Specific GNAI:GIV interaction screening assays, methods and compositions
11366121 · 2022-06-21
Assignee
Inventors
Cpc classification
C07K19/00
CHEMISTRY; METALLURGY
C07K14/723
CHEMISTRY; METALLURGY
A61K31/185
HUMAN NECESSITIES
G01N2333/726
PHYSICS
G01N33/6845
PHYSICS
G01N2500/02
PHYSICS
International classification
A61K31/185
HUMAN NECESSITIES
Abstract
Research tool assay for identifying a specific modulator of GNAI, compositions and methods of use. The assay includes combining a drug candidate with GNAI and a C-terminal GIV peptide and determining if the drug candidate inhibits GNAI interaction with the C-terminal GIV peptide; and combining the drug candidate with GNAI and a DAPLE peptide and determining if the drug candidate inhibits GNAI interaction with DAPLE peptide. Also provided are compositions and methods of treatment relating to the same.
Claims
1. A research tool assay for identifying a specific modulator of guanine nucleotide-binding protein alpha (GNAI), comprising a. combining a drug candidate with GNAI and a C-terminal Girdin (GIV) peptide comprising the amino acid sequence of SEQ ID NO:1 and determining if the drug candidate inhibits GNAI interaction with the C-terminal GIV peptide; and b. combining the drug candidate with GNAI and a Dvl-associated protein with high frequency of leucine (DAPLE) peptide comprising the amino acid sequence of SEQ ID NO:2 and determining if the drug candidate inhibits GNAI interaction with the DAPLE peptide, wherein the drug candidate is identified as a specific modulator of GNAI when the drug candidate inhibits interaction with the C-terminal GIV peptide, and does not inhibit GNAI interaction with the DAPLE peptide.
2. The assay of claim 1, wherein the determining steps are detected by fluorescent polarization.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
DETAILED DESCRIPTION
(26) The present invention provides high-throughput screening assays to identify small molecule specific inhibitors of the GNAI:GIV interface as drug candidates, compositions and methods of use resulting therefrom. The screening assays of the present invention provide non-naturally occurring specific in vitro applications of inventive concepts in the form of unique research tools to identify drug candidates for further in vivo testing and therapeutic use.
(27) It is to be understood that the invention is not limited in its application to the details of construction and the arrangement of components set forth in the following description or illustrated in the drawings.
(28) When introducing elements of the present invention or the preferred embodiment(s) thereof, the articles “a”, “an”, “the” and “said” are intended to mean that there are one or more of the elements. The terms “comprising”, “including” and “having” are intended to be inclusive and mean that there may be additional elements other than the listed elements.
(29) As used herein, “inhibit” or “inhibition” or “inhibits” refers to a reduction in normal activity, in embodiments a reduction below average minus 3 standard deviations, or minus 5 standard deviations.
(30) As used herein, the term “pharmaceutical composition” contemplates compositions comprising one or more therapeutic compounds, agents or drugs as described below, and one or more pharmaceutically acceptable excipients, carriers, or vehicles.
(31) As used herein, the term “pharmaceutically acceptable excipients, carriers, or vehicles” comprises any acceptable materials, and/or any one or more additives known in the art. As used herein, the term “excipients,” “carriers,” or “vehicle” refer to materials suitable for drug administration through various conventional administration routes known in the art. Excipients, carriers, and vehicles useful herein include any such materials known in the art, which are nontoxic and do not interact with other components of the composition in a deleterious manner, and generally refers to an excipient, diluent, preservative, solubilizer, emulsifier, adjuvant, and/or vehicle with which an active agent or drug is administered. Such carriers may be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents. Antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; and agents for the adjustment of tonicity such as sodium chloride or dextrose may also be a carrier. Methods for producing compositions in combination with carriers are known to those of skill in the art. In some embodiments, the language “pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art.
(32) The present invention provides a research tool assay for identifying a specific modulator of GNAI, comprising: (a) combining a drug candidate with GNAI and a C-terminal GIV peptide and determining if the drug candidate inhibits GNAI interaction with the C-terminal GIV peptide; and (b) combining the drug candidate with GNAI and a DAPLE peptide and determining if the drug candidate inhibits GNAI interaction with DAPLE peptide. In embodiments, the drug candidate is identified as a specific modulator of GNAI when the drug candidate inhibits interaction with the C-terminal GIV peptide, and does not inhibit GNAI interaction with the DAPLE peptide.
(33) In embodiments, the C-terminal GIV peptide comprises the amino acid sequence of SEQ ID NO: 1. In embodiments, the DAPLE peptide comprises the amino acid sequence of SEQ ID NO:2.
(34) In embodiments, the determining steps are detected by fluorescent polarization.
(35) The invention further provides a method of specifically modulating GNAI to treat a patient in need thereof, comprising administering to the patient an effective amount of a compound that inhibits GNAI interaction with a C-terminal GIV peptide, and does not inhibit GNAI interaction with DAPLE. In embodiments, the compound is ATA, or a functional analog or derivative thereof. In embodiments, the compound is NF023, or a functional analog or derivative thereof. In embodiments, the method is effective to treat cancer, fibrogenesis, diabetes, aging, or infertility.
(36) The invention further provides a pharmaceutical composition comprising a pharmaceutically acceptable excipient and an effective amount of a compound that inhibits GNAI interaction with a C-terminal GIV peptide, and does not inhibit GNAI interaction with DAPLE. In embodiments, the compound is ATA, or a functional analog or derivative thereof. In embodiments, the compound is NF023, or a functional analog or derivative thereof. In embodiments, the method is effective to treat cancer, fibrogenesis, diabetes, aging, or infertility.
(37) In embodiments, the invention provides an assay and method for screening for drug candidates which act as specific inhibitors against the GNAI:GIV interface. In embodiments, the invention provides an assay and method for screening a drug candidate using GIV or a fragment thereof comprising or consisting essentially of a small part of the GIV molecule (at least 31 aa on its C-terminus) (such as GIV peptide: KTGSPGSEVVTLQQFLEESNKLTSVQIKSSS (SEQ ID NO: 1)). The identified GIV GBA peptide gives information on the GNAI:GIV interface and can be disrupted with small molecule drug candidates.
(38) In a subsequent step, drug candidates that inhibit the GNAI:GIV interface are tested in a secondary screen involving GNAI:DAPLE, which will eliminate small molecules that do not have specificity against GNAI:GIV interface. Therefore, in this step, the drug candidate is screened for its inability to inhibit the GNAI:DAPLE interface using DAPLE or a fragment thereof comprising or consisting essentially of a small part of the molecule (such as DAPLE peptide: SASPSSEMVTLEEFLEESNRSSPTHDTPSCRDDL (SEQ ID NO:2)). This will ensure identifying specific inhibitors that will not cross-inhibit the GNAI:DAPLE interface (with which GNAI:GIV interface shares similarities), because DAPLE's ability to bind and activate GNAI is critical for tumor suppression and inhibiting that interface (as a potential side effect of inhibitors against the GNAI:GIV interface) is highly undesirable.
(39) As for the first step in the assay, this small region of 31 aa GIV peptide: KTGSPGSEVVTLQQFLEESNKLTSVQIKSSS (SEQ ID NO: 1) was arrived at after careful biochemistry determined that anything less than this is less efficient in binding or activation the G protein, GNAI. The invention provides that this peptide sequence can be adapted in HTP screens to accurately pick up the effective agonists/antagonists against the druggable interface GNAI:GIV.
(40) As for the second step, it is not common knowledge that the orthologue of GIV, DAPLE, also binds GNAI and uses a similar hydrophobic binding cleft on which GIV docks. It was discovered that DAPLE's ability to bind GNAI has differences from how GIV binds GNAI. It is these differences that achieve specificity of molecular inhibitors to target the GNAI:GIV interface, without affecting the GNAI:DAPLE interface. The DAPLE peptide SASPSSEMVTLEEFLEESNRSSPTHDTPSCRDDL (SEQ ID NO:2) is the appropriate secondary screen to eliminate the molecules that non-specifically target both GNAI:GIV and GNAI:DAPLE interfaces.
(41) As will be appreciated, performing the first step described above initially will insure the second step is screening for effective inhibitors, however, the invention contemplates that the order of the steps can be reversed. The invention contemplates compositions comprising the tools and reagents necessary for conducting the screening assays, in particular screening for molecules which selectively inhibit the GNAI interface with molecules comprising, or consisting essentially of, the GIV peptide KTGSPGSEVVTLQQFLEESNKLTSVQIKSSS (SEQ ID NO: 1) or the DAPLE peptide SASPSSEMVTLEEFLEESNRSSPTHDTPSCRDDL (SEQ ID NO:2), and a detectable moiety.
EXAMPLES
Example 1
(42) A pilot screen of the LOPAC1280 library (collection of known bioactive compounds) was conducted and identified lead compounds with inhibitory activity (FIG. 11A). A virtual ligand screen (VLS) of the same library (LOPAC1280) was conducted using in silico docking methods [33-35] (
(43) The invention provides therapeutic compositions comprising compounds identified by the screening methods, and analogs and derivatives thereof, in a pharmaceutically acceptable excipient. Exemplary compounds provided by the screening assay of the present invention are aurintricarboxylic acid (ATA) and 8,8′-[carbonylbis(imino-3,1-phenylenecarbonylimino)]bis(1,3,5-naphthalene-trisulfonic acid) hexasodium salt (NF-023) and 4-[3-(4-Acetyl-3-hydroxy-2-propylphenoxy)propxylphenoxyacetic acid (L-165,041). ATA is listed as a DNA topoisomerase II inhibitor in the Sigma LOPAC library database, and it has also been shown to inhibit cysteine proteases such as calpain and caspases 3, 6, 7, and 9. NF-023 is listed as a potent, selective P2X1 receptor antagonist in the Sigma LOPAC library database, and is an analog of suramin, a hexasulfonated naphthylurea.
(44) ##STR00001##
DISCUSSION
(45) GIV can be referred to as a GEM because of its ability to serve as a GEF [activator] of GNAI as well as a GDI [inhibitor] for GNAS. By working in this sort of dual mode, GIV-GEM can coordinately lower cellular cAMP levels by activating the inhibitor of adenylyl cyclase [GNAT] and inhibiting the stimulator of adenylyl cyclase [GNAS]. This is unlike what happens in the case of GPCRs, the most drugged/targeted component of cAMP signaling to date. (see
(46)
(47) The reason GIV-GEM and other GEMs can be major targetable components is because cAMP is most important in the biological activities shown in
(48) The Gbetagamma dependent component of signaling that is initiated when GIV-GEMs release free Gbg subunits from GNAI and GNAS, has been shown to be important for signaling via PI3K, Rac1 and other such intermediates. Therefore, GIV-GEM initiates two pronged signaling: cAMP via GNAI/GNAS [alpha subunits of heterotrimeric G proteins] and Gbetagamma signaling via its own intermediates. Both components are important for the holistic impact of GIV-GEM in disease states.
(49) Recent work using systems biology has shown that levels of GIV-GEM being high vs low acts like a tunable valve for cAMP flow in signaling circuits. Briefly, systems approach was used to build a circuit for growth factor dependent cAMP signaling via G proteins, GNAI and GNAS. The model was first validated using cell based and biochemical assays for key reaction steps. The model captured the key observed dynamics of EGFR-GIV-G protein complex formation, GNAS-GIV complex formation, and then cAMP, PKA and pCREB signaling. This model inquires as to what impact does high vs low GIV have on cAMP signaling downstream of growth factors. Results of such simulations are shown in
(50) Non-canonical growth factor-dependent cAMP signaling is prolonged and largely on internal membranes.
(51)
(52) Using systems approaches determined that GIV-GEM operates in 2 regimes. See figures and legend below. The GEF effect on GNAI is a predominant effect early on. The GDI effect on GNAS is the predominant effect later.
(53)
(54)
(55)
(56) Based on the above, it can be concluded that GIV-GEM serves as a tunable valve for cAMP signaling:
(57)
(58) Therefore, the invention provides strategies for drug development in GIV-driven diseases.
(59) The best drugs to target this novel modulator of cAMP and elevate cAMP levels in disorders characterized by HIGH-GIV and low-cAMP [like invasive cancers and fibrogenic diseases] is to tackle both GEF and GDI functions of GIV. The Gbetagamma side of signaling will be automatically stopped if GIV can be inhibited from activating trimeric G proteins Gi or inhibiting trimeric Gs.
(60) So as to not block any G protein signaling via canonical pathways, avoid targeting the G protein, or finding molecules that can sit in transient pockets created during nucleotide exchange. Finding such molecules may be acceptable for some biochemical research use, but will derail canonical G protein signaling cascades via GPCRs.
(61) The addition of PDE inhibitors to GIV-inhibitors should provide adjuvant benefit PDE inhibitors will reduce cAMP removal, and further augment cAMP conc in cells.
(62) The preferred molecules will be those that can bind GIV and alter the exposure of the GEM module on GIV which has a dual role and can serve as GEF and GDI on two G proteins. This should be possible because it has been published earlier [Lin C et al., MBoC 2014] that GIV's CT is intrinsically disordered, and when bound to proteins, it is known to change conformation.
(63) The preferred molecules will also be those which can bind GIV and target it for degradation, effectively reducing the copy numbers in cells. This is a possibility because the protein may be rendered as ‘poorly folded or wrongly folded’ when bound to ‘drug,’ and such forms may be targeted by cells for degradation. Thus, a part of small molecule drug candidate screening, levels of GIV mRNA and protein can be measured in cells, such as by qPCR and Immunoblotting; while proteins should be reduced, in proteasome-dependent manner, mRNA could remain detectable/constant/go down due to the loss of positive feedback loop between STAT3 [transcriptional activator of GIV] and GIV [which activates STAT3 signaling via GEM function] (Dunkel Y et al., JBC 2011).
(64) In embodiments, the invention provides a screen for small molecules that disrupt GIV-CT's [˜210 aa] ability to bind or modulate nucleotide exchange in Gαi or Gas. This screening research tool assay can comprise the following steps.
(65) Step 1—Protein-protein interaction assay: any kind [by any assay, FP, or others] i. pre-incubate GIV-CT with small molecules. One may pre-screen at this stage to find which molecules are binding to GIV using either CD spectroscopy or other methods; ii. add G proteins, either Gαi and Gas to the reaction; and iii. identify some negative or some positive allosteric modulators of GEM function (NAMs and some PAMs).
(66) In Step 2—Measure enzyme activity [by GTPase assays-HTP methods].
(67) If STEP 2 is carried out before STEP 1, then do pre-incubation with small molecules, then remove excess of the unbound molecules, before exposing the G proteins to exchanging conditions. This will avoid the possible jamming of some of the molecules in pockets of G proteins exposed during transition states of exchange.
(68) If the above caution cannot be done, then extra step should be included that G proteins Gαi and Gas with small molecule alone should be incubated and tested for their ability to inhibit or alter in any way the basal nucleotide exchange observed in monomeric alpha subunits in vitro.
(69) In Step 3—Cell-based assays: i. GIV protein levels by immunoblotting, ii. GIV mRNA by qPCR, iii. cAMP assays—kits commercial, iv. pAkt, other signaling pathways, AND v. cell invasion, apoptosis, proliferation, differentiation, stemness.
(70) These and other features of the embodiments of the invention will become apparent to the skilled artisan upon a review of the present disclosure and appended claims.