promoter originated from one plant species may be used to direct gene expression in another plant species.

    [0061] A polynucleotide or amino acid sequence is “heterologous” to an organism or a second polynucleotide or amino acid sequence if it originates from a foreign species, or, if from the same species, is modified from its original form. For example, when a polynucleotide encoding a polypeptide sequence is said to be operably linked to a heterologous promoter, it means that the polynucleotide coding sequence encoding the polypeptide is derived from one species whereas the promoter sequence is derived from another, different species; or, if both are derived from the same species, the coding sequence is not naturally associated with the promoter (e.g., is a genetically engineered coding sequence, e.g., from a different gene in the same species, or an allele from a different ecotype or variety, or a gene that is not naturally expressed in the target tissue).

    [0062] The term “operably linked” refers to a functional relationship between two or more polynucleotide (e.g., DNA) segments. Typically, it refers to the functional relationship of a transcriptional regulatory sequence to a transcribed sequence. For example, a promoter or enhancer sequence is operably linked to a DNA or RNA sequence if it stimulates or modulates the transcription of the DNA or RNA sequence in an appropriate host cell or other expression system. Generally, promoter transcriptional regulatory sequences that are operably linked to a transcribed sequence are physically contiguous to the transcribed sequence, i.e., they are cis-acting. However, some transcriptional regulatory sequences, such as enhancers, need not be physically contiguous or located in close proximity to the coding sequences whose transcription they enhance.

    [0063] A homologous enzyme is an enzyme that has a polypeptide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95% or 99% identical to any one of the enzymes described in this specification or in an incorporated reference. The homologous enzyme comprises or retains amino acid residues that are recognized as conserved for the enzyme. The homologous enzyme may have non-conserved amino acid residues replaced or found to be of a different amino acid, or amino acid(s) inserted or deleted, but which does not affect or has insignificant effect on the enzymatic activity of the homologous enzyme. The homologous enzyme has an enzymatic activity that is identical or essentially identical to the enzymatic activity any one of the enzymes described in this specification or in an incorporated reference. The homologous enzyme may be found in nature or be an engineered mutant thereof.

    [0064] The terms “host cell” of “host organism” is used herein to refer to a living biological cell that can be transformed via insertion of an expression vector.

    [0065] The terms “expression vector” or “vector” refer to a compound and/or composition that transduces, transforms, or infects a host cell, thereby causing the cell to express nucleic acids and/or proteins other than those native to the cell, or in a manner not native to the cell. An “expression vector” contains a sequence of nucleic acids (ordinarily RNA or DNA) to be expressed by the host cell. Optionally, the expression vector also comprises materials to aid in achieving entry of the nucleic acid into the host cell, such as a virus, liposome, protein coating, or the like. The expression vectors contemplated for use in the present invention include those into which a nucleic acid sequence can be inserted, along with any preferred or required operational elements. Further, the expression vector must be one that can be transferred into a host cell and replicated therein. Particular expression vectors are plasmids, particularly those with restriction sites that have been well documented and that contain the operational elements preferred or required for transcription of the nucleic acid sequence. Such plasmids, as well as other expression vectors, are well known to those of ordinary skill in the art.

    [0066] The terms “polynucleotide” and “nucleic acid” are used interchangeably and refer to a single or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5′ to the 3′ end. A nucleic acid of the present invention will generally contain phosphodiester bonds, although in some cases, nucleic acid analogs may be used that may have alternate backbones, comprising, e.g., phosphoramidate, phosphorothioate, phosphorodithioate, or O-methylphophoroamidite linkages (see Eckstein, Oligonucleotides and Analogues: A Practical Approach, Oxford University Press); positive backbones; non-ionic backbones, and non-ribose backbones. Thus, nucleic acids or polynucleotides may also include modified nucleotides that permit correct read-through by a polymerase. “Polynucleotide sequence” or “nucleic acid sequence” includes both the sense and antisense strands of a nucleic acid as either individual single strands or in a duplex. As will be appreciated by those in the art, the depiction of a single strand also defines the sequence of the complementary strand; thus the sequences described herein also provide the complement of the sequence. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. The nucleic acid may be DNA, both genomic and cDNA, RNA or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases, including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, isoguanine, etc.

    [0067] The term “plant” as used herein can refer to a whole plant or part of a plant, e.g., seeds, and includes plants of a variety of ploidy levels, including aneuploid, polyploid, diploid and haploid. The term “plant part,” as used herein, refers to shoot vegetative organs and/or structures (e.g., leaves, stems and tubers), branches, roots, flowers and floral organs (e.g., bracts, sepals, petals, stamens, carpels, anthers), ovules (including egg and central cells), seed (including zygote, embryo, endosperm, and seed coat), fruit (e.g., the mature ovary), seedlings, and plant tissue (e.g., vascular tissue, ground tissue, and the like), as well as individual plant cells, groups of plant cells (e.g., cultured plant cells), protoplasts, plant extracts, and seeds. The class of plants that can be used in the methods of the invention is generally as broad as the class of higher and lower plants amenable to transformation techniques, including angiosperms (monocotyledonous and dicotyledonous plants), gymnosperms, ferns, bryophytes, and multicellular algae.

    [0068] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited.

    [0069] The amino acid sequence of Comamonas testosteroni (Pseudomonas testosteroni) protocatechuate 4,5-dioxygenase alpha subunit (PmdA) is as follows:

    TABLE-US-00001 (SEQ ID NO: 1)         10         20         30         40 MALEKPYLDV PGTIIFDAEQ SRKGYWLNQF CMSLMKAENR         50         60         70         80 ERFRADERAY LDEWAMTEEQ KQAVLARDLN WCMRTGGNIY         90        100        110        120  FLAKIGATDG KSFQQMAGSM TGMTEEEYRA MMMGGGRSAE        130        140 GNRYVGEDGD AQAHHQPQGS AGNQNKEGN 

    [0070] In some embodiment, the PmdA, or homologous enzyme thereof, comprises an amino acid sequence having equal to or more than about 70%, 75%, 80%, 85%, 90%, 95%, or 99% amino acid sequence identity to SEQ ID NO:1. In some embodiments, the PmdA, or homologous enzyme thereof, comprises one or more of the following conserved amino acid sequences:

    TABLE-US-00002 (SEQ ID NO: 12) KPYLDVPGT, (SEQ ID NO: 13) IFDAEQSRKGYWLNQFCMSLMKAENRERF, (SEQ ID NO: 14) DERAYLDEWAMTEEQKQAVLARDLNWC, (SEQ ID NO: 15) GGNIYFLAKIGATDGKSFQQMAGSMTGMTEEEYR, (SEQ ID NO: 16) GGRSA, and  (SEQ ID NO: 17) VGEDGDAQAH.

    [0071] The amino acid sequence of Comamonas testosteroni (Pseudomonas testosteroni) protocatechuate 4,5-dioxygenase beta subunit (PmdB) is as follows:

    TABLE-US-00003 (SEQ ID NO: 2)         10         20         30         40 MARITASVFT SHVPAIGAAM DMGKTQEAYW APLFKGYDFS         50         60         70         80 RQWMKDNKPD VIFLVYNDHA TAFSLDCIPT FAIGTAAEFQ         90        100        110        120 PADEGWGPRP VPKVVGHPDL ASHIAQSVIQ QDFDLTIVNK        130        140        150        160 MDVDHGLTVP LSLMCGEQDP KTGSWPCPVI PFAVNVVQYP        170        180        190        200 VPTGQRCFNL GRAIRKAVES YDQDINVHIW GTGGMSHQLQ        210        220        230        240 GARAGLINKE WDNQFLDLLV ENPHGLAQMP HIDYVREAGS        250        260        270        280 EGIELVMWLI ARGAMSDVDG PAPLPKVAHR FYHVPASNTA VGHLILENQ 

    [0072] In some embodiment, the PmdB, or homologous enzyme thereof, comprises an amino acid sequence having equal to or more than about 70%, 75%, 80%, 85%, 90%, 95%, or 99% amino acid sequence identity to SEQ ID NO:2. In some embodiments, the PmdB, or homologous enzyme thereof, comprises one or more of the following conserved amino acid sequences:

    TABLE-US-00004 (SEQ ID NO: 18) MARITASV, (SEQ ID NO: 19) TSHVPAIGAA, (SEQ ID NO: 20) PDVIFLVYNDHATAFSLD, (SEQ ID NO: 21) IPTFAIGTAAEF, (SEQ ID NO: 22) IPTFAIGTAAEF, (SEQ ID NO: 23) LASHIAQSVIQ, (SEQ ID NO: 24) DFDLTIVNKMDVDHGLTVPLSLMCGE, (SEQ ID NO: 25) VIPFAVNVVQYPVP, (SEQ ID NO: 26) IWGTGGMSHQLQGARAGLIN, (SEQ ID NO: 27) YVREAGSEGIELVMWLIARGAM, and (SEQ ID NO: 28) HVPASNTAVGHLILEN.

    [0073] The amino acid sequence of Comamonas testosteroni 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (PmdC) is as follows:

    TABLE-US-00005 (SEQ ID NO: 3)         10         20         30         40  MSKTIKVALA GAGAFGIKHL DGIKNIDGVE VVSLVGRRFD         50         60         70         80 QTKEVADKYG IAHVATDLAE SLALPEVDAV ILCTPTQMHA          90        100        110        120 EQAIACMKAG KHVQVEIPLA DALKDAQEVA ELQKQTGLVA         130        140        150        160 MVGHTRRFNP SHQWVHKKIE AGEFNIQQMD VQTYFFRRTN         170        180        190        200  MNALGQARSW TDHLLWHHAA HTVDLFAYQA GSPIVKANAV         210        220        230        240  QGPIHKDLGI AMDMSIQLKA ANGAICTLSL SFNNDGPLGT        250        260        270        280 FFRYIGDTGT YLARYDDLYT GKDEKIDVSQ VDVSMNGIEL        290        300        310 QDREFFAAIR EGREPNSSVQ QVFNCYKVLH DLEQQLNAD 

    [0074] In some embodiment, the PmdC, or homologous enzyme thereof, comprises an amino acid sequence having equal to or more than about 70%, 75%, 80%, 85%, 90%, 95%, or 99% amino acid sequence identity to SEQ ID NO:3. In some embodiments, the PmdC, or homologous enzyme thereof, comprises one or more of the following conserved amino acid sequences:

    TABLE-US-00006 (SEQ ID NO: 29) ALAGAGAFG, (SEQ ID NO: 30) KNIDGVE, (SEQ ID NO: 31) VDAVILCTPTQMHAEQAIACM, (SEQ ID NO: 32) AGKHVQVEIPLAD, (SEQ ID NO: 33) MVGHTRRFNPSHQ, (SEQ ID NO: 34) IQQMDVQTYFFRR, (SEQ ID NO: 35) RSWTDHLLWHHAAHTVDLFAYQAG, (SEQ ID NO: 36) ANAVQGPIH, (SEQ ID NO: 37) LGIAMDMSIQLK, (SEQ ID NO: 38) GAICTLSLSFNNDGPLGTFFRYI, (SEQ ID NO: 39) ARYDDL, (SEQ ID NO: 40) VDVSMNGIELQDREF, and (SEQ ID NO: 41) AAIREGREPNSSV.

    [0075] The amino acid sequence of E. coil 3-deoxy-D-arabinoheptulosonate 7-phosphate synthase (AroG) is as follows:

    TABLE-US-00007 (SEQ ID NO: 4)         10         20         30         40  MNYQNDDLRI KEIKELLPPV ALLEKFPATE NAANTVAHAR         50         60         70         80 KAIHKILKGN DDRLLVVIGP CSIHDPVAAK EYATRLLALR         90        100        110        120 EELKDELEIV MRVYFEKPRT TVGWKGLIND PHMDNSFQIN        130        140        150        160 DGLRIARKLL LDINDSGLPA AGEFLDMITP QYLADLMSWG         170        180        190        200  AIGARTTESQ VHRELASGLS CPVGFKNGTD GTIKVAIDAI        210        220        230        240  NAAGAPHCFL SVTKWGHSAI VNTSGNGDCH IILRGGKEPN        250        260        270        280 YSAKHVAEVK EGLNKAGLPA QVMIDFSHAN SSKQFKKQMD        290        300        310        320 VCADVCQQIA GGEKATTGVM VESHLVEGNQ SLESGEPLAY        330        340        350  GKSITDACIG WEDTDALLRQ LANAVKARRG 

    [0076] In some embodiment, the AroG, or homologous enzyme thereof, comprises an amino acid sequence having equal to or more than about 70%, 75%, 80%, 85%, 90%, 95%, or 99% amino acid sequence identity to SEQ ID NO:4. In some embodiments, the AroG, or homologous enzyme thereof, comprises one or more of the following conserved amino acid sequences:

    TABLE-US-00008 (SEQ ID NO: 42) MRVYFEKPRT, (SEQ ID NO: 43) VGWKGLIN, (SEQ ID NO: 44) GLRIARK, (SEQ ID NO: 45) WGAIGARTTESQVHR, (SEQ ID NO: 46) HIILRGG, and (SEQ ID NO: 47) SHANS.

    [0077] In a particular embodiment, the feedback-resistant DAHP synthase (L175Q) (AroG*) has the following amino acid sequence:

    TABLE-US-00009 (SEQ ID NO: 5)         10         20         30         40  MNYQNDDLRI KEIKELLPPV ALLEKFPATE NAANTVAHAR         50         60         70         80 KAIHKILKGN DDRLLVVIGP CSIHDPVAAK EYATRLLALR          90        100        110        120 EELKDELEIV MRVYFEKPRT TVGWKGLIND PHMDNSFQIN         130        140        150        160  DGLRIARKLL LDINDSGLPA AGEFLDMITP QYLADLMSWG         170        180        190        200  AIGARTTESQ VHREQASGLS CPVGENNGTD GTIKVAIDAI         210        220        230        240  NAAGAPHCFL SVTKWGHSAI VNTSGNGDCH IILRGGKEPN        250        260        270        280 YSAKHVAEVK EGLNKAGLPA QVMIDFSHAN SSKQFKKQMD         290        300        310        320 VCADVCQQIA GGEKAIIGVM VESHLVEGNQ SLESGEPLAY         330        340        350  GKSITDACIG WEDTDALLRQ LANAVKARRG 

    [0078] In some embodiment, the AroG*, or homologous enzyme thereof, comprises an amino acid sequence having equal to or more than about 70%, 75%, 80%, 85%, 90%, 95%, or 99% amino acid sequence identity to SEQ ID NO:5. In some embodiments, the AroG*, or homologous enzyme thereof, comprises the Q at position 175. In some embodiments, the AroG*, or homologous enzyme thereof, comprises one or more of the following conserved amino acid sequences:

    TABLE-US-00010 (SEQ ID NO: 42) MRVYFEKPRT, (SEQ ID NO: 43) VGWKGLIN, (SEQ ID NO: 44) GLRIARK, (SEQ ID NO: 45) WGAIGARTTESQVHR, (SEQ ID NO: 46) HIILRGG, and (SEQ ID NO: 47) SHANS.

    [0079] The amino acid sequence of Pseudomonas aeruginosa p-hydroxybenzoate 3-monooxygenase (p-hydroxybenzoate hydroxylase) (PobA) is as follows:

    TABLE-US-00011 (SEQ ID NO: 6)         10         20         30         40  MKTQVAIIGA GPSGLLLGQL LHKAGIDNVI LERQTPDYVL         50         60         70         80 GRIRAGVLEQ GMVDLLREAG VDRRMARDGL VHEGVEIAFA          90        100        110        120 GQRRRIDLKR LSGGKTVTVY GQTEVTRDLM EAREACGATT         130        140        150        160 VYQAAEVRLH DLQGERPYVT FERDGERLRL DCDYIAGCDG         170        180        190        200  FHGISRQSIP AERLKVFERV YPFGWLGLLA DTPPVSHELI         210        220        230        240  YANHPRGFAL CSQRSATRSR YYVQVPLTEK VEDWSDERFW        250        260        270        280 TELKARLRAE VAEKLVTGPS LEKSIAPLRS FVVEPMQHGR         290        300        310        330 LFLAGDAAHI VPPTGAKGLN LAASDVSTLY RLLLKAYREG         340        350        360        370 RGELLERYSA ICLRRIWKAE RFSWWMTSVL HRFPDTDAFS         380        390  QRIQQTELEY YLGSEAGLAT IAENYVGLPY EEIE

    [0080] In some embodiment, the PobA, or homologous enzyme thereof, comprises an amino acid sequence having equal to or more than about 70%, 75%, 80%, 85%, 90%, 95%, or 99% amino acid sequence identity to SEQ ID NO:6. In some embodiments, the PobA, or homologous enzyme thereof, comprises one or more of the following conserved amino acid sequences:

    TABLE-US-00012 (SEQ ID NO: 48) GLLLGQLL, (SEQ ID NO: 49) RIRAG, (SEQ ID NO: 50) VTVYGQTEVT, (SEQ ID NO: 51) IAGCDG, (SEQ ID NO: 52) VYPFGWLG, (SEQ ID NO: 53) RGFALCS, (SEQ ID NO: 54) TRSRYY, (SEQ ID NO: 55) EKLVTGPS, (SEQ ID NO: 56) EKSIAPLRSFV, (SEQ ID NO: 57) EKSIAPLRSFVLAASD, (SEQ ID NO: 58) WKAERFSWWMT, and (SEQ ID NO: 59) AENYVGLPYE.

    [0081] PobA* is a p-hydroxybenzoate 3-monooxygenase that is mutant such that it catalyzes HBA into GAL. In some embodiments, the PobA* is reduced (as compared to the unmodified wild-type PobA) or unable to catalyze HBA into PCA. In some embodiments, the PobA* has the analogous Y385F and/or T294A mutations (the amino acid residue positions as corresponding to SEQ ID NO:6).

    [0082] In a particular embodiment, the PobA* has the following amino acid sequence:

    TABLE-US-00013 (SEQ ID NO: 7)         10         20         30         40  MKTQVAIIGA GPSGLLLGQL LHKAGIDNVI LERQTPDYVL         50         60         70         80 GRIRAGVLEQ GMVDLLREAG VDRRMARDGL VHEGVEIAFA          90        100        110        120 GQRRRIDLKR LSGGKTVTVY GQTEVTRDLM EAREACGATT         130        140        150        160 VYQAAEVRLH DLQGERPYVT FERDGERLRL DCDYIAGCDG         170        180        190        200  FHGISRQSIP AERLKVFERV YPFGWLGLLA DTPPVSHELI         210        220        230        240  YANHPRGFAL CSQRSATRSR YYVQVPLTEK VEDWEDERFW        250        260        270        280 TELKARLPAE VAEKLVTGPS LEKSIAPLRS FVVEPMQHGR        290        300        310        320  LFLAGDAAHI VPPAGAKGLN LAASDVSTLY RLLLKAYREG        330        340        350        360 RGELLERYSA ICLRRIWKAE RFSWWMTSVL HRFPDTDAFS         370        380        390  QRIQQTELEY YLGSEAGLAT IAENFVGLPY EEIE 

    [0083] In some embodiment, the PobA*, or homologous enzyme thereof, comprises an amino acid sequence having equal to or more than about 70%, 75%, 80%, 85%, 90%, 95%, or 99% amino acid sequence identity to SEQ ID NO:7. The PobA*, or homologous enzyme thereof, comprises the F at position 385 and/or the A at position 294. These two amino acid residues are each alone or together important for the enzymatic activity of catalyzing HBA into GAL. In some embodiments, the PobA*, or homologous enzyme thereof, comprises one or more of the following conserved amino acid sequences: GLLLGQLL (SEQ ID NO:48), RIRAG (SEQ ID NO:49), VTVYGQTEVT (SEQ ID NO:50), IAGCDG (SEQ ID NO:51), VYPFGWLG (SEQ ID NO:52), RGFALCS (SEQ ID NO:53), TRSRYY (SEQ ID NO:54), EKLVTGPS (SEQ ID NO:55), EKSIAPLRSFV (SEQ ID NO:56), EKSIAPLRSFVLAASD (SEQ ID NO:57), WKAERFSWWMT (SEQ ID NO:58), and AENFVGLPYE (SEQ ID NO:60).

    TABLE-US-00014 TABLE 6 Suitable PcaG for the invention. Enzyme name [Organism] Accession number protocatechuate 3,4-dioxygenase subunit GJB79204.1 alpha [Aeromonas caviae] MULTISPECIES: protocatechuate 3,4- WP_010955312.1 dioxygenase subunit alpha [Gammaproteobacteria] protocatechuate 3,4-dioxygenase subunit AXQ49722.1 alpha [Stenotrophomonas rhizophila] protocatechuate 3,4-dioxygenase subunit WP_167065900.1 alpha [Pantoea sp. Ap-967] protocatechuate 3,4-dioxygenase alpha AFH89644.1 subunit [Stenotrophomonas maltophilia] protocatechuate 3,4-dioxygenase subunit MRF38928.1 alpha [Escherichia coli] protocatechuate 3,4-dioxygenase subunit WP_167271347.1 alpha [Pantoea sp. Tr-811] protocatechuate 3,4-dioxygenase subunit NPA19495.1 alpha [Gammaproreobacteria bacterium] protocatechuate 3,4-dioxygenase subunit QPN46230.1 alpha [Priestia aryabhattai] protocatechuate 3,4-dioxygenase subunit ] NOY04354.1 alpha [Gammaproteobacteria bacterium

    [0084] The amino acid sequence of E. coil protocatechuate 3,4-dioxygenase subunit alpha (PcaG) is as follows:

    TABLE-US-00015 (SEQ ID NO: 8)         10         20         30         40  MPIELLPETP SQTAGPYVHI GLALEAAGNP TRDQEIWNCL         50         60         70         80 AKPDAPGEHI LLIGHVYDGN GHLVRDSFLE VWQADANGEY         90        100        110        120 QDAYNLENAF NSFGRTATTF DAGEWTLQTV KPGVVNNAAG         130        140        150        160 VPMAPHINIS LFARGINIHL HTRLYFDDEA QANAKCPVLN         170        180        190        200  LIEQPQRRET LIAKRCEVDG KTAYRFDIRI QGEGETVFFD F

    [0085] In some embodiment, the PcaG, or homologous enzyme thereof, comprises an amino acid sequence having equal to or more than about 70%, 75%, 80%, 85%, 90%, 95%, or 99% amino acid sequence identity to SEQ ID NO:8. In some embodiments, the PcaG, or homologous enzyme thereof, comprises one or more of the following conserved amino acid sequences:

    TABLE-US-00016 (SEQ ID NO: 61) MPIELLPETPSQTAGPYVHIGLALEAAGNPTRDQEIWN, (SEQ ID NO: 62) VYDGNGHLVRDSF, (SEQ ID NO: 63) WQADANG, (SEQ ID NO: 64) FNSFGRTATTFDAGEWT, (SEQ ID NO: 65) TVKPGVV, (SEQ ID NO: 66) NAAGVPMAPHINISLFARGINIHLHTRLYFDDEA, (SEQ ID NO: 67) ANAKCPVLNLIEQPQRRETL, and (SEQ ID NO: 68) AKRCEVDGKTAYRFDIRIQGEGETVFFDF.

    [0086] Suitable PcaG for the invention are listed in Table 6.

    TABLE-US-00017 TABLE 7 Suitable PcaH for the invention. Enzyme name [Organism] Accession number protocatechuate 3,4-dioxygenase subunit beta AXQ49723.1 [Stenotrophomonas rhizophila] MULTISPECIES: protocatechuate 3,4- WP_167065903.1 dioxygenase subunit alpha [unclassified Pantoea] protocatechuate 3,4-dioxygenase subunit beta GJB79205.1 [Aeromonas caviae] MULTISPECIES: protocatechuate 3,4-dioxygenase WP_009682255.1 subunit beta [Gammaproteobacteria] protocatechuate 3,4-dioxygenase subunit beta MRF38927.1 [Escherichia coli] protocatechuate 3,4-dioxygenase subunit alpha QPN46229.1 [Priestia aryabhattai] protocatechuate 3,4-dioxygenase alpha subunit AFH89645.1 [Stenotrophomonas maltophilia]

    [0087] The amino acid sequence of E. coil protocatechuate 3,4-dioxygenase subunit beta (PcaH) is as follows:

    TABLE-US-00018 (SEQ ID NO: 9)         10         20         30         40  MPAQDNSRFV IRDRNWHPKA LTPDYKTSVA RSPRQALVSI         50         60         70         80 PQSISETTGP DFSHLGFGAH DHDLLLNFNN GGLPIGERII         90        100        110        120 VAGRVVDQYG KPVPNTLVEM WQANAGGRYR HKNDRYLAPL        130        140        150        160 DPNFGGVGRC LTDRDGYYSF RTIKPGPYPW RNGPNDWRPA        170        180        190        200  HIHFAISGPS IATKLITQLY FEGDPLIPMC PIVKSIANPQ         210        220        230  AVQQLIAKLD MSNANPMDCL AYRFDIVLRG QRKTHFENC

    [0088] In some embodiment, the PcaH, or homologous enzyme thereof, comprises an amino acid sequence having equal to or more than about 70%, 75%, 80%, 85%, 90%, 95%, or 99% amino acid sequence identity to SEQ ID NO:9. In some embodiments, the PcaH, or homologous enzyme thereof, comprises one or more of the following conserved amino acid sequences: MPAQDNSRFVIRDRNWHPKALTPDYKTS (SEQ ID NO:69), ARSPRQALVSIPQSISETTGP (SEQ ID NO:70), HLGFGAHDHDLLLNFNNGGLP (SEQ ID NO:71), GERIIVAGRVVDQYG (SEQ ID NO:72), PVPNTLVE (SEQ ID NO:73), WQANAGGRYRHKNDRYLAPLDPNFGGVGRCLTD (SEQ ID NO:74), FRTIKPGPYPWRNGPNDWRPAHIH (SEQ ID NO:75), SGPSIATKLITQLYFEGDPLIP (SEQ ID NO:76), CPIVKSIANP (SEQ ID NO:77), AVQQLIAKLDMSNANPMDCLAYRFDI (SEQ ID NO:78), and LRGQRKTHFE (SEQ ID NO:79). Suitable PcaH for the invention are listed in Table 7.

    [0089] The amino acid sequence of Sphingomonas paucimobilis 2-pyrone-4,6-dicarboxylate hydrolase (LigI) is as follows:

    TABLE-US-00019 (SEQ ID NO: 10)         10         20         30         40 MTNDERILSW NETPSKPRYT PPPGAIDAHC HVFGPMAQFP         50         60         70         80 FSPKAKYLPR DAGPDMLFAL RDHLGFARNV IVQASCHGTD         90        100        110        120 NAATLDAIAR AQGKARGIAV VDPAIDEAEL AALHEGGMRG         130        140        150        160 IRFNFLKRLV DDAPKDKFLE VAGRLPAGWH VVIYFEADIL         170        180        190        200  EELRPFMDAI PVPIVIDHMG RPDVRQGPDG ADMKAFRRLL        210        220        230        240  DSREDIWFKA TCPDRLDPAG PPWDDFARSV APLVADYADR        250        260        270        280 VIWGTDWPHP NMQDAIPDDG LVVDMIPRIA PTPELQHKML        290  VTNPMRLYWS EEM 

    [0090] In some embodiment, the LigI, or homologous enzyme thereof, comprises an amino acid sequence having equal to or more than about 70%, 75%, 80%, 85%, 90%, 95%, or 99% amino acid sequence identity to SEQ ID NO:10. In some embodiments, the LigI, or homologous enzyme thereof, comprises one or more of the following conserved amino acid residues of SEQ ID NO:10 at positions: 47, 75, 122, 128, 154, 178, and 251, which are each independently or all important for the enzymatic activity of LigI in that they involved in the substrate binding site. A LigI, or homologous enzyme thereof, comprises the following conserved amino acid residue of SEQ ID NO:10 at position 246 which is the active site for the enzymatic activity of LigI.

    [0091] The amino acid sequence of Corynebacterium glutamicum 3-dehydroshikimate dehydratase (QsuB) is as follows:

    TABLE-US-00020 (SEQ ID NO: 11)         10         20         30         40  MRTSIATVCL SGTLAEKLRA AADAGFDGVE IFEQDLVVSP         50         60         70         80 HSAEQIRQRA QDLGLTLDLF QPFRDFEGVE EEQFLKNLHR          90        100        110        120 LEEKFKLMNR LGIEMILLCS NVGTATINDD DLFAEQLHRA        130        140        150        160 ADLAEKYNVK IAYEALAWGK FVNDFEHAHA LVEKVNHKAL         170        180        190        200  GTCLDTFHIL SRGWETDEVE NIPAEKIFFV QLADAPKLSM         210        220        230        240  DILSWSRHHR VFPGEGDFDL VKFMVHLAKT GYDGPISLEI        250        260        270        280 FNDSFRKAEV GRTAIDGLRS LRWLEDQTWH ALSAEDRPSA        290        300        310        320 LELRALPEVA EPEGVDFIEI ATGRLGETIR VLHQLGFRLG         330        340        350        360 GHHCSKQDYQ VWTQGDVRIV VCDRGATGAP TTISAMGFDT         370        380        390        400  PDPEAAHARA ELLRAQTIDR PHIEGEVDLK GVYAPDGVEL        410        420        430        440  FFAGPSPDGM PEWLPEFGVE KQEAGLIEAI DHVNFAQPWQ        450        460        470        480 HFDEAVLFYT ALMALETVRE DEFPSPIGLV RNQVMRSPND         490        500        510        520 AVRLLLSVAP EDGEQGDFLN AAYPEHIALA TADIVAVAER         530        540        550        560 ARKRGLDFLP VPENYYDDVQ ARFDLPQEFL DTLKENHLLY         570        580        590        600  DRDENGEFLH FYTRTLGTLF FEVVERRGGF AGWGETNAPV         610  RLAAQYREVR DLERGIPN 

    [0092] In some embodiment, the QsuB, or homologous enzyme thereof, comprises an amino acid sequence having equal to or more than about 70%, 75%, 80%, 85%, 90%, 95%, or 99% amino acid sequence identity to SEQ ID NO:11. In some embodiments, the QsuB, or homologous enzyme thereof, comprises one or more of the following conserved amino acid residues of SEQ ID NO:11 at positions: 134, 165, 191, 239, 432, 506, and 582, which are each independently or all important for the enzymatic activity of QsuB in that they involved in metal binding.

    [0093] It is to be understood that, while the invention has been described in conjunction with the preferred specific embodiments thereof, the foregoing description is intended to illustrate and not limit the scope of the invention. Other aspects, advantages, and modifications within the scope of the invention will be apparent to those skilled in the art to which the invention pertains.

    [0094] All patents, patent applications, and publications mentioned herein are hereby incorporated by reference in their entireties.

    [0095] The invention having been described, the following examples are offered to illustrate the subject invention by way of illustration, not by way of limitation.

    EXAMPLE 1

    In-Planta Production of the Biodegradable Polyester Precursor 2-pyrone-4,6-dicarboxylic Acid (PDC): Stacking Reduced Biomass Recalcitrance with Value-Added Co-Product

    [0096] 2-pyrone-4,6-dicarboxylic acid (PDC), a chemically stable intermediate that naturally occurs during microbial degradation of lignin by bacteria, represents a promising building block for diverse biomaterials and polyesters such as biodegradable plastics. The lack of chemical synthesis method has hindered large-scale utilization of PDC and metabolic engineering approaches for its biosynthesis have recently emerged. In this study, a strategy for the production of PDC via manipulation of the shikimate pathway using plants as green factories is demonstrated. In tobacco leaves, it is first shown that transient expression of bacterial feedback-resistant 3-deoxy-D-arabinoheptulosonate 7-phosphate synthase (AroG) and 3-dehydroshikimate dehydratase (QsuB) produces high titers of protocatechuate (PCA), which is in turn efficiently converted into PDC upon co-expression of PCA 4,5-dioxygenase (PmdAB) and 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (PmdC) from Comamonas testosterone. It is validated in Arabidopsis that stable expression of AroG in a genetic background containing the QsuB gene enhances PCA content in plant biomass, presumably via an increase of the carbon flux through the shikimate pathway. Further, introducing AroG and the PDC biosynthetic genes (PmdA, PmdB, and PmdC) into the Arabidopsis QsuB background, or introducing the five genes (AroG, QsuB, PmdA, PmdB, and PmdC) stacked on a single construct into wild-type plants resulted in PDC titers of ˜1% and ˜3% dry weight in plant biomass, respectively. Consistent with previous observations, all PDC producing lines show strong reductions of lignin content in stems as a consequence of QsuB expression. This low lignin trait is accompanied with improvements of biomass saccharification efficiency due reduced cell wall recalcitrance to enzymatic degradation. Importantly, most transgenic lines show no reduction in biomass yields. Therefore, it is concluded that engineering plants with the proposed de-novo PDC pathway provides an avenue to enrich biomass with a value-added co-product and to improve biomass quality for the supply of fermentable sugars. Implementing this strategy into bioenergy crops has the potential to support existing microbial fermentation approaches that exploit lignocellulosic biomass feedstocks for PDC production.

    [0097] In this example, it is exploited that the C. testosteroni genes encoding the alpha and beta subunits of PCA 4,5-dioxygenase (PmdA and PmdB) and CHMS dehydrogenase (PmdC) for PDC production in plants (FIG. 1). This approach also leverages previously reported engineering strategies in Arabidopsis that (1) enable PCA overproduction by expression of a 3-dehydroshikimate dehydratase (QsuB) (Eudes et al., 2015) and (2) increase the metabolic flux through the shikimate pathway by expression of feedback-resistant 3-deoxy-D-arabinoheptulosonate 7-phosphate synthase (DAHPS, hereafter AroG*) (Tzin et al., 2012; Eudes et al., 2018).

    [0098] Using a leaf transient expression system in tobacco (Nicotiana benthamiana), it is first shown that all three enzymes (PmdA, PmdB, and PmdC) are essential for the conversion of PCA into PDC, while co-expression of AroG* with QsuB increases the production of PCA. Using Arabidopsis as a model for stable transformation, it is confirmed that introducing AroG* into a transgenic background that contains QsuB increases PCA titers, which are up ˜3.5-fold compared the parental line. Next, a gene-stacking approach for introducing the four enzymes AroG*, PmdA, PmdB, and PmdC into the QsuB parental line (PDC-4G x QsuB) resulted in PDC production (up to 1% dry weight). Furthermore, transformation of wild-type Arabidopsis with a construct consisting of the five genes located on a single plasmid for co-expression of AroG*, QsuB, PmdA, PmdB, and PmdC (PDC-5G) enabled higher PDC titers in plant biomass (˜3% dry weight). Importantly, the different Arabidopsis PDC-producing lines show reduced lignin contents and improved biomass saccharification efficiencies compared to wild-type control plants, which is presumably a consequence of QsuB expression in lignifying tissues as previously observed in other Arabidopsis plants engineered with the same QsuB gene (Eudes et al., 2015; Aznar et al., 2018).

    [0099] Consequently, it is successfully demonstrated in this example an engineering strategy for enriching plant biomass with PDC as a value-added co-product while conferring a reduced biomass recalcitrance trait that enables higher yields of fermentable sugars for downstream biorefinery applications.

    Material and Methods

    Chemicals and Plant Growth Condition

    [0100] Chemicals and culture media for plant cultivation are purchased from PhytoTechnology Laboratories (Lenexa, KS). Hygromycin B is purchased from Gold Biotechnology (St. Louis, Mo.). All other chemicals are purchased from Sigma-Aldrich (St. Louis, Mo.).

    Plant Material and Growth Conditions

    [0101] Arabidopsis thaliana (ecotype Columbia, Col-0) is grown in a growth chamber (Percival Scientific, Perry, Iowa) with 150 μmol/m.sup.2/s of light for 16 h per 24-h day cycle, 22° C., and 60% humidity. Prior transfer to soil, the selection of transgenic plants is made on Murashige and Skoog vitamin medium, supplemented with 1% sucrose, 1.5% agar, and 25 μg/mL hygromycin. The Arabidopsis line pC4H::QsuB-1 is grown on the same medium supplemented with 50 μg/mL kanamycin prior transfer to soil (Eudes et al., 2015). For Arabidopsis biomass yields, the height of the main stem is measured at the mature senesced stage and all stems are harvested without leaves and siliques for total biomass dry weight measurements. Wild-type tobacco (Nicotiana benthamiana) seeds are germinated directly on soil and plants are grown in a growth chamber with 150 μmol/m.sup.2/s of light for 16 h per 24-h day cycle, 25° C., and 60% humidity.

    Cloning of Level-0 DNA Parts

    [0102] The DNA coding sequences of plastid-targeted PmdA, PmdB, and PmdC from C. testosteroni are codon-optimized for expression in A. thaliana and synthesized as gene fragments by GenScript (Piscataway, N.J.). All coding sequences contain at their 5′-end the sequence of the plastid transit peptide Schl2 from the A. thaliana chloroplastic photosystem II subunit S (AT1G44575) and flanking BsaI restriction sites plus extra homologous sequences for downstream integration into pBca9145 using In-Fusion cloning (Takara Bio USA, Mountain View, Calif.) (Shih et al., 2016; Table 1). A gene sequence encoding feedback-insensitive AroG (L175Q) from E. coli preceded with a sequence encoding the chloroplast transit peptide Schl1 of the pea (Pisum sativum) ribulose-1,5-bisphosphate carboxylase small subunit (GenBank: AAG45569.1) is amplified by PCR with primers containing flanking BsaI restriction sites (Table 2) using the pDONR221-P3-schl1-aroG.sup.L175Q-P2 construct as template (Eudes et al., 2018) and subcloned into the backbone pBca9145 by In-Fusion cloning. Similarly, a gene sequence encoding a 3-dehydroshikimate dehydratase (QsuB) from C. glutamicum preceded with a sequence encoding the synthetic chloroplast transit peptide Schl3 is amplified by PCR with primers containing flanking BsaI restriction sites (Table 2) using the plasmid pTKan-pC4H::schl3::QsuB as template (Eudes et al., 2015) and subcloned into pBca9145. Finally, a 2377-bp sequence corresponding to the promoter pC3′H of the Arabidopsis coumarate 3′-hydroxylase gene (At2g40890) is amplified by PCR with primers containing flanking BsaI restriction sites (Table 2) using Arabidopsis thaliana genomic DNA as template, and subcloned into pBca9145. All corresponding level-0 constructs are listed in Table 3.

    Plasmid Constructions

    [0103] For transient expression in tobacco, synthetic sequences encoding Schl1-AroG*, Schl2-PmdA, Schl2-PmdB, Schl2-PmdC, schl1-LigI, schl2-pcaG, schl3-pcaH, and Schl3-QsuB are released by BsaI digest from the pBca9145 backbone and ligated individually into the binary vector pPMS057 which contains a 35S promoter (p35S) from the cauliflower mosaic virus (Belcher et al., 2020; Table 1). The resulting vectors containing p35S::Schl1-AroG*, p35S::Schl2-PmdA, p35S::Schl2-PmdB, p35S::Schl2-PmdC, p35S::Schl2-pcaG, p35S::Schl3-pcaH, p35S::Schl1-LigI, and p35S::Schl3-QsuB are listed in Table 4. For stable Arabidopsis transformation, the jStack cloning method is used to generate the level-2 constructs pAroG, pPDC-4G, and pPDC-5G (Shih et al., 2016). Detailed information about the level-0, level-1, and level-2 plasmids used for jStack assemblies are listed in Tables 1, 3 and 5. Plasmid sequences are available at the Inventory of Composable Elements (ICE) source registry (website for: public-registry.jbei.org).

    Tobacco Infiltration and Arabidopsis Transformation

    [0104] Binary vectors are transformed into Agrobacterium tumefaciens strain GV3101 by electroporation and selection is made on Luria-Bertani (LB) solid medium with 50 mg/mL kanamycin, 30 mg/mL gentamycin, and 100 mg/mL rifampicin. For transient expression in tobacco, leaves of 4-week-old plants are infiltrated with Agrobacterium strains (OD.sub.600=1.0) carrying pPMS057 vectors of interest following the procedures described previously (Sparkes et al., 2006). For stable expression, the constructs are introduced into Arabidopsis via Agrobacterium-mediated transformation (Bechtold and Pelletier, 1998). The stability in Agrobacterium of the large binary vectors used for Arabidopsis transformation is verified by PCR using plasmid preps from overnight-grown Agrobacterium cultures as template (FIG. 1).

    DNA Extraction and PCR Analysis

    [0105] Arabidopsis genomic DNA is extracted using the DNeasy Plant Mini Kit (Qiagen, Valencia, Calif.) following the manufacturer's protocol. Detection by PCR of the transgenes AroG*, QsuB, PmdA, PmdB, and PmdC from the pAroG, pPDC-4G, or pPDC-5G construct was conducted using the primers listed in Table 2.

    Metabolite Extraction for LC-MS Metabolite Analysis

    [0106] Metabolites are extracted from mature senesced dried Arabidopsis stems using 80% (v/v) methanol-water as solvent as previously described (Eudes et al., 2018). For each sample, 30 mg of ball-milled biomass is sequentially extracted four times with 1 mL of solvent at 70° C. The 4 mL extracts are mixed with 2 mL of HPLC grade water and cleared by centrifugation at 4,000× g for 5 minutes. After centrifugation, extracts are filtered through Amicon Ultra centrifugal filters (3 kDa MW cut off, EMD Millipore, Billerica, Mass.) at 12,000× g for 60 min at 4° C. For PCA quantification, a 500 μL aliquot of the filtered extracts is dried under vacuum and hydrolyzed with 1N HCl for 3 h at 90° C. to release the PCA aglycone form, followed by three ethyl acetate partitioning steps as previously described (Eudes et al., 2015). Metabolites are extracted with the same method from the harvested tobacco leaves, which are frozen, and pulverized in liquid nitrogen five days post-infiltration. Around 200 mg of frozen leaf disc is used for each extraction.

    LC-MS Metabolite Analysis

    [0107] PCA and PDC are analyzed using an HPLC-ESI-TOF-MS as previously described (Eudes et al., 2013). Quantification of metabolites is performed via 6-point calibration curves of standard compounds. The theoretical m/z (negative ionization) of deprotonated PCA, PCA-glucose conjugate, and PDC are 153.01933, 315.07216, and 182.99351, respectively.

    Lignin Measurements

    [0108] Lignin is quantified from mature senesced dried Arabidopsis stems using the thioglycolic acid method as previously described (Suzuki et al., 2009). Dried cell wall residues (˜15 mg) obtained after sequential metabolite extractions (see section 2.7) are used.

    Biomass Pretreatment and Saccharification

    [0109] Ball-milled senesced stems (10 mg) are mixed with 340 μL of 0.25% w/v NaOH and shaken at 1400 rpm (50° C., 60 min) for dilute alkaline pretreatment. Saccharification is initiated by adding 650 μL of 100 mM sodium citrate buffer pH 5 containing 80 μg/mL tetracycline and 0.05% w/w Cellic CTec3 cellulase (Novozymes, Davis, Calif.). After 96 h of incubation at 50° C. with shaking (800 rpm), samples are centrifuged and the supernatant is filtered through 0.45-μm nylon membrane centrifugal filters (VWR International, Radnor, Pa.) for glucose and xylose measurements using high-performance liquid chromatography (HPLC). The system is equipped with an Aminex cation-exchange resin column HPX-87H, 300×7.8 mm (Bio-Rad, Hercules, Calif.) and the eluant was 4 mM H.sub.2SO.sub.4 at a flow rate of 0.4 mL/min at 60° C. Glucose and xylose are identified by refractive index and their amount quantified using standard curves of authentic compounds.

    Results

    Production of PDC in Tobacco Leaves by Transient Expression of AroG*, QsuB, PCA 4,5-dioxygenase (PmdAB) and CHMS Dehydrogenase (PmdC)

    [0110] It is previously showed that stable expression of plastid-targeted QsuB in tobacco (Nicotiana tabacum L.) leads to accumulation of PCA in plant tissues (Wu et al., 2017). Therefore, transiently plastid-targeted versions of QsuB, PmdA, PmdB, and PmdC are co-expressed in tobacco leaves to rapidly validate the use of these enzymes for production of PDC from PCA in planta. Plastid-targeted feedback-insensitive DAHP synthase AroG.sup.L175Q (AroG*) is also included to enhance the carbon flux through the shikimate pathway. Successfully, accumulation of PDC is observed in leaves infiltrated with the five bacterial genes, whereas expression of QsuB without PmdA, PmdB, and PmdC resulted only in the accumulation of a PCA glucose conjugate (FIG. 2A; FIG. 9). HPLC-ESI-TOF MS analysis of an authentic standard is used to assess the authenticity of PDC measured in metabolite extracts obtained from infiltrated tobacco leaves (FIG. 2B). It is also observed that co-infiltration of AroG* with QsuB increased the production of the PCA glucose conjugate by ˜2.5-fold compared with infiltrations with QsuB alone, which validates the efficacy of AroG* at enhancing the carbon flux through the shikimate pathway (FIG. 2A). The amount of PCA is reduced upon expression of the Pmd genes, which indicates a conversion of PCA into PDC in the complete pathway (FIG. 2A). Finally, a combinatorial approach showed that all three enzymes PmdA, PmdB, and PmdC are necessary for de-novo PDC synthesis since omitting one of the Pmd genes abolished PDC production (FIG. 9). In addition, among the examined de novo biosynthetic pathways for PDC synthesis depicted in FIG. 12A, the route using AroG*, QsuB, PmdA, PmdB and PmdC showed as the most promising pathway to have highest titer

    Enhancement of PCA Content in Arabidopsis Stems by Co-Expression of QsuB with Feedback-Insensitive AroG*

    [0111] An Arabidopsis line that express a plastid-targeted QsuB using the promoter of the cinnamate 4-hydroxylase gene (pAtC4H) (Eudes et al., 2015) is transformed with a construct (pAroG) for expression of plastid-targeted DAHP synthase AroG.sup.L175Q under the control of the Arabidopsis pAtCESA4 promoter for preferential expression in stems (FIG. 3, Panel A).

    [0112] Acid-hydrolyzed methanol extracts from five lines that contain both QsuB and AroG* transgenes show PCA titers up to 3.5-fold higher (0.4% dry weight) compared to those obtained from the parental line containing only QsuB (FIG. 4, Panels A and B). This result demonstrates that AroG* expression increases the carbon flux through the shikimate pathway and enables higher PCA synthesis in the Arabidopsis QsuB parental background.

    [0113] It is previously reported that QsuB expression leads to strong reductions of lignin content in Arabidopsis stems, which is presumably a consequence of a reduction of the shikimate pool required for lignin biosynthesis (Eudes et al., 2015). Here, compared to wild-type plants, lignin content is reduced by 40-45% in stems of transgenic lines containing both QsuB and AroG*, indicating that AroG* expression does not fully restore lignin content in the Arabidopsis QsuB background (FIG. 4, Panel C).

    Production of PDC and Reduction of Lignin by Co-Expressing AroG*, PmdA, PmdB, and PmdC in a QsuB Arabidopsis Background

    [0114] Considering that AroG* expression elevated PCA titers in an Arabidopsis line containing the QsuB gene, a ˜17-kb four gene construct (pPDC-4G) by stacking AroG* and the three PDC biosynthetic genes (PmdA, PmdB, and PmdC) is designed to produce PDC in this Arabidopsis QsuB background. The bacterial enzymes are targeted to plastids and expression of the corresponding genes is driven by promoters active in stem tissues that produce secondary cell wall such as fibers and xylem vessels (FIG. 3, Panel B). A preliminary metabolite screening is conducted to examine PDC production among the PDC-4G x QsuB transformants obtained in the T1 generation. Using LC-MS analysis, PDC is detected in methanol extracts obtained from stem biomass of twelve independent lines at the senesced mature stage, for which titers ranged from 1 to 9 mg/g DW and averaged 3.3±0.7 mg/g DW (FIG. 10). Next, the top three PDC-producing lines are further examined in the T2 generation. It is confirmed by PCR that these lines contain the AroG* and PmdABC genes in addition to the previously introduced QsuB gene (FIG. 5, Panel A), and validated the presence of PDC (ranging from 6.7 to 10.4 mg/g DW) in methanol-soluble metabolites extracted from stem biomass, which is not detected in extracts obtained from either wildtype or plants with QsuB alone (FIG. 5, Panel B). The drastic lignin reduction observed in the QsuB parental line is maintained in the PDC-4G x QsuB transgenics (ranging from 47 to 51%), which indicates a successful trait stacking for lignin reduction and in-planta accumulation of a value-added co-product (FIG. 5, Panel C). Lastly, transgenic lines harboring the pPDC-4G construct show no reduction of biomass yields compared with wild-type controls (FIG. 5, Panel D).

    In-Planta PDC Production by Stacking AroG*, QsuB, PmdA, PmdB, and PmdC on a Single Construct

    [0115] The production of PDC is evaluated in plants transformed with a five-gene construct (pPDC-5G) that consists of a ˜22-kb T-DNA containing AroG*, QsuB, and the three PDC biosynthetic genes PmdA, PmdB, and PmdC. In this construct, each gene is under the control of the same promoter used for the pPDC-4G construct, and the QsuB gene under the control of pAtC4H was included (FIG. 3, Panel C). A preliminary metabolite screening is conducted to examine PDC production among the PDC-5G transformants obtained in the T1 generation. PDC titers from the biomass of thirteen independent lines ranged between 4.5-36.7 mg/g DW and averaged 13.0±0.7 mg/g DW, which represents a significant increase compared to the titers achieved with the PDC-4G x QsuB primary transformants (FIG. 10). Six lines selected for further analyses show the presence of the five genes AroG*, QsuB, PmdA, PmdB, and PmdC in the T2 generation (FIG. 6A). For these lines, PDC amount in mature senesced stems range from 9.6 to 29.7 mg/g DW (FIG. 6B) and lignin content is reduced by 30-45% compared to wild-type plants (FIG. 6C). Importantly, most transgenic lines harboring the PDC-5G construct show no penalty in biomass yields compared with wild-type controls (FIG. 6D).

    Biomass Saccharification Efficiency of PDC-Producing Plants

    [0116] Biomass saccharification assays are performed to assess the cell wall recalcitrance of engineered PDC-producing lines. After a dilute alkaline pretreatment and a 96-h enzymatic digestion, higher release of glucose and xylose from the biomass of the engineered lines compared to wild-type controls is observed (FIG. 7). In conjunction with the reduction of lignin content measured in these lines, this result indicates a reduced recalcitrance of cellulose and xylan to enzymatic degradation. Improvements of saccharification efficiency ranged between 37% and 77% for glucose (FIG. 7, Panel A) and between 46% and 84% for xylose (FIG. 7, Panel B).

    DISCUSSION AND CONCLUSIONS

    [0117] PDC is a promising building block for diverse biodegradable polyesters and other polymers with novel functionalities. In this study, it is demonstrated for the first time that PDC synthesis can be achieved in plants, which represents a complementary approach to the microbial production systems previously described in the literature. Indeed, considering an integrated biorefinery process, bioenergy crops engineered with the strategy described in this work could potentially supply PDC as well as fermentable sugars for downstream PDC microbial production.

    [0118] The highest PDC titers in biomass (˜3% DW) are obtained with plants containing the five biosynthetic genes located on a single construct (pPDC-5G). These titers are higher than those achieved in plants transformed successively with constructs containing one gene (i.e., QsuB) and four genes (pPDC-4G), which is possibly the result of higher transgene expression in the pPDC-5G lines. Similar observations are made in sugarcane developed with a gene stacking approach using multiple or single vectors for overproduction of triacylglycerol (Parajuli et al., 2020), as well as engineered polyhydroxybutyrate producing switchgrass obtained either from the transformation of multigene constructs or by crossing individual transgenic lines (Somleva et al., 2008).

    [0119] A significant amount of the PCA intermediate is detected in Arabidopsis PDC producing lines, suggesting that synchronizing the spatiotemporal expression of 3-dehydroshikimate dehydratase (QsuB) and PCA 4,5-dioxygenase (PmdAB) could enable higher PCA utilization and PDC production. Unlike transient expression experiments in tobacco leaves in which QsuB, PmdA, and PmdB are under the control of the same constitutive promoter (p35S), the stable Arabidopsis lines are engineered with different promoters to drive expression of the various biosynthetic genes. This approach is intended to avoid misassembling of expression cassettes using the yeast homologous recombination-based cloning method and to limit gene silencing effects that sometimes occur across generations in plants with multiple copies of the same transgene sequence (Vaucheret et al., 2001). Specifically, pAtC4H used to drive QsuB expression in Arabidopsis may have a broader expression pattern compared to pAtGAUT12 used for PmdA expression since pAtC4H is active in epidermal tissues in addition to vascular tissues that produce secondary cell walls (Bell-Lelong et al., 1997; Peña et al., 2007). Therefore, the use of synthetic promoters to coordinate the expression of PDC biosynthetic genes could represent a promising approach towards optimizing transgenes expression and enhancing PDC titers (Belcher et al., 2020). Furthermore, it is observed that a PCA glucose conjugate accumulates when QsuB is expressed in plastids, which indicates a transit of free PCA from plastids to the cytosol where UDP-glycosyltransferases are located (FIG. 11). Therefore, another level of engineering towards improving PDC titers could consist in the identification and disruption of PCA exporter(s) located on the chloroplast envelope in order to retain PCA more efficiently. Indeed, the translocation of carboxylated aromatics across compartmental membranes is predicted to be an active process and PCA transporters have been identified in plants and bacteria (Ishimaru et al., 2011; Mori et al., 2008; Vermaas et al., 2019). Finally, considering that our de-novo PDC pathway is confined to plastids, integrating the corresponding biosynthetic genes as operons into the chloroplast genome could promote PDC synthesis, but chloroplast transformation techniques applied to bioenergy crops remain to be developed (Jin and Daniell, 2015).

    [0120] Besides employing a 3-dehydroshikimate dehydratase, overproduction of PCA can be achieved in plants by dual expression of plastid-targeted bacterial chorismate pyruvate-lyase and p-hydroxybenzoate hydroxylase (Eudes et al., 2016). This strategy reroutes chorismate, which is another intermediate of the shikimate pathway found upstream 3-dehydroshikimate (FIG. 1). Therefore, it would be interesting to evaluate whether combining this strategy with the expression of 3-dehydroshikimate dehydratase results in higher PCA titers in plant biomass.

    [0121] The reduction of lignin in plants expressing a bacterial 3-dehydroshikimate dehydratase (QsuB) has been attributed to a reduction of the cytosolic shikimate pool available for HCT during biosynthesis rather than a modification of phenylalanine content which is unchanged in extracts from QsuB plants (Eudes et al., 2015). Interestingly, although co-expression of DAHPS (AroG*) with QsuB led to higher PCA production, presumably by increasing the carbon flux through the shikimate pathway, lignin content remains low in plants carrying AroG* and QsuB (FIG. 4, Panel C; FIG. 5, Panel C; and, FIG. 6C). Previous studies reported that expression of AroG.sup.L175Q does not affect lignin content in Arabidopsis stems despite its positive effect on the content of various shikimate-derived metabolites including soluble phenylpropanoids, glucosinolates, and flavonoids (Tzin et al., 2012). Extended metabolite analyses need to be conducted in the transgenic plants to identify the possible metabolic bottlenecks that prevent lignin restoration. Nevertheless, low lignin is a desirable trait in crops since lignin has a negative impact on biomass processability in various agroindustrial applications including the manufacturing of second-generation bioproducts (Carpita and McCann, 2020). As anticipated, the reduction of lignin content in PDC-producing lines is accompanied with improvements of biomass saccharification efficiency (FIG. 7), which suggests that total polysaccharide hydrolysis and the release of fermentable sugars could be achieved with reduced enzyme loadings.

    [0122] Most Arabidopsis PDC producing lines show no reduction of biomass yields under controlled growth conditions (FIG. 5, Panel D; and FIG. 6D). These observations are encouraging and it will be important to evaluate plants' performance while transferring the engineering approach to bioenergy crops grown under field conditions. Glucose from lignocellulosic hydrolysates represent an attractive substrate for microbial synthesis of PDC, and a production yield of ˜35% (0.35 g PDC/g glucose) have been achieved using an engineered P. putida strain (Johnson et al., 2019). Considering this production yield and glucan contents ranging between 30-40% DW in currently proposed bioenergy crops such as sorghum and switchgrass (van der Weijde et al., 2013), it is estimated that ˜10.5-14 g of PDC can be potentially produced from 100 g of total biomass. Consequently, based on the best titers achieved with the present plant metabolic engineering approach (equivalent to 3 g PDC/100 g biomass), it is propose that PDC directly produced in crops could significantly contribute to overall PDC production in future biomass-based refineries that combine in-planta and microbial syntheses.

    TABLE-US-00021 TABLE 1 List of vectors used for tobacco infiltrations and jStack clonings. E. coli JBEI Name Level Purpose Ori E. coli selection ICE ID pPMS057 — Tobacco. pBR322 Kanamycin JBEI- infiltration 19576 pBca9145 Level DNA parts ColEI Carbenicillin JBEI- 0 isolation 19578 (j Stack) pPMS028 Level Intermediate p15A Chloramphenicol JBEI- 1 cloning 11601 (jStack) pPMS074 Level Plant ColEI Kanamycin JBEI- 2 transfor- 14584 mation (jStack)

    TABLE-US-00022 TABLE 2 Primer used in this study. Primer name Purpose/Target Sequence (5′-3′) BsaI- Part isolation/chl1-aroG [00001]embedded image schl1- ATATCCTC (SEQ ID NO: 80) aroG- Fw BsaI- [00002]embedded image schl1- GCCTTAAC (SEQ ID NO: 81) aroG-Rv BsaI- Part isolation/schl3-QsuB [00003]embedded image schl3- TCCTCCT (SEQ ID NO: 82) qsuB- Fw BsaI- [00004]embedded image schl3- CCTCTCTCTAAATC (SEQ ID NO: 83) qsuB- Rv BsaI- Part isolation/pAtRef8 [00005]embedded image pAtRef8- TCTCAATTCATATTGAA (SEQ ID NO: 84) Fw BsaI- [00006]embedded image pAtRef8- TTTTTATTTTCG (SEQ ID NO: 85) Rv Primer_1-F Genotyping/AroG* from AGAAGTTGGAAGCTCAAGCAA pAroBG and lines AroG* x (SEQ ID NO: 86) Primer_1-R Qsub CCCATCTCATAAATAACGTCATGC (SEQ ID NO: 87) Primer_2-F Genotyping/QsuB from CGCTACAGGAAGGTTAGGTGA lines AroG* x QsuB (SEQ ID NO: 88) Primer_2-R CACAGTTCGATAGCGAAAACCG (SEQ ID NO: 89) Primer_3-F Genotyping/AroG* in AGAAGTTGGAAGCTCAAGCAA pPDC-4G and lines PDC- (SEQ ID NO: 90) Primer_3-F 4G x QsuB CGTAGATGAAAGACTGAGTGC (SEQ ID NO: 91) Primer_4-F Genotyping/PmdA in AGCGCATAACCGAGAAAACC pPDC-4G and lines PDC- (SEQ ID NO: 92) Primer_4-F 4G x QsuB GGGAACAAAAGGAATAAAGAGGCA (SEQ ID NO: 93) Primer_5-F Genotyping/PmdB in CTCCACCAACTTTCCCCTACTT pPDC-4G and lines PDC- (SEQ ID NO: 94) Primer_5-F 4G x QsuB CACAGTTCGATAGCGAAAACCG (SEQ ID NO: 95) Primer_6-F Genotyping/PmdC in GGAAACCGCGACGATGAAAG pPDC-4G and lines PDC- (SEQ ID NO: 96) Primer_6-F 4G x QsuB CCCATCTCATAAATAACGTCATGC (SEQ ID NO: 97) Primer_7-F Genotyping/AroG* in AGAAGTTGGAAGCTCAAGCAA pPDC-5G and lines PDC- (SEQ ID NO: 98) Primer_7-F 5G CGTAGATGAAAGACTGAGTGC (SEQ ID NO: 99) Primer_8-F Genotyping/QsuB in CGCTACAGGAAGGTTAGGTGA pPDC-5G and lines PDC- (SEQ ID NO: 100) Primer_8-F 5G AGACAGATAAAGCCACGCACA (SEQ ID NO: 101) Primer_9-F Genotyping/PmdA in AGCGCATAACCGAGAAAACC pPDC-5G and lines PDC- (SEQ ID NO: 102) Primer_9-F 5G CACAGTTCGATAGCGAAAACCG (SEQ ID NO: 103) Primer_10-F Genotyping/PmdB in CTCCACCAACTTTCCCCTACTT pPDC-5G and lines PDC- (SEQ ID NO: 104) Primer_10-F 5G GGGAACAAAAGGAATAAAGAGGCA (SEQ ID NO: 105) Primer_11-F Genotyping/PmdC in GGAAACCGCGACGATGAAAG pPDC-5G and lines PDC- (SEQ ID NO: 106) Primer_11-F 5G CCCATCTCATAAATAACGTCATGC (SEQ ID NO: 107)

    TABLE-US-00023 TABLE 3 List of level-0 DNA parts used in this study. Construct JBEI name Backbone Description ICE ID {P_AtCESA4} pBca9145 Arabidopsis cellulose JBx_062461 synthase 4 (CESA4) promoter {P_AtGAUT12} pBca9145 Arabidopsis galacturonosyl JBx_062463 transferase 12 (GAUT12) promoter {P_AtC3′H} pBca9145 Arabidopsis coumarate 3′- JBx_094582 hydroxylase (C3′H) promoter {P_AtC4H} pBca9145 Arabidopsis cinnamate 4- JBx_042272 hydroxylase (C4H) promoter {P_AtCESA7} pBca9145 Arabidopsis cellulose JBx_062465 synthase 7 (CESA7) promoter {C_schl1- pBca9145 Plastid-targeted feedback- JBx_093489 aroG.sup.L175Q9} resistant DAHPS (AroG L175Q) from E. coli (WP_032246946) {C_schl2- pBca9145 Plastid-targeted PCA 4,5- JBx_142228 pmdA} dioxygenase alpha chain (PmdA) from C. testosterone (GenBank: EHN65776.1) {C_schl2- pBca9145 Plastid-targeted PCA 4,5- JBx_142229 pmdB} dioxygenase beta chain (PmdB) from C. testosterone (GenBank: EHN65777.1) {C_schl2- pBca9145 Plastid-targeted CHMS JBx_142230 pmdC} dehydrogenase (PmdC) from C. testosterone (GenBank: EHN65778.1) {C schl3- pBca9145 Plastid-targeted 3- JBx_092931 qsuB} dehydroshimiate dehydratase (QsuB) from C. glutamicum (GenBank: YP_001137362.1) {T_tG7} pBca9145 Agrobacterium tG7 terminator JBx_042392 {L_tG7} pBca9145 Agrobacterium tG7 linker JBx_042394 {T_tAtAct2} pBca9145 Arabidopsis actin 2 terminator JBx_042324 {L_tAtAct2} pBca9145 Arabidopsis actin 2 linker JBx_042344 {T_tAtRbcS} pBca9145 Arabidopsis Rubisco small JBx_042282 subunit terminator {L_tAtRbcS} pBca9145 Arabidopsis Rubisco small JBx_042288 subunit linker {T_tMAS} pBca9145 Agrobacterium mannopine JBx_042284 synthase terminator {L_tMAS} pBca9145 Agrobacterium mannopine JBx_042290 synthase linker {T_tNOS} pBca9145 Agrobacterium nopaline JBx_042266 synthase terminator {L_tOCS- pBca9145 Agrobacterium octopine JBx_065722 Hyg.sup.R} synthase terminator and plant hygromycin selectable marker, primary linker

    TABLE-US-00024 TABLE 4 List of plasmids used for transient expression in tobacco. JBEI Construct Name Description ICE ID pPMS057-schl1- Plastid-targeted feedback-resistant JBx_097054 AroG* 3-deoxy-D-arabinoheptulosonate 7-phosphate synthase(DAHPS, AroG L175Q) from E. coli (WP_032246946) pPMS057-schl2- Plastid-targeted PCA 4,5- JBx_100114 PmdA dioxygenase alpha chain (PmdA) from C. testosterone (GenBank: EHN65776.1) pPMS057-schl2- Plastid-targeted PCA 4,5- JBx_100115 PmdB dioxygenase beta chain (PmdB) from C. testosterone (GenBank: EHN65776.1) pPMS057-schl2- Plastid-targeted CHMS JBx_100116 PmdC dehydrogenase (PmdC) from C. testosterone (GenBank: EHN65778.1) pPMS057-schl2- Plastid-targeted PCA 3,4- JBx_144875 pcaG dioxygenase alpha chain (PcaG) from Pseudomonas putida (GenBank: WP_003251601.1) pPMS057-schl3- Plastid-targeted PCA 3,4- JBx_144876 pcaH dioxygenase beta chain (PcaH) from Pseudomonas putida (GenBank: WP_016489110.1) pPMS057-schl1- Plastid-targeted 2-pyrone-4,6- JBx_144877 LigI dicarboxylate hydrolase (LigI) from Sphingomonas paucimobilis (GenBank: BAA33799.1) pPMS057-schl3- Plastid-targeted 3-dehydroshimiate JBx_142226 QsuB dehydratase (QsuB) from C. glutamicum (GenBank: YP_001137362.1)

    TABLE-US-00025 TABLE 5 List of level-2 binary vectors and their intermediate level-1 constructs used in this study. Construct name Level Backbone Description JBEI ICE ID pAroG 2 pPMS074 tOCS-Hyg.sup.R-pAtCESA4::schl1-aroG.sup.L175Q-tNOS JBx_102760 tOCS-Hyg.sup.R-pAtCESA4::schl1-aroG.sup.L175Q-tNOS 1 pPMS028 Level-1 construct obtained with level-0 parts: JBx_102758 {L_tOCS-Hyg.sup.R} {P_AtCESA4} {C_schl1-aroG.sup.L175Q} {T_tNOS} pPDC-4G 2 pPMS074 tOCS-Hyg.sup.R-pAtCESA4::schl1-aroG.sup.L175Q-tG7-p JBx_102759 AtGAUT12::schl2-pmdA-tAtAct2-pAtC3′H::sc hl2-pmdB-tAtRbcS-pAtCESA7::schl2-pmdC-t NOS tOCS-Hyg.sup.R-pAtCESA4::schl1-aroG.sup.L175Q-tG7 1 pPMS028 Level-1 construct obtained with level-0 parts: JBx_096298 {L_tOCS-Hyg.sup.R} {P_AtCESA4} {C_schl1-aroG.sup.L175Q} {T_tG7} tG7-pAtGAUT12::schl2-pmdA-tAtAct2 1 pPMS028 Level-1 construct obtained with level-0 parts: JBx_102755 {L_tG7} {P_AtGAUT12} {C_schl2-pmdA} {T_tAtAct2} tAtAct2-pAtC3′H::schl2-pmdB-tAtRbcS 1 pPMS028 Level-1 construct obtained with level-0 parts: JBx_102756 {L_tAtAct2} {P_AtC3′H} {C_schl2-pmdB} {T_tAtRbcS} tAtRbcS-pAtCESA7::schl2-pmdC-tNOS 1 pPMS028 Level-1 construct obtained with level-0 parts: JBx_102757 {L_tAtRbcS} {P_AtCESA7} {C_schl2-pmdC} {T_tNOS} tOCS-Hyg.sup.R-pAtCESA4::schl1-aroG.sup.L175Q-tG7 1 pPMS028 Level-1 construct obtained with level-0 parts: JBx_096298 {L_tOCS-Hyg.sup.R} {P_AtCESA4} {C_schl1-aroG.sup.L175Q} {T_tG7} tG7-pAtC4H::schl3-qsuB-tMAS 1 pPMS028 Level-1 construct obtained with level-0 parts: JBx_097321 {L_tG7} {P_AtC4H} {C_schl3-qsuB} {T_tMAS} tMSA-pAtGAUT12::schl2-pmdA-tRBCS 1 pPMS028 Level-1 construct obtained with level-0 parts: JBx_144633 {L_tMSA} {P_AtGAUT12} {C_schl2-pmdA} {T_tRBCS} tRBCS-pAtC3′H::schl2-pmdB-tAtAct2 1 pPMS028 Level-1 construct obtained with level-0 parts: JBx_144633 {L_tRBCS} {P_AtC3′H} {C_schl2-pmdB} {T_tAtAct2} tAtAct2-pAtCESA7::schl2-pmdC-tNOS 1 pPMS028 Level-1 construct obtained with level-0 parts: JBx_144635 {L_tAtAct2} {P_AtCESA7} {C_schl2-pmdC} {T_tNOS}

    REFERENCES CITED HEREIN

    [0123] Altpeter, F., Springer, N. M., Bartley, L. E., Blechl, A. E., Brutnell, T. P., Citovsky, V., Conrad, L. J., Gelvin, S. B., Jackson, D. P., Kausch, A. P., Lemaux, P. G., Medford, J. I., Orozco-Cárdenas, M. L., Tricoli, D. M., Van Eck, J., Voytas, D. F., Walbot, V., Wang, K., Zhang, Z. J., Stewart, C. N., 2016. Advancing crop transformation in the era of genome editing. Plant Cell 28,1510-1520.
    Amore, A., Ciesielski, P. N., Lin, C.-Y., Salvachúa, D., Sànchez i Nogué, V., 2016. Development of lignocellulosic biorefinery technologies: Recent advances and current challenges. Aust. J. Chem. 69, 1201-1218.
    Aznar, A., Chalvin, C., Shih, P. M., Maimann, M., Ebert, B., Birdseye, D. S., Loqué, D., Scheller, H. V., 2018. Gene stacking of multiple traits for high yield of fermentable sugars in plant biomass. Biotechnol. Biofuels 11:2.
    Bailey-Serres, J., Parker, J. E., Ainsworth, E. A., Oldroyd, G. E. D., Schroeder, J. I., 2019. Genetic strategies for improving crop yields. Nature 575, 109-118.
    Baral, N. R., Sundstrom, E. R., Das, L., Gladden, J., Eudes, A., Mortimer, J. C., Singer, S. W., Mukhopadhyay, A., Scown, C. D., 2019. Approaches for more efficient biological conversion of lignocellulosic feedstocks to biofuels and bioproducts. ACS Sustain. Chem. Eng. 7, 9062-9079.
    Bechtold, N., Pelletier, G., 1998. In planta Agrobacterium-mediated transformation of adult Arabidopsis thaliana plants by vacuum infiltration. In: Martinez-Zapater, J. M., Salinas, J., Eds.), Arabidopsis Protocols. Humana Press, Totowa, N.J., pp. 259-266.
    Belcher, M., Vuu, K., Zhou, A., Mansoori, N., Ramos, A., Thompson, M., Scheller, H., Loqué, D., Shih, P. M., 2020. Design of orthogonal regulatory systems for modulating gene expression in plants. Nat. Chem. Biol. 16, 857-865.
    Bell-Lelong, D. A., Cusumano, J. C., Meyer, K., Chapple, C., 1997. Cinnamate-4-hydroxylase expression in Arabidopsis. Regulation in response to development and the environment. Plant Physiol. 113, 729-738.
    Bito, M., Michinobu, T., Katayama, Y., Otsuka, Y., Nakamura, M., Ohara, S., Masai, E., Shigehara, K., 2008. 2-Pyrone-4,6-dicarboxylic acid as a source of green-plastics and antibacterial chemicals. Trans. Mater. Res. Soc. Japan 33, 1165-1168.
    Börnke, F., Broer, I., 2010. Tailoring plant metabolism for the production of novel polymers and platform chemicals. Curr. Opin. Plant Biol. 13, 354-362.
    Carpita, N. C., McCann, M. C., 2020. Redesigning plant cell walls for the biomass-based bioeconomy. J. Biol. Chem. doi: 10.1074/jbc.REV120.014561.
    Eudes, A., Berthomieu, R., Hao, Z., Zhao, N., Benites, V. T., Baidoo, E. E. K., Loqué, D., 2018. Production of muconic acid in plants. Metab. Eng. 46, 13-19.
    Eudes, A., Juminaga, D., Baidoo, E. E. K., Collins, F. W., Keasling, J. D., Loqué, D., 2013. Production of hydroxycinnamoyl anthranilates from glucose in Escherichia coli. Microb. Cell Fact. 12, 62.
    Eudes, A., Liang, Y., Mitra, P., Loqué, D., 2014. Lignin bioengineering. Curr. Opin. Plant Biol. 26, 189-198.
    Eudes, A., Pereira, J. H., Yogiswara, S., Wang, G., Teixeira Benites, V., Baidoo, E. E. K., Lee, T. S., Adams, P. D., Keasling, J. D., Loqué, D., 2016. Exploiting the substrate promiscuity of hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyl transferase to reduce lignin. Plant Cell Physiol. 57, 568-579.
    Eudes, A., Sathitsuksanoh, N., Baidoo, E. E. K., George, A., Liang, Y., Yang, F., Singh, S., Keasling, J. D., Simmons, B. A., Loqué, D., 2015. Expression of a bacterial 3-dehydroshikimate dehydratase reduces lignin content and improves biomass saccharification efficiency. Plant Biotechnol. J. 13, 1241-1250.
    Hishida, M., Shikinaka, K., Katayama, Y., Kajita, S., Masai, E., Nakamura, M., Otsuka, Y., Ohara, S., Shigehara, K., 2009. Polyesters of 2-pyrone-4,6-dicarboxylic acid (PDC) as bio-based plastics exhibiting strong adhering properties. Polym. J. 41, 297-302.
    Ishimaru, Y., Kakei, Y., Shimo, H., Bashir, K., Sato, Y., Sato, Y., Uozumi, N., Nakanishi, H., Nishizawa, N. K., 2011. A rice phenolic efflux transporter is essential for solubilizing precipitated apoplasmic iron in the plant stele. J. Biol. Chem. 286, 24649-24655.
    Jin, S., Daniell, H., 2015. The engineered chloroplast genome just got smarter. Trends Plant Sci. 20, 622-640.
    Johnson, C. W., Salvachúa, D., Rorrer, N. A., Black, B. A., Vardon, D. R., St. John, P. C., Cleveland, N. S., Dominick, G., Elmore, J. R., Grundl, N., Khanna, P., Martinez, C. R., Michener, W. E., Peterson, D. J., Ramirez, K. J., Singh, P., VanderWall, T. A., Wilson, A. N., Yi, X., Biddy, M. J., Bomble, Y. J., Guss, A. M., Beckham, G. T., 2019. Innovative chemicals and materials from bacterial aromatic catabolic pathways. Joule 3, 1523-1537.
    Kang, M. J., Kim, H. T., Lee, M-W., Kim, K-A., Khang, T. U., Song, H. M., Park, S. J., Joo, J. C., Cha, H. G., 2020. A chemo-microbial hybrid process for the production of 2-pyrone-4,6-dicarboxylic acid as a promising bioplastic monomer from PET waste. Green Chem., 22, 3461-3469.
    Lebrun, M., Leroux, B., Sailland, A., 1992. Gène chimère pour la transformation des plantes. European patent application. Patent Application No. EP 508909A1.
    Lin, C-Y., Eudes, A., 2020. Strategies for the production of biochemicals in bioenergy crops. Biotechnol Biofuels. 13, 71.
    Loqué, D., Scheller, H. V., Pauly, M., 2015. Engineering of plant cell walls for enhanced biofuel production. Curr. Opin. Plant Biol. 25, 151-161.
    Luo, Z. W., Kim, W. J., Lee, S. Y., 2018. Metabolic engineering of Escherichia coli for efficient production of 2-pyrone-4,6-dicarboxylic acid from glucose. ACS Synth. Biol. 7, 2296-2307.
    Markel, K., Belcher, M. S., Shih, P. M., 2020. Defining and engineering bioenergy plant feedstock ideotypes. Curr. Opin. Biotech. 62, 196-201.
    Michinobu, T., Bito, M., Tanimura, M., Katayama, Y., Masai, E., Nakamura, M., Otsuka, Y., Ohara, S., Shigehara, K., 2010. Synthesis and characterization of hybrid biopolymers of L-lactic acid and 2-pyrone-4,6-dicarboxylic acid. J. Macromol. Sci. A. 47, 564-570.
    Michinobu, T., Bito, M., Yamada, Y., Tanimura, M., Katayama, Y., Masai, E., Nakamura, M., Otsuka, Y., Ohara, S., Shigehara, K., 2009. Fusible, elastic, and biodegradable polyesters of 2-pyrone-4,6-dicarboxylic acid (PDC). Polym. J. 41, 1111-1116.
    Michinobu, T., Hishida, M., Sato, M., Katayama, Y., Masai, E., Nakamura, M., Otsuka, Y., Ohara, S., Shigehara, K., 2008. Polyesters of 2-pyrone-4,6-dicarboxylic acid (PDC) obtained from a metabolic intermediate of lignin. Polym. J. 40, 68-75.
    Mori, K., Kamimura, N., Masai, E., 2018. Identification of the protocatechuate transporter gene in Sphingobium sp. strain SYK-6 and effects of overexpression on production of a value-added metabolite. Appl. Microbiol. Biotechnol. 102, 4807-4816.
    Nakajima, M., Nishino, Y., Tamura, M., Mase, K., Masai, E., Otsuka, Y., Nakamura, M., Sato, K., Fukuda, M., Shigehara, K., Ohara, S., Katayama, Y., Kajita, S., 2009. Microbial conversion of glucose to a novel chemical building block, 2-pyrone-4,6-dicarboxylic acid. Metab. Eng. 11, 213-220.
    Otsuka, Y., Nakamura, M., Shigehara, K., Sugimura, K., Masai, E., Ohara, S., Katayama, Y., 2006. Efficient production of 2-pyrone 4,6-dicarboxylic acid as a novel polymer-based material from protocatechuate by microbial function. Appl. Microbiol. Biotechnol. 71, 608-614.
    Parajuli, S., Kannan, B., Karan, R., Sanahuja, G., Liu, H., Garcia-Ruiz, E., Kumar, D., Singh, V., Zhao, H., Long, S., Shanklin, J., Altpeter, F., 2020. Towards oilcane: Engineering hyperaccumulation of triacylglycerol into sugarcane stems. GCB Bioenergy 12, 476-490.
    Peña, M. J., Zhong, R., Zhou, G. K., Richardson, E. A., O'Neill, M. A., Darvill, A. G., York, W. S., Ye, Z. H., 2007 Arabidopsis irregular xylem8 and irregular xylem9: implications for the complexity of glucuronoxylan biosynthesis. Plant Cell 19, 549-563.
    Perez, J. M., Kontur, W. S., Alherech, M., Coplien, J., Karlen, S. D., Stahl, S. S., Donohue, T. J., Noguera, D. R., 2019. Funneling aromatic products of chemically depolymerized lignin into 2-pyrone-4-6-dicarboxylic acid with Novosphingobium aromaticivorans. Green Chem. 21, 1340-1350.
    Qian, Y., Otsuka, Y., Sonoki, T., Mukhopadhyay, B., Nakamura, M., Jellison, J., Goodell, B., 2016. Engineered microbial production of 2-pyrone-4,6-dicarboxylic acid from lignin residues for use as an industrial platform chemical. BioResources. 11, 6097-6109.
    Shih, P. M., Vuu, K., Mansoori, N., Ayad, L., Louie, K. B., Bowen, B. P., Northen, T. R., Loqué, D., 2016. A robust gene-stacking method utilizing yeast assembly for plant synthetic biology. Nat. Commun. 7, 13215.
    Shikinaka, K., Hashimoto, Y., Kajita, S., Masai, E., Katayama, Y., Nakamura, M., Otsuka, Y., Ohara, S., Shigehara, K., 2013. Thermoplastic polyesters of 2-pyrone-4,6-dicarboxylic acid (PDC) obtained from a metabolic intermediate of lignin. Sen'i Gakkaishi 69, 39-47.
    Shikinaka, K., Otsuka, Y., Iguchi, Y., Nakamura, M., Itoh, Y., Masai, E., Katayama, Y., Shigehara, K., 2016. Preferential cesium ion trapping by 2-pyrone-4,6-dicarboxylic acid (PDC) obtained from a metabolic intermediate of lignin, a woody biomass resource. J. Nucl. Sci. Technol. 53, 1256-1259.
    Shikinaka, K., Otsuka, Y., Nakamura, M., Masai, E., Katayama, Y., 2018. Utilization of lignocellulosic biomass via novel sustainable process. J. Oleo Sci. 67, 1059-1070.
    Snell, K. D., Singh, V., Brumbley, S. M., 2015. Production of novel biopolymers in plants: recent technological advances and future prospects. Curr. Opin. Biotech. 32, 68-75.
    Somleva, M. N., Snell, K. D., Beaulieu, J. J., Peoples, 0. P., Garrison, B. R., Patterson, N. A., 2008. Production of polyhydroxybutyrate in switchgrass, a value-added co-product in an important lignocellulosic biomass crop. Plant Biotechnol. J. 6, 663-678.
    Sparkes, I. A., Runions, J., Kearns, A., Hawes, C., 2006. Rapid, transient expression of fluorescent fusion proteins in tobacco plants and generation of stably transformed plants. Nat. Protoc. 1, 2019-2025.
    Suzuki, S., Suzuki, Y., Yamamoto, N., Hattori, T., Sakamoto, M., Umezawa, T., 2009. High-throughput determination of thioglycolic acid lignin from rice. Plant Biotechnol. 26, 337-340.
    Tzin, V., Malitsky, S., Zvi, M. M. B., Bedair, M., Sumner, L., Aharoni, A., Galili, G., 2012. Expression of a bacterial feedback-insensitive 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase of the shikimate pathway in Arabidopsis elucidates potential metabolic bottlenecks between primary and secondary metabolism. New Phytol. 194, 430-439.
    Vanhercke, T., Dyer, J. M., Mullen, R. T., Kilaru, A., Rahman, M. M., Petrie, J. R., Green, A. G., Yurchenko, O., Singh, S. P., 2019. Metabolic engineering for enhanced oil in biomass. Prog. Lipid Res. 74, 103-129.
    Van Der Weijde, T., Alvim Kamei, C. L., Torres, A. F., Vermerris, W., Dolstra, O., Visser, R. G. F., Trindade, L. M., 2013. The potential of C4 grasses for cellulosic biofuel production. Front. Plant Sci. 4, 1-18.
    Vaucheret, H., Béclin, C., Elmayan, T., Feuerbach, F., Godon, C., Morel, J. B., Mourrain, P., Palauqui, J. C., Vernhettes, S., 1998. Transgene-induced gene silencing in plants. Plant J. 16, 651-659.
    Vermaas, J. V., Dixon, R. A., Chen, F., Mansfield, S. D., Boerjan, W., Ralph, J., Crowley, M. F., Beckham, G. T., 2019. Passive membrane transport of lignin-related compounds. Proc. Natl. Acad. Sci. USA 116, 23117-23123.
    Wilkes, S., Glasl, H., 2001. Isolation, characterization, and systematic significance of 2-pyrone-4,6-dicarboxylic acid in Rosaceae. Phytochemistry 58, 441-449.
    Wu, W., Dutta, T., Varman, A. M., Eudes, A., Manalansan, B., Loqué, D., Singh, S., 2017. Lignin valorization: Two hybrid biochemical routes for the conversion of polymeric lignin into value-added chemicals. Sci. Rep. 7, 8420.
    Yang, M., Baral, N. R., Simmons, B. A., Mortimer, J. C., Shih, P. M., Scown, C. D., 2020. Accumulation of high-value bioproducts in planta can improve the economics of advanced biofuels. Proc. Natl. Acad. Sci. U.S.A 117, 8639-8648.
    Yuan, L., Grotewold, E., 2015. Metabolic engineering to enhance the value of plants as green factories. Metab. Eng. 27, 83-91.

    [0124] While the present invention has been described with reference to the specific embodiments thereof, it should be understood by those skilled in the art that various changes may be made and equivalents may be substituted without departing from the true spirit and scope of the invention. In addition, many modifications may be made to adapt a particular situation, material, composition of matter, process, process step or steps, to the objective, spirit and scope of the present invention. All such modifications are intended to be within the scope of the claims appended hereto.